RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780638|ref|YP_003065051.1| molecular chaperone protein
DnaJ [Candidatus Liberibacter asiaticus str. psy62]
         (384 letters)



>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's
           yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 90

 Score =  101 bits (252), Expect = 1e-22
 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 267 FKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVI- 325
           FKRDG DL  T+P+S     +G +  + T+D     ++  +  Q  +     G+GMP   
Sbjct: 2   FKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPK 61

Query: 326 NSGRKGDLYVQVQVETPQKLNKRQRELLE 354
           N  ++G+L V+ +V+ P  LN  Q+  ++
Sbjct: 62  NPSQRGNLIVKYKVDYPISLNDAQKRAID 90



 Score = 34.9 bits (80), Expect = 0.011
 Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 4/55 (7%)

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSG 178
           G DL Y L +S +E+  G +  I+                    P   +   G G
Sbjct: 6   GDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSR----VQPVQPSQTSTYPGQG 56


>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain
          {Escherichia coli [TaxId: 562]}
          Length = 75

 Score = 95.1 bits (236), Expect = 9e-21
 Identities = 41/73 (56%), Positives = 56/73 (76%)

Query: 3  KADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQK 62
          K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D QK
Sbjct: 2  KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQK 61

Query: 63 RALYDQGGHEALE 75
          RA YDQ GH A E
Sbjct: 62 RAAYDQYGHAAFE 74


>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein
           mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast
           (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 80

 Score = 90.0 bits (223), Expect = 3e-19
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 267 FKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQ--TGKQFRLKGKGMPV 324
           FKRDG DL     I ++T   GG F +  +     +V I  G     G +  ++GKGMP+
Sbjct: 2   FKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPI 61

Query: 325 INSGRKGDLYVQVQVETPQ 343
              G  G+L ++  ++ P+
Sbjct: 62  PKYGGYGNLIIKFTIKDPE 80



 Score = 33.0 bits (75), Expect = 0.042
 Identities = 13/45 (28%), Positives = 16/45 (35%), Gaps = 2/45 (4%)

Query: 124 GADLRYNLEISLEEAFSGKTVQIRFP--TAVKCSTCSGSGAKPGT 166
           G DL Y  EI L  A +G    +       +K     G    PG 
Sbjct: 6   GDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGM 50



 Score = 31.8 bits (72), Expect = 0.093
 Identities = 9/39 (23%), Positives = 16/39 (41%)

Query: 224 SVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVK 262
            +     +  G R  + G+G      G  G+L I  ++K
Sbjct: 39  GIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIK 77


>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein
           DnaJ {Escherichia coli [TaxId: 562]}
          Length = 79

 Score = 83.2 bits (205), Expect = 3e-17
 Identities = 40/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 141 GKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGS 200
           G T +IR PT  +C  C GSGAKPGT P  C  C+GSG+V    Q FF++++ C  C+G 
Sbjct: 1   GVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMR-QGFFAVQQTCPHCQGR 59

Query: 201 GQIIPHPCSKCHGQGRV 217
           G +I  PC+KCHG GRV
Sbjct: 60  GTLIKDPCNKCHGHGRV 76


>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId:
          9913]}
          Length = 98

 Score = 82.3 bits (203), Expect = 5e-17
 Identities = 13/65 (20%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 5  DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAK---EKFAQISEAYEVLRDPQ 61
            ++ +G+    T  Q+K  +R   +  HPD+    P  +     F ++++A+    +  
Sbjct: 34 TKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQG 93

Query: 62 KRALY 66
          ++ LY
Sbjct: 94 QKPLY 98


>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]}
          Length = 77

 Score = 81.7 bits (201), Expect = 9e-17
 Identities = 38/75 (50%), Positives = 57/75 (76%), Gaps = 2/75 (2%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
          M K D+YQ LG+ R A+D ++K A+R  A++YHPD+N  +P A+EKF +I+EAY+VL DP
Sbjct: 1  MGK-DYYQTLGLARGASDEEIKRAYRRQALRYHPDKN-KEPGAEEKFKEIAEAYDVLSDP 58

