Query         gi|254780639|ref|YP_003065052.1| hypothetical protein CLIBASIA_02630 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 39
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Tue May 31 17:28:24 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780639.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2bsj_A Chaperone protein SYCT;  12.0      59  0.0025   15.2   0.9   22    8-29     91-112 (133)
  2 2vvp_A Ribose-5-phosphate isom   9.3      80  0.0034   14.5   0.8   24   14-37    121-145 (162)
  3 1wix_A HOOK homolog 1, RSGI RU   8.5      31  0.0013   16.7  -1.5   16   15-30     12-27  (164)
  4 1j03_A Putative steroid bindin   8.2 1.3E+02  0.0055   13.4   1.6   14   12-25     78-91  (102)
  5 2be6_D Voltage-dependent L-typ   6.8 1.6E+02  0.0067   12.9   2.0   20   15-34     15-34  (37)
  6 3er7_A Uncharacterized NTF2-li   6.7 1.3E+02  0.0056   13.3   1.1   28   11-38      2-29  (131)
  7 3mtj_A Homoserine dehydrogenas   6.5 1.7E+02  0.0069   12.8   2.6   30    5-34    102-132 (444)
  8 3ing_A Homoserine dehydrogenas   6.1 1.8E+02  0.0074   12.7   2.4   30    5-34    109-139 (325)
  9 2kvv_A Putative excisionase; D   6.0 1.8E+02  0.0074   12.7   2.5   20    5-24     51-70  (78)
 10 3do5_A HOM, homoserine dehydro   5.8 1.8E+02  0.0076   12.6   2.4   30    5-34    107-137 (327)

No 1  
>2bsj_A Chaperone protein SYCT; type III secretion, effector, YOPT; 1.83A {Yersinia enterocolitica} PDB: 2bho_A 2bsh_A 2bsi_A
Probab=11.96  E-value=59  Score=15.20  Aligned_cols=22  Identities=32%  Similarity=0.523  Sum_probs=16.9

Q ss_pred             EEEEEEHHHHHHHHHHHHHHHH
Q ss_conf             7766523669999999885488
Q gi|254780639|r    8 SVVMMEKTAIQDWIETFELGKE   29 (39)
Q Consensus         8 svvmmektaiqdwietfelgke   29 (39)
                      +.+|..-.+.|.|.|.|--.-|
T Consensus        91 pla~ldvaelqAWlErFIdDIE  112 (133)
T 2bsj_A           91 SLVGLDIDEMQAWLERFIDDIE  112 (133)
T ss_dssp             ESTTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHH
T ss_conf             5100479999999999999999


No 2  
>2vvp_A Ribose-5-phosphate isomerase B; RPIB, RV2465C, RARE sugar, carbohydrate metabolism, pentose phosphate pathway; HET: R52 5RP; 1.65A {Mycobacterium tuberculosis} SCOP: c.121.1.1 PDB: 2vvo_A* 2vvq_A* 2bes_A* 2bet_A* 1usl_A
Probab=9.28  E-value=80  Score=14.51  Aligned_cols=24  Identities=13%  Similarity=0.405  Sum_probs=17.0

Q ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHH
Q ss_conf             3669999999-88548841477751
Q gi|254780639|r   14 KTAIQDWIET-FELGKEHGRKLEKT   37 (39)
Q Consensus        14 ktaiqdwiet-felgkehgrklekt   37 (39)
                      +--++.|++| |..|-.|.|+++|-
T Consensus       121 ~~iv~~~l~t~f~~ggRh~~Rv~ki  145 (162)
T 2vvp_A          121 LAIVDAFVTTPWSKAQRHQRRIDIL  145 (162)
T ss_dssp             HHHHHHHHHSCCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHH
T ss_conf             9999999769989986389999999


No 3  
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1
Probab=8.53  E-value=31  Score=16.67  Aligned_cols=16  Identities=19%  Similarity=0.524  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             6699999998854884
Q gi|254780639|r   15 TAIQDWIETFELGKEH   30 (39)
Q Consensus        15 taiqdwietfelgkeh   30 (39)
                      -|+-.|+.||+++..+
T Consensus        12 ~aLv~Wi~tF~~~~~~   27 (164)
T 1wix_A           12 DSLIIWLQTFKTASPC   27 (164)
T ss_dssp             HHHHHHHTTCCCSSCC
T ss_pred             HHHHHHHHHCCCCCCC
T ss_conf             8999999975998776


No 4  
>1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A
Probab=8.17  E-value=1.3e+02  Score=13.36  Aligned_cols=14  Identities=36%  Similarity=0.750  Sum_probs=11.1

Q ss_pred             EEHHHHHHHHHHHH
Q ss_conf             52366999999988
Q gi|254780639|r   12 MEKTAIQDWIETFE   25 (39)
Q Consensus        12 mektaiqdwietfe   25 (39)
                      .|...+++|.+.|+
T Consensus        78 ~e~~~l~~W~~~f~   91 (102)
T 1j03_A           78 KEINTLNDWETKFE   91 (102)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999996


No 5  
>2be6_D Voltage-dependent L-type calcium channel alpha- 1C subunit; calmodulin, IQ domain, inactivation, facilitation, calcium-dependent, gating; 2.00A {Homo sapiens}
Probab=6.83  E-value=1.6e+02  Score=12.94  Aligned_cols=20  Identities=30%  Similarity=0.385  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             66999999988548841477
Q gi|254780639|r   15 TAIQDWIETFELGKEHGRKL   34 (39)
Q Consensus        15 taiqdwietfelgkehgrkl   34 (39)
                      -.|||+...|.--||.++.-
T Consensus        15 ~liqdyfr~fk~rke~~~~~   34 (37)
T 2be6_D           15 FLIQEYFRKFKKRKEQGLVG   34 (37)
T ss_dssp             HHHHHHHHHHHHHHHHTCC-
T ss_pred             HHHHHHHHHHHHHHHHCCCC
T ss_conf             98999999999988840036


