RPSBLAST alignment of GI: 254780638 and protein with PDBid: 3hho

>3hho_A CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae} Length = 174
 Score = 77.9 bits (191), Expect = 4e-15
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 5  DFYQVLGIDRNAT--DRQLKTAFRSLAMKYHPDQNRNDPE-----AKEKFAQISEAYEVL 57
          +++++ G+          L + FR+L  ++HPD      E     A ++ AQI++AY+ L
Sbjct: 5  NYFELFGLPIQFELDGSLLSSQFRALQKRFHPDNFATASERDRLMAVQQAAQINDAYQTL 64

Query: 58 RDPQKRALYDQGGH 71
          +DP +RA Y     
Sbjct: 65 KDPLRRAEYLLSLQ 78