Query: 61 QKRALYDQGGHEALE 75
          +KR ++D+ G E L+
Sbjct: 59 RKREIFDRYGEEGLK 73


>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3
          (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus
          musculus) [TaxId: 10090]}
          Length = 94

 Score = 81.6 bits (201), Expect = 9e-17
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEK------FAQISEAY 54
          +KK D+Y +LG D +A    LK  ++ L + YHPD+   D  A         F +I +A+
Sbjct: 14 LKK-DWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAW 72

Query: 55 EVLRDPQKRALYDQGGH 71
          ++L + + +  YD    
Sbjct: 73 KILGNEETKKKYDLQRS 89


>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain
          {Escherichia coli [TaxId: 562]}
          Length = 76

 Score = 77.4 bits (190), Expect = 2e-15
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 5  DFYQVLGIDRNAT--DRQLKTAFRSLAMKYHPDQNRNDPEA-----KEKFAQISEAYEVL 57
          D++ + G+        + L   F+ L  +YHPD+  +  +A      ++ A I++A++ L
Sbjct: 2  DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTL 61

Query: 58 RDPQKRALYD 67
          R P  RA Y 
Sbjct: 62 RHPLMRAEYL 71


>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's
           yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 80

 Score = 75.0 bits (184), Expect = 1e-14
 Identities = 15/69 (21%), Positives = 22/69 (31%), Gaps = 3/69 (4%)

Query: 196 TCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDL 255
              G  +         HG     E+  + + + PG   GT+I    +G      G    L
Sbjct: 14  LFVGKKKSFKIGRKGPHGAS---EKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTL 70

Query: 256 YIFISVKKH 264
              I  K H
Sbjct: 71  QFVIQEKSH 79



 Score = 44.9 bits (106), Expect = 1e-05
 Identities = 8/39 (20%), Positives = 17/39 (43%)

Query: 302 RVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVE 340
            + +  G + G +   K +G     +GR+  L   +Q +
Sbjct: 39  DIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEK 77


>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo
          sapiens) [TaxId: 9606]}
          Length = 88

 Score = 74.7 bits (183), Expect = 1e-14
 Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 4/71 (5%)

Query: 5  DFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRND-PEAKEKFAQISEAYEVLRDPQKR 63
          +   V+       + + K   R L +K+HPD+N  +   A E F  +      L   +K+
Sbjct: 17 EVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRL---EKQ 73

Query: 64 ALYDQGGHEAL 74
          A  DQ    A 
Sbjct: 74 AFLDQNADRAS 84


>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate
           reductase), N-terminal domain {Shewanella oneidensis
           [TaxId: 70863]}
          Length = 90

 Score = 74.4 bits (182), Expect = 1e-14
 Identities = 15/74 (20%), Positives = 18/74 (24%), Gaps = 6/74 (8%)

Query: 152 VKCSTCSGSG---AKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCR---GSGQIIP 205
             C +C   G   A        C  C+G                 C+ C           
Sbjct: 12  GGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQK 71

Query: 206 HPCSKCHGQGRVSE 219
             C  CH  GR S 
Sbjct: 72  PTCESCHDDGRTSA 85



 Score = 26.7 bits (58), Expect = 3.7
 Identities = 7/38 (18%), Positives = 10/38 (26%)

Query: 143 TVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
            V       + C+ C             C  C+  GR 
Sbjct: 46  AVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRT 83


>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain
          {Murine polyomavirus [TaxId: 10634]}
          Length = 79

 Score = 74.3 bits (182), Expect = 1e-14
 Identities = 9/71 (12%), Positives = 27/71 (38%), Gaps = 6/71 (8%)

