Query gi|254780639|ref|YP_003065052.1| hypothetical protein CLIBASIA_02630 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 39 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 21:22:29 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780639.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG5549 Predicted Zn-dependent 41.8 11 0.00027 20.2 0.8 13 14-26 110-122 (236) 2 pfam03447 NAD_binding_3 Homose 29.8 36 0.00092 17.5 2.0 30 5-34 81-113 (116) 3 KOG2387 consensus 28.9 36 0.00091 17.5 1.8 20 7-26 111-130 (585) 4 pfam07450 HycH Formate hydroge 15.8 84 0.0021 15.5 1.5 26 10-36 47-72 (131) 5 PRK08374 homoserine dehydrogen 13.4 1.1E+02 0.0029 14.8 1.7 30 5-34 107-137 (316) 6 pfam04959 ARS2 Arsenite-resist 13.1 1.2E+02 0.0032 14.6 1.8 18 12-29 19-36 (211) 7 TIGR01761 thiaz-red thiazoliny 12.6 1.4E+02 0.0035 14.4 1.9 30 5-34 99-128 (378) 8 PHA00456 hypothetical protein 12.0 78 0.002 15.7 0.5 21 11-31 13-33 (34) 9 smart00504 Ubox Modified RING 11.1 1.3E+02 0.0034 14.5 1.4 13 11-23 22-34 (63) 10 PRK08622 galactose-6-phosphate 10.9 97 0.0025 15.2 0.6 23 14-36 117-140 (171) No 1 >COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Probab=41.79 E-value=11 Score=20.25 Aligned_cols=13 Identities=46% Similarity=0.856 Sum_probs=11.0 Q ss_pred HHHHHHHHHHHHH Q ss_conf 3669999999885 Q gi|254780639|r 14 KTAIQDWIETFEL 26 (39) Q Consensus 14 ktaiqdwietfel 26 (39) +||||+|-++|.+ T Consensus 110 ~tava~wa~~fpl 122 (236) T COG5549 110 LTAVAGWAKTFPL 122 (236) T ss_pred HHHHHHHHHHCCC T ss_conf 9999989873880 No 2 >pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model. Probab=29.83 E-value=36 Score=17.46 Aligned_cols=30 Identities=27% Similarity=0.271 Sum_probs=25.5 Q ss_pred CCEEEEEEEHHHHHH---HHHHHHHHHHHHHHH Q ss_conf 403776652366999---999988548841477 Q gi|254780639|r 5 YGISVVMMEKTAIQD---WIETFELGKEHGRKL 34 (39) Q Consensus 5 ygisvvmmektaiqd---wietfelgkehgrkl 34 (39) -|++||...|.++-+ |-|-|++-+++|.++ T Consensus 81 ~GkhVVTaNK~~lA~~~~~~eL~~~A~~~g~~~ 113 (116) T pfam03447 81 AGKHVVTASKGALADLALRERLREAAEASGVRV 113 (116) T ss_pred CCCEEEEECHHHHCCHHHHHHHHHHHHHCCCEE T ss_conf 799899907889678579999999999839969 No 3 >KOG2387 consensus Probab=28.90 E-value=36 Score=17.49 Aligned_cols=20 Identities=45% Similarity=0.619 Sum_probs=13.5 Q ss_pred EEEEEEEHHHHHHHHHHHHH Q ss_conf 37766523669999999885 Q gi|254780639|r 7 ISVVMMEKTAIQDWIETFEL 26 (39) Q Consensus 7 isvvmmektaiqdwietfel 26 (39) ..||---..|||||||.... T Consensus 111 VQvvPHiTdaIq~WiervA~ 130 (585) T KOG2387 111 VQVVPHITDAIQDWIERVAR 130 (585) T ss_pred EEECCCHHHHHHHHHHHHHC T ss_conf 68553346899999999744 No 4 >pfam07450 HycH Formate hydrogenlyase maturation protein HycH. This family contains the bacterial formate hydrogenlyase maturation protein HycH, which is approximately 140 residues long. This may be required for the conversion of a precursor form of the large subunit of hydrogenlyase 3 into a mature form. Probab=15.78 E-value=84 Score=15.54 Aligned_cols=26 Identities=27% Similarity=0.443 Sum_probs=20.6 Q ss_pred EEEEHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 665236699999998854884147775 Q gi|254780639|r 10 VMMEKTAIQDWIETFELGKEHGRKLEK 36 (39) Q Consensus 10 vmmektaiqdwietfelgkehgrklek 36 (39) .-+....-..||.+++-| |--||++- T Consensus 47 l~cp~~~y~~wi~~Lpeg-eArRKm~G 72 (131) T pfam07450 47 LSCPLEEYRAWIALLPEG-EARRKMEG 72 (131) T ss_pred HCCCHHHHHHHHHHCCCH-HHHHHHHC T ss_conf 428599999999838936-78999846 No 5 >PRK08374 homoserine dehydrogenase; Provisional Probab=13.37 E-value=1.1e+02 Score=14.82 Aligned_cols=30 Identities=27% Similarity=0.265 Sum_probs=25.0 Q ss_pred CCEEEEEEEHHHH-HHHHHHHHHHHHHHHHH Q ss_conf 4037766523669-99999988548841477 Q gi|254780639|r 5 YGISVVMMEKTAI-QDWIETFELGKEHGRKL 34 (39) Q Consensus 5 ygisvvmmektai-qdwietfelgkehgrkl 34 (39) -|++||--.