RPSBLAST alignment of GI: 254780638 and protein with PDBid: 3ag7

>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106
 Score = 76.9 bits (189), Expect = 7e-15
 Identities = 7/62 (11%), Positives = 24/62 (38%), Gaps = 7/62 (11%)

Query: 5   DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDP-------EAKEKFAQISEAYEVL 57
             ++ + +        ++ +++   +  HPD+ +           A++ F  + EA++  
Sbjct: 41  SGWKPVPLMDMIEGNAVRKSYQRALLILHPDKLQQKGASANQKYMAEKVFELLQEAWDHF 100

Query: 58  RD 59
             
Sbjct: 101 NT 102