Query: 2  KKADFYQVLGIDRNA--TDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRD 59
           K    ++L + R       +++ A++  ++  HPD+  +         +++  +   + 
Sbjct: 9  DKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHA----LMQELNSLWGTFKT 64

Query: 60 PQKRALYDQGG 70
                 + GG
Sbjct: 65 EVYNLRMNLGG 75


>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein
           mas5 (Hsp40, Ydj1), insert domain {Baker's yeast
           (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 74

 Score = 72.4 bits (177), Expect = 6e-14
 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 6/73 (8%)

Query: 152 VKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQS---FFSIERACSTCRGSGQIIP--H 206
           + C  C G G K G     C  CNG G  + T Q        +  C  C G+G II    
Sbjct: 3   ILCKECEGRGGKKGA-VKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKD 61

Query: 207 PCSKCHGQGRVSE 219
            C  C+G+   +E
Sbjct: 62  RCKSCNGKKVENE 74


>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain
           {Simian virus 40, Sv40 [TaxId: 10633]}
          Length = 114

 Score = 71.0 bits (173), Expect = 2e-13
 Identities = 17/102 (16%), Positives = 40/102 (39%), Gaps = 7/102 (6%)

Query: 1   MKKADFYQVLGIDRNA--TDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLR 58
            +      +LG++R+A      ++ A+     ++HPD+  ++ + K+    ++  Y+ + 
Sbjct: 5   EESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKK----MNTLYKKME 60

Query: 59  DPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELF 100
           D  K A     G         + G   +    +   +   LF
Sbjct: 61  DGVKYAHQPDFGGFWDATEIPTYGTDEWEQW-WNAFNEENLF 101


>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import
           protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's
           yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 74

 Score = 53.9 bits (129), Expect = 2e-08
 Identities = 13/72 (18%), Positives = 25/72 (34%), Gaps = 2/72 (2%)

Query: 269 RDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSG 328
           + G D+   +  S+      G      L+     V +  G + G++   KG+     +  
Sbjct: 2   QRGKDIKHEISASL-EELYKGRTAKLALNRKILEVHVEPGMKDGQRIVFKGEADQAPD-V 59

Query: 329 RKGDLYVQVQVE 340
             GD+   V   
Sbjct: 60  IPGDVVFIVSER 71



 Score = 49.7 bits (118), Expect = 4e-07
 Identities = 21/73 (28%), Positives = 28/73 (38%), Gaps = 6/73 (8%)

Query: 198 RGSGQIIPHPCS-----KCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAP 252
           RG         S     K          K+L V+V PG+ DG RI   GE         P
Sbjct: 3   RGKDIKHEISASLEELYKGRTAKLALNRKILEVHVEPGMKDGQRIVFKGEADQA-PDVIP 61

Query: 253 GDLYIFISVKKHQ 265
           GD+   +S + H+
Sbjct: 62  GDVVFIVSERPHK 74


>d1qo8a1 a.138.1.3 (A:2-102) Flavocytochrome c3 (respiratory
           fumarate reductase), N-terminal domain {Shewanella
           frigidimarina [TaxId: 56812]}
          Length = 101

 Score = 37.5 bits (86), Expect = 0.002
 Identities = 12/69 (17%), Positives = 21/69 (30%), Gaps = 10/69 (14%)

Query: 154 CSTCSGSGAKP----GTNPMDCNICNGSGRVYTTAQSFF------SIERACSTCRGSGQI 203
           C +C     K           C  C+G        +  F        +  C++C    + 
Sbjct: 14  CQSCHAKPIKVTDSETHENAQCKSCHGEYAELANDKLQFDPHNSHLGDINCTSCHKGHEE 73

Query: 204 IPHPCSKCH 212
               C++CH
Sbjct: 74  PKFYCNECH 82



 Score = 27.1 bits (59), Expect = 2.4
 Identities = 7/51 (13%), Positives = 12/51 (23%), Gaps = 7/51 (13%)

