RPSBLAST alignment of GI: 254780638 and protein with PDBid: 2yua

>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99
 Score = 84.3 bits (208), Expect = 4e-17
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
            +   Y +LG+   AT  Q+K A+      YHPD+N    EA E+F +IS+AY VL   
Sbjct: 14 YSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSA 73

Query: 61 QKRALYDQGGHEALEYGAQSQGAGGFG 87
            R  YD+G     +   +  G+G   
Sbjct: 74 TLRRKYDRGLLS--DEDLRGPGSGPSS 98