|.++ ..|-|-+++-+++|+.+ T Consensus 107 ~G~hVVTANK~~lA~~~~eL~~~A~~~~~~~ 137 (316) T PRK08374 107 EGKSVVTSNKPPIANHYDELLNEANERNLGY 137 (316) T ss_pred CCCCEECCCHHHHHHHHHHHHHHHHHCCCEE T ss_conf 8992997886999851999999999749849 No 6 >pfam04959 ARS2 Arsenite-resistance protein 2. Arsenite is a carcinogenic compound which can act as a co-mutagen by inhibiting DNA repair. Arsenite-resistance protein 2 is thought to play a role in arsenite resistance. Probab=13.14 E-value=1.2e+02 Score=14.64 Aligned_cols=18 Identities=28% Similarity=0.632 Sum_probs=13.2 Q ss_pred EEHHHHHHHHHHHHHHHH Q ss_conf 523669999999885488 Q gi|254780639|r 12 MEKTAIQDWIETFELGKE 29 (39) Q Consensus 12 mektaiqdwietfelgke 29 (39) ..+..|+||+.+||---+ T Consensus 19 ~t~~ev~e~~~~fe~Kl~ 36 (211) T pfam04959 19 ITHGEVNEWIKTFEEKLG 36 (211) T ss_pred CCHHHHHHHHHHHHHHHH T ss_conf 578999999999999998 No 7 >TIGR01761 thiaz-red thiazolinyl imide reductase; InterPro: IPR010091 This reductase is found associated with gene clusters for the biosynthesis of various non-ribosomal peptide derived natural products in which cysteine is cyclised to a thiazoline ring containing an imide double bond. Examples include yersiniabactin and pyochelin. Yersiniabactin is a virulence factor secreted by Yersinia pestis in iron-deficient microenvironments, in order to scavenge ferric ions . . Probab=12.63 E-value=1.4e+02 Score=14.39 Aligned_cols=30 Identities=27% Similarity=0.398 Sum_probs=24.6 Q ss_pred CCEEEEEEEHHHHHHHHHHHHHHHHHHHHH Q ss_conf 403776652366999999988548841477 Q gi|254780639|r 5 YGISVVMMEKTAIQDWIETFELGKEHGRKL 34 (39) Q Consensus 5 ygisvvmmektaiqdwietfelgkehgrkl 34 (39) -||+|..-.--.-.||.+--+|..++||.. T Consensus 99 RGi~VLqEHPl~p~d~~~L~~lA~~~Gr~Y 128 (378) T TIGR01761 99 RGIHVLQEHPLHPEDIAELLRLAERQGRRY 128 (378) T ss_pred CCCEEEECCCCCHHHHHHHHHHHHHCCCEE T ss_conf 675156328988778999999999709866 No 8 >PHA00456 hypothetical protein Probab=12.01 E-value=78 Score=15.70 Aligned_cols=21 Identities=38% Similarity=0.452 Sum_probs=17.7 Q ss_pred EEEHHHHHHHHHHHHHHHHHH Q ss_conf 652366999999988548841 Q gi|254780639|r 11 MMEKTAIQDWIETFELGKEHG 31 (39) Q Consensus 11 mmektaiqdwietfelgkehg 31 (39) |-|||+-.|+++-+++=|+.| T Consensus 13 kwekt~~~~Y~~lY~~Wk~Rg 33 (34) T PHA00456 13 KWEKTANDAYQELYNLWKRRG 33 (34) T ss_pred HHHHHCCHHHHHHHHHHHHCC T ss_conf 999842658999999987548 No 9 >smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Probab=11.09 E-value=1.3e+02 Score=14.47 Aligned_cols=13 Identities=31% Similarity=0.759 Sum_probs=11.0 Q ss_pred EEEHHHHHHHHHH Q ss_conf 6523669999999 Q gi|254780639|r 11 MMEKTAIQDWIET 23 (39) Q Consensus 11 mmektaiqdwiet 23 (39) -.|+.+|+.|+.+ T Consensus 22 tyer~~I~~wl~~ 34 (63) T smart00504 22 TYERRAIEKWLLS 34 (63) T ss_pred EECHHHHHHHHHH T ss_conf 7059999999980 No 10 >PRK08622 galactose-6-phosphate isomerase subunit LacB; Reviewed Probab=10.89 E-value=97 Score=15.20 Aligned_cols=23 Identities=17% Similarity=0.356 Sum_probs=16.1 Q ss_pred HHHHHHHHHH-HHHHHHHHHHHHH Q ss_conf 3669999999-8854884147775 Q gi|254780639|r 14 KTAIQDWIET-FELGKEHGRKLEK 36 (39) Q Consensus 14 ktaiqdwiet-felgkehgrklek 36 (39) +..++.|++| ||-|..|.|.++| T Consensus 117 ~~iv~~fL~T~Feggrh~~RRv~K 140 (171) T PRK08622 117 CDIIDAFINAEYKPTEENKKLIAK 140 (171) T ss_pred HHHHHHHHCCCCCCCHHHHHHHHH T ss_conf 999999977998996078789999 Done!