Query: 193 ACSTCRGSGQIIPHP-------CSKCHGQGRVSEEKLLSVNVPPGVDDGTR 236
           +C +C      +          C  CHG+        L  +          
Sbjct: 13  SCQSCHAKPIKVTDSETHENAQCKSCHGEYAELANDKLQFDPHNSHLGDIN 63


>d1d4ca1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory
           fumarate reductase), N-terminal domain {Shewanella
           putrefaciens [TaxId: 24]}
          Length = 102

 Score = 33.0 bits (74), Expect = 0.040
 Identities = 17/77 (22%), Positives = 24/77 (31%), Gaps = 15/77 (19%)

Query: 151 AVKCSTCSGSGAKPGTNPM------DCNICNGSGRVYTTA---------QSFFSIERACS 195
              C +C  S     TN         C  C+G  +    A         +S    E AC+
Sbjct: 12  MGGCDSCHVSDKGGVTNDNLTHENGQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEIACT 71

Query: 196 TCRGSGQIIPHPCSKCH 212
           +C    +     C  CH
Sbjct: 72  SCHKGHEKSVAYCDACH 88


>d2cvca1 a.138.1.1 (A:40-544) 16-heme cytochrome c HmcA
           {Desulfovibrio vulgaris [TaxId: 881]}
          Length = 505

 Score = 30.5 bits (66), Expect = 0.22
 Identities = 11/70 (15%), Positives = 16/70 (22%), Gaps = 7/70 (10%)

Query: 150 TAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFF---SIERACSTC---RGSGQI 203
               C  C  +       P  C  C+G               +  + C  C       + 
Sbjct: 434 KGTLCQGCHHNS-PASLTPPKCASCHGKPFDADRGDRPGLKAAYHQQCMGCHDRMKIEKP 492

Query: 204 IPHPCSKCHG 213
               C  CH 
Sbjct: 493 ANTACVDCHK 502



 Score = 27.4 bits (58), Expect = 1.8
 Identities = 14/104 (13%), Positives = 35/104 (33%), Gaps = 7/104 (6%)

Query: 134 SLEEAFSGKTVQIRFPTAVKC-STCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIER 192
            L++  + +  +I     + C +  + +G K G    +C  C+       ++      ++
Sbjct: 58  RLDDNSAAELKEIYHANCIGCHTDLAKAGKKTGPQDGECRSCHNPKPSAASSWKEIGFDK 117

Query: 193 ACSTCRGSGQIIPHP------CSKCHGQGRVSEEKLLSVNVPPG 230
           +      + + I         C  CH     + +KL+       
Sbjct: 118 SLHYRHVASKAIKPVGDPQKNCGACHHVYDEASKKLVWGKNKED 161


>d3caoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus
           [TaxId: 873]}
          Length = 103

 Score = 29.0 bits (64), Expect = 0.72
 Identities = 11/65 (16%), Positives = 19/65 (29%), Gaps = 6/65 (9%)

Query: 154 CSTC------SGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHP 207
           C+ C              +    C+ C+   +   T     +  + C  C       P  
Sbjct: 36  CNACHHVWVNGVLAEDEDSVGTPCSDCHALEQDGDTPGLQDAYHQQCWGCHEKQAKGPVM 95

Query: 208 CSKCH 212
           C +CH
Sbjct: 96  CGECH 100


>d1hkqa_ a.4.5.10 (A:) Replication protein A, repA {Pseudomonas
          syringae pv. savastanoi [TaxId: 29438]}
          Length = 125

 Score = 29.0 bits (65), Expect = 0.76
 Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEA 53
          ++   F +V GID       L  A   L  +    +     +  E+   +   
Sbjct: 41 IRADTFAEVFGIDVKHAYAALDDAATKLFNRD--IRRYVKGKVVERMRWVFHV 91


>d1repc1 a.4.5.10 (C:15-143) RepE54 {Escherichia coli, mini-F
           plasmid [TaxId: 562]}
          Length = 129

