RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) >gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 908 Score = 28.1 bits (62), Expect = 0.69 Identities = 22/118 (18%), Positives = 47/118 (39%), Gaps = 15/118 (12%) Query: 4 SAKIEF-LDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYP-------- 54 S ++EF ++G+KY I R+ S + I + G + + Sbjct: 73 SVELEFEVNGKKYRIEREFRRGRGQSTGSLQIIEVDGERIADGKKDVNEKIEELLGLDKD 132 Query: 55 ------VVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNM 106 + Q E +F+ PK R++ L ++ G + L L+E+ + +++ + Sbjct: 133 TFTRSVYLPQGEFDAFLKSKPKERKEILDELFGLEKYEKLSELLKEVIKEAKAKIEEL 190 >gnl|CDD|113014 pfam04224, DUF417, Protein of unknown function, DUF417. This family of uncharacterized proteins appears to be restricted to proteobacteria. Length = 153 Score = 26.6 bits (59), Expect = 1.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 54 PVVAQKELQSFIHITPKNRRDKLSDILGFGEMT 86 P V+ L SF++ KN +S +LG E Sbjct: 44 PFVSNSPLMSFLYEFLKNGTYGVSYLLGITETI 76 >gnl|CDD|147698 pfam05686, DUF821, Arabidopsis thaliana protein of unknown function (DUF821). This family consists of a group of Arabidopsis thaliana proteins with no known function. Length = 396 Score = 25.9 bits (57), Expect = 2.8 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Query: 44 IGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDIL 80 +G + +FFY + LQ ++H P D D+ Sbjct: 244 VGPEYYDFFY-----RGLQPWVHYWPIKSDDDCRDLK 275 >gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.. Length = 236 Score = 25.2 bits (55), Expect = 4.3 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Query: 70 KNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAM 111 K R D+LS++L E+ L T +R+L SL R ++AA+ Sbjct: 131 KKRLDELSELLDLEEL--LDTPVRQL--SLGQRMRAEIAAAL 168 >gnl|CDD|34837 COG5240, SEC21, Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion]. Length = 898 Score = 25.1 bits (54), Expect = 5.0 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 7/64 (10%) Query: 55 VVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPL 114 V KE++S I + +NR I + T LKT E L + P+ V D Sbjct: 339 SVCNKEVESLI--SDENR-----TISTYAITTLLKTGTEETIDRLVNLIPSFVHDMSDGF 391 Query: 115 KKCV 118 K Sbjct: 392 KIIA 395 >gnl|CDD|48392 cd02146, NfsA_FRP, This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor.. Length = 229 Score = 24.8 bits (54), Expect = 6.0 Identities = 6/19 (31%), Positives = 11/19 (57%) Query: 63 SFIHITPKNRRDKLSDILG 81 S I +T + KL+++ G Sbjct: 44 SVIVVTDPELKAKLAELAG 62 >gnl|CDD|147367 pfam05152, DUF705, Protein of unknown function (DUF705). This family contains several uncharacterized Baculovirus proteins. Length = 297 Score = 24.5 bits (54), Expect = 6.8 Identities = 6/15 (40%), Positives = 11/15 (73%), Gaps = 1/15 (6%) Query: 27 GSFTLIDDIPSGNDF 41 + TL+DD+ S N++ Sbjct: 247 KTITLVDDLKS-NNY 260 >gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]. Length = 327 Score = 24.5 bits (53), Expect = 7.0 Identities = 9/51 (17%), Positives = 20/51 (39%) Query: 53 YPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRK 103 YP+ + + +T + LG + L+ L + +SL+ + Sbjct: 274 YPIPKKNAEEHEGFLTSFKVSSEKLKSLGGFKFRPLEETLSDTVESLREKG 324 >gnl|CDD|30557 COG0208, NrdF, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism]. Length = 348 Score = 24.5 bits (53), Expect = 8.5 Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 10 LDGQKYTIARQMHEKGEGSFTLIDDIPSGND 40 + KY A ++++K +F L ++I ND Sbjct: 29 WNPIKYPWALELYKKLTANFWLPEEIDLSND 59 >gnl|CDD|35433 KOG0212, KOG0212, KOG0212, Uncharacterized conserved protein [Function unknown]. Length = 675 Score = 24.1 bits (52), Expect = 8.6 Identities = 17/70 (24%), Positives = 26/70 (37%), Gaps = 7/70 (10%) Query: 19 RQMHEKGEGSF-TLIDDIPSGNDFKTIG------AQSLEFFYPVVAQKELQSFIHITPKN 71 R + + F I PS D+ + QS E + A +Q F+ I ++ Sbjct: 225 RTLTDTLLSEFLAEIRSSPSSMDYDDMINVLVPHLQSSEPEIQLKALTWIQEFVKIPGRD 284 Query: 72 RRDKLSDILG 81 LS IL Sbjct: 285 LLLYLSGILT 294 >gnl|CDD|144894 pfam01470, Peptidase_C15, Pyroglutamyl peptidase. Length = 203 Score = 24.2 bits (53), Expect = 9.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 86 TSLKTALRELQQSLQSRKPNMV 107 TS K A LQQ++ KP++V Sbjct: 43 TSFKKAAEVLQQAIAEIKPDIV 64 >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit. Length = 485 Score = 24.2 bits (53), Expect = 9.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 72 RRDKLSDILGFGEMTSL 88 R KLS LG G MT+L Sbjct: 279 RAAKLSSQLGEGSMTAL 295 >gnl|CDD|33326 COG3523, IcmF, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 1188 Score = 24.2 bits (52), Expect = 9.8 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 16/67 (23%) Query: 54 PVVAQKELQSFIHITPKNRRDK----------LSDILGFGEM------TSLKTALRELQQ 97 V + E F+ + K RR + +SD+L +L+ L+EL++ Sbjct: 192 DEVDRAEWLGFLGLLKKYRRRRPLNGIILTLSVSDLLTADPAEREALARTLRARLQELRE 251 Query: 98 SLQSRKP 104 +L +R P Sbjct: 252 TLHARLP 258 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.134 0.372 Gapped Lambda K H 0.267 0.0656 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,361,479 Number of extensions: 62938 Number of successful extensions: 152 Number of sequences better than 10.0: 1 Number of HSP's gapped: 152 Number of HSP's successfully gapped: 27 Length of query: 121 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 39 Effective length of database: 4,491,799 Effective search space: 175180161 Effective search space used: 175180161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)