>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.

Probab=97.76  E-value=7.1e-05  Score=44.16  Aligned_cols=30  Identities=27%  Similarity=0.372  Sum_probs=24.1

Q ss_pred             EEEECCCC-EEEEEECCCCCHHHHHHHHHHH
Q ss_conf             79986898-6999907986578999999998
Q gi|254780640|r   44 QKIEFADH-LTIVNGQNGYGKSSLSEAIEWL   73 (110)
Q Consensus        44 ~~i~f~~~-~~~i~G~Ng~GKStil~ai~~~   73 (110)
T Consensus        19 vsl~v~~Gei~~iiGpnGaGKSTLl~~i~G~   49 (200)
T cd03217          19 VNLTIKKGEVHALMGPNGSGKSTLAKTIMGH   49 (200)
T ss_pred             CEEEECCCCEEEEECCCCCCHHHHHHHHCCC
T ss_conf             0568879989999968999999999997077