>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=94.52  E-value=0.11  Score=28.18  Aligned_cols=30  Identities=30%  Similarity=0.469  Sum_probs=21.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             9999079865789999999985797756433
Q gi|254780640|r   53 TIVNGQNGYGKSSLSEAIEWLFYGYTQRRKH   83 (110)
Q Consensus        53 ~~i~G~Ng~GKStil~ai~~~l~g~~~~~~~   83 (110)
T Consensus         2 i~iigH~~aGKTtL~E~lL~~~-g~i~~~G~   31 (268)
T cd04170           2 IALVGHSGSGKTTLAEALLYAT-GAIDRLGS   31 (268)
T ss_pred             EEEEECCCCCHHHHHHHHHHHC-CCCCCCCC
T ss_conf             8999089999899999999966-99665765