No 6  
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24
Probab=6.72  E-value=1.3e+02  Score=13.32  Aligned_cols=28  Identities=14%  Similarity=0.463  Sum_probs=17.2

Q ss_pred             EEEHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             6523669999999885488414777512
Q gi|254780639|r   11 MMEKTAIQDWIETFELGKEHGRKLEKTC   38 (39)
Q Consensus        11 mmektaiqdwietfelgkehgrklektc   38 (39)
                      ||.-|++..+.+-+.+....-+.|++-|
T Consensus         2 ~~~~T~LdrYF~LsD~A~~d~~~l~eLi   29 (131)
T 3er7_A            2 MMNTTTLDRYFDLFDASRTDEKAFDDLI   29 (131)
T ss_dssp             ----CHHHHHHHHHHHTTTCHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             7522689999988876158989999999


No 7  
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans}
Probab=6.51  E-value=1.7e+02  Score=12.84  Aligned_cols=30  Identities=23%  Similarity=0.268  Sum_probs=24.6

Q ss_pred             CCEEEEEEEHHHHHH-HHHHHHHHHHHHHHH
Q ss_conf             403776652366999-999988548841477
Q gi|254780639|r    5 YGISVVMMEKTAIQD-WIETFELGKEHGRKL   34 (39)
Q Consensus         5 ygisvvmmektaiqd-wietfelgkehgrkl   34 (39)
                      -|++||.-.|.++.. |-|-+++-+++|+.+
T Consensus       102 ~G~~VVTANK~~~a~~~~eL~~~a~~~~~~~  132 (444)
T 3mtj_A          102 NGKHVVTANKHLVAKYGNEIFAAAQAKGVMV  132 (444)
T ss_dssp             TTCEEEECCHHHHHHHHHHHHHHHHHHTCCE
T ss_pred             CCCCEEECCHHHHHHHHHHHHHHHHHHCCEE
T ss_conf             2883674233678878999999999809889


No 8  
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: NDP; 1.95A {Thermoplasma acidophilum}
Probab=6.06  E-value=1.8e+02  Score=12.70  Aligned_cols=30  Identities=17%  Similarity=0.543  Sum_probs=23.7

Q ss_pred             CCEEEEEEEHHHHHH-HHHHHHHHHHHHHHH
Q ss_conf             403776652366999-999988548841477
Q gi|254780639|r    5 YGISVVMMEKTAIQD-WIETFELGKEHGRKL   34 (39)
Q Consensus         5 ygisvvmmektaiqd-wietfelgkehgrkl   34 (39)
                      -|++||...|.++-. |-|-+++-++||.++
T Consensus       109 ~GkhVVTANK~~la~~~~eL~~lA~~~g~~i  139 (325)
T 3ing_A          109 SGMNVVTANKSGLANKWHDIMDSANQNSKYI  139 (325)
T ss_dssp             TTCEEEECCCHHHHHHHHHHHHHHHHHTCCE
T ss_pred             HCCCEEECCCHHHHHHHHHHHHHHHHHCCEE
T ss_conf             4487893585153333799999998608704


No 9  
>2kvv_A Putative excisionase; DNA binding, WHTH motif, structural genomics, northeast structural genomics consortium (NESG), PSI-2; NMR {Klebsiella pneumoniae}
Probab=6.00  E-value=1.8e+02  Score=12.68  Aligned_cols=20  Identities=10%  Similarity=-0.001  Sum_probs=15.8

Q ss_pred             CCEEEEEEEHHHHHHHHHHH
Q ss_conf             40377665236699999998
Q gi|254780639|r    5 YGISVVMMEKTAIQDWIETF   24 (39)
Q Consensus         5 ygisvvmmektaiqdwietf   24 (39)
                      .--|..|....+|+.|||.-
T Consensus        51 ~~ns~~~YN~~~Id~wIe~~   70 (78)
T 2kvv_A           51 TLRGTTWYNYPEINKFIRDS   70 (78)
T ss_dssp             CTTCEEEEEHHHHHHHHHHH
T ss_pred             CCCCEEEECHHHHHHHHHHH
T ss_conf             88972787599999999998


No 10 
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural genomics, joint center for structural genomics; 2.20A {Archaeoglobus fulgidus}
Probab=5.84  E-value=1.8e+02  Score=12.63  Aligned_cols=30  Identities=23%  Similarity=0.397  Sum_probs=23.6

Q ss_pred             CCEEEEEEEHHHH-HHHHHHHHHHHHHHHHH
Q ss_conf             4037766523669-99999988548841477
Q gi|254780639|r    5 YGISVVMMEKTAI-QDWIETFELGKEHGRKL   34 (39)
Q Consensus         5 ygisvvmmektai-qdwietfelgkehgrkl   34 (39)
                      -|++||...|.++ ..|-+-+++-+++|.++
T Consensus       107 ~G~hVVTANK~~la~~~~~l~~~a~~~~~~~  137 (327)
T 3do5_A          107 RGKHVVTSNKGPLVAEFHGLMSLAERNGVRL  137 (327)
T ss_dssp             TTCEEEECCSHHHHHHHHHHHHHHHHTTCCE
T ss_pred             HCCCEEECCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             4893894282687761999998722024389


Done!