 Score = 27.9 bits (62), Expect = 1.5
 Identities = 11/57 (19%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMK----YHPDQNRNDPEAKEKFAQISEA 53
           +  A + ++ G+      + ++ A +S A K    Y P+++  D +  E F    + 
Sbjct: 48  IHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEEDAGDEKGYESFPWFIKP 104


>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase)
           {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 205

 Score = 27.1 bits (59), Expect = 2.4
 Identities = 8/70 (11%), Positives = 20/70 (28%), Gaps = 3/70 (4%)

Query: 135 LEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERAC 194
             EA   +  +   P A+  S+      +  +  +     +  G    +     S +   
Sbjct: 20  FNEAK--EDPRETLPEAITFSSAELPSGRVSSRILLFKELDHRGFTIYS-NWGTSRKAHD 76

Query: 195 STCRGSGQII 204
                +  I+
Sbjct: 77  IATNPNAAIV 86


>d2cy3a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans,
           different strains [TaxId: 876]}
          Length = 118

 Score = 26.4 bits (57), Expect = 4.6
 Identities = 14/76 (18%), Positives = 21/76 (27%), Gaps = 13/76 (17%)

Query: 152 VKCSTCSGSGAKPGTNPMD--CNICNGSGRVYTTAQSFF------SIERACSTCRGS--- 200
           V+C  C  +    G        + C+ S      A +        +    C  C  +   
Sbjct: 42  VECVQCHHTLEADGGAVKKCTTSGCHDSLEFRDKANAKDIKLVENAFHTQCIDCHKALKK 101

Query: 201 --GQIIPHPCSKCHGQ 214
                 P  C KCH  
Sbjct: 102 DKKPTGPTACGKCHTT 117


>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase,
           HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId:
           3702]}
          Length = 230

 Score = 26.2 bits (57), Expect = 4.9
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 8/43 (18%)

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGI 103
           Q+     +          QS G GGFG G     +FSELF+ I
Sbjct: 196 QRVGCMMKDEEGKAY---QSGGCGGFGKG-----NFSELFKSI 230


>d1u5ta1 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8
          {Baker's yeast (Saccharomyces cerevisiae) [TaxId:
          4932]}
          Length = 145

 Score = 26.2 bits (58), Expect = 4.9
 Identities = 9/41 (21%), Positives = 16/41 (39%), Gaps = 3/41 (7%)

Query: 20 QLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
            +      A K H  + +  PE + KF  +  +  +  DP
Sbjct: 19 VFQERLVEFAKK-HNSELQASPEFRSKFMHMCSSIGI--DP 56


>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase,
           HppD {Corn (Zea mays) [TaxId: 4577]}
          Length = 224

 Score = 25.8 bits (56), Expect = 5.4
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 5/25 (20%)

Query: 79  QSQGAGGFGAGMYGNSDFSELFEGI 103
           Q  G GGFG G     +FS+LF+ I
Sbjct: 198 QKGGCGGFGKG-----NFSQLFKSI 217


>gi|3308969|dbj|BAA31557.1|(36-183:257) macrophage-colony
           stimulating factor alpha [Bos taurus] 
           gi|33114043|gb|AAP94638.1| colony-stimulating factor-1
           splice variant [Bos taurus]  E=5e-72 s/c=1.84 id=87%
           cov=101%
          Length = 148

 Score = 26.0 bits (57), Expect = 5.5
 Identities = 8/35 (22%), Positives = 17/35 (48%)

Query: 332 DLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNP 366
              V+   ETP +L ++ + +  E + +  +D N 
Sbjct: 97  KACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNI 131


>d1aqea_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans,
           different strains [TaxId: 876]}
          Length = 110

 Score = 26.0 bits (56), Expect = 5.7
 Identities = 15/76 (19%), Positives = 21/76 (27%), Gaps = 13/76 (17%)

Query: 152 VKCSTCSGSGAKPGTNPMD-CNIC-------NGSGRVYTTAQSFFSIERACSTC-----R 198
           + C  C  +     T        C            V  T  +    E++C  C     R
Sbjct: 35  IACQQCHHTVPDTYTIESCMTEGCHDNIKERTEISSVERTFHTTKDSEKSCVGCHRELKR 94

Query: 199 GSGQIIPHPCSKCHGQ 214
                 P  C+ CH Q
Sbjct: 95  QGPSDAPLACNSCHVQ 110


>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular
           domain {Rat (Rattus norvegicus) [TaxId: 10116]}
          Length = 157

 Score = 26.0 bits (55), Expect = 6.0
 Identities = 12/77 (15%), Positives = 22/77 (28%), Gaps = 4/77 (5%)

Query: 154 CSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHG 213
           C      G     +P DC I  G+      A+    +   C   + +        S C  
Sbjct: 13  CKDNHCWG----ESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLA 68

Query: 214 QGRVSEEKLLSVNVPPG 230
               +   +  ++ P  
Sbjct: 69  CLHFNHSGICELHCPAL 85


>d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo
           sapiens) [TaxId: 9606]}
          Length = 333

 Score = 26.0 bits (56), Expect = 6.1
 Identities = 14/83 (16%), Positives = 28/83 (33%), Gaps = 12/83 (14%)

Query: 145 QIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQII 204
           +I   T +  S           N M   +C+   +     Q   + +      +      
Sbjct: 226 RIEQKTTLTASAGIAP------NTMLAKVCSDKNKPNGQYQILPNRQAVMDFIK------ 273

Query: 205 PHPCSKCHGQGRVSEEKLLSVNV 227
             P  K  G G+V+E+ L ++ +
Sbjct: 274 DLPIRKVSGIGKVTEKMLKALGI 296


>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase,
           HppD {Pseudomonas fluorescens [TaxId: 294]}
          Length = 203

 Score = 25.3 bits (55), Expect = 7.8
 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 5/25 (20%)

Query: 79  QSQGAGGFGAGMYGNSDFSELFEGI 103
           Q +G  GFG G     +F  LFE I
Sbjct: 172 QRKGDDGFGEG-----NFKALFESI 191


>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase,
           HppD {Streptomyces avermitilis [TaxId: 33903]}
          Length = 199

 Score = 25.3 bits (55), Expect = 8.0
 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 5/25 (20%)

Query: 79  QSQGAGGFGAGMYGNSDFSELFEGI 103
           +  G+ GFG G     +F  LFE I
Sbjct: 174 ERHGSMGFGKG-----NFKALFEAI 193


>d2nrac1 a.4.5.10 (C:9-151) Replication initiation protein PI
          {Escherichia coli [TaxId: 562]}
          Length = 143

 Score = 25.2 bits (55), Expect = 8.7
 Identities = 7/28 (25%), Positives = 12/28 (42%)

Query: 1  MKKADFYQVLGIDRNATDRQLKTAFRSL 28
          ++  D   +  I  +   RQLK   + L
Sbjct: 49 IRAEDLAALAKITPSLAYRQLKEGGKLL 76


>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon
           Haloarcula marismortui [TaxId: 2238]}
          Length = 119

 Score = 25.2 bits (55), Expect = 9.5
 Identities = 7/20 (35%), Positives = 8/20 (40%)

Query: 335 VQVQVETPQKLNKRQRELLE 354
           V V  + P  L     E LE
Sbjct: 2   VYVDFDVPADLEDDALEALE 21


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.317    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0595    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,467,448
Number of extensions: 72220
Number of successful extensions: 310
Number of sequences better than 10.0: 1
Number of HSP's gapped: 270
Number of HSP's successfully gapped: 48
Length of query: 384
Length of database: 2,407,596
Length adjustment: 87
Effective length of query: 297
Effective length of database: 1,213,086
Effective search space: 360286542
Effective search space used: 360286542
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (24.9 bits)