RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) >gnl|CDD|162740 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. Length = 1164 Score = 29.3 bits (66), Expect = 0.26 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 53 YPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLK-TALRELQQ 97 Y VV Q ++ FI ++P RR + +I G E K AL EL++ Sbjct: 136 YNVVLQGDVTDFISMSPVERRKIIDEIAGVAEFDRKKEKALEELEE 181 >gnl|CDD|162601 TIGR01916, F420_cofE, F420-0:gamma-glutamyl ligase. This model represents an enzyme of coenzyme F(420) biosynthesis, as catalyzed by MJ0768 of Methanococcus jannaschii and by the N-terminal half of FbiB of Mycobacterium bovis strain BCG. Note that only two glutamates are ligated in M. jannaschii, but five to six in the Mycobacterium lineage. In M. jannaschii, CofE catalyzes the GTP-dependent addition of two L-glutamates. Length = 243 Score = 26.6 bits (59), Expect = 1.6 Identities = 10/45 (22%), Positives = 18/45 (40%) Query: 3 ISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQ 47 I+ DG +A + K EG +++I + I A+ Sbjct: 22 IAEAAPLEDGDVLVVASTVVSKAEGRIIRLEEITPSPEALEIAAR 66 >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional. Length = 880 Score = 26.5 bits (59), Expect = 1.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 56 VAQKELQSFIHITPKNRRDKLSDILGFG 83 V Q E+ I+ TP +R+D + D+L G Sbjct: 135 VRQGEVNKLINATPSDRQDMIDDLLQLG 162 >gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional. Length = 276 Score = 26.7 bits (59), Expect = 1.7 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Query: 10 LDGQKYTI---ARQMHEKGEGSFTLIDDIPSGNDFKTIGA 46 ++G Y + AR++ G GSF I I + N + GA Sbjct: 119 VNGTMYVLKHAARELVRGGGGSFVGISSIAASNTHRWFGA 158 >gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase. In a number of bacteria, including Oxalobacter formigenes from the human gut, a two-gene operon of oxc (oxalyl-CoA decarboxylase) and frc (formyl-CoA transferase) encodes a system for degrading and therefore detoxifying oxalate. Members of this family are the thiamine pyrophosphate (TPP)-containing enzyme oxalyl-CoA decarboxylase. Length = 554 Score = 26.3 bits (58), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Query: 88 LKTALRELQQSLQSRKPNMVSAAMDP 113 LK AL E +L S KP +++A +DP Sbjct: 517 LKAALNE---ALASGKPTLINAVIDP 539 >gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional. Length = 1006 Score = 26.1 bits (57), Expect = 2.2 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query: 66 HITPKNRRDKLSDILGFGEMT---SLKTALRELQQSLQSRKPNMVS 108 H TP RD + F E+ SL+ AL+E ++ +Q KP ++ Sbjct: 298 HQTPMPERDAVERARNFKEVNLGYSLEDALQEAERCIQCAKPTCIA 343 >gnl|CDD|180770 PRK06946, PRK06946, lipid A biosynthesis lauroyl acyltransferase; Provisional. Length = 293 Score = 25.8 bits (57), Expect = 3.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 82 FG-EMTSLKTALRELQQSLQSRKPNMVSAAMD 112 FG EM S + R++ + L+ KP M+ A MD Sbjct: 159 FGAEMVSRADSARQVLRWLRDGKPVMLGADMD 190 >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional. Length = 895 Score = 25.6 bits (56), Expect = 3.3 Identities = 13/51 (25%), Positives = 23/51 (45%) Query: 56 VAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNM 106 V Q E+ S I P R+ L +IL + L+++ L++ N+ Sbjct: 135 VGQGEMDSLISGDPAQRKKILDEILEINSLERNYDKLKDVIDMLRAEISNI 185 >gnl|CDD|177477 PHA02695, PHA02695, hypothetical protein; Provisional. Length = 725 Score = 25.4 bits (55), Expect = 3.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 56 VAQKELQSFIHITPKNRRDKLSDILGFG 83 + ++Q ++H RD++SD FG Sbjct: 241 IRAGQVQEYLHYAEDYLRDRVSDTGAFG 268 >gnl|CDD|179957 PRK05183, hscA, chaperone protein HscA; Provisional. Length = 616 Score = 25.1 bits (56), Expect = 4.8 Identities = 10/40 (25%), Positives = 19/40 (47%) Query: 77 SDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKK 116 D+L E ++ A+ L++ Q + + AA+ L K Sbjct: 551 GDLLSAAERAAIDAAMAALREVAQGDDADAIEAAIKALDK 590 >gnl|CDD|183956 PRK13293, PRK13293, F420-0--gamma-glutamyl ligase; Reviewed. Length = 245 Score = 24.9 bits (55), Expect = 5.5 Identities = 12/45 (26%), Positives = 18/45 (40%) Query: 3 ISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQ 47 I+ + + DG IA + K EG +DDI I + Sbjct: 24 IAERYDLEDGDIIVIASTIVSKAEGRVIDLDDITPSERAIEIAKK 68 >gnl|CDD|105866 PRK12702, PRK12702, mannosyl-3-phosphoglycerate phosphatase; Reviewed. Length = 302 Score = 24.6 bits (53), Expect = 5.7 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Query: 66 HITPKNRRDKLSDILGFGEMTSLKTA------LRELQQSLQSRKPNMVSAAMDP 113 HI + R+D D++GFG+ T+ + A L E +++ + + S + DP Sbjct: 105 HILQQVRQDSHLDLIGFGDWTASELAAATGIPLEEAERAQKREYSEIFSYSGDP 158 >gnl|CDD|177634 PHA03398, PHA03398, viral phosphatase superfamily protein; Provisional. Length = 303 Score = 24.8 bits (55), Expect = 6.4 Identities = 6/15 (40%), Positives = 11/15 (73%), Gaps = 1/15 (6%) Query: 27 GSFTLIDDIPSGNDF 41 + TL+DD+ S N++ Sbjct: 253 KTITLVDDLKS-NNY 266 >gnl|CDD|180097 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional. Length = 326 Score = 24.5 bits (54), Expect = 6.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 87 SLKTALRELQQSLQS 101 SLK L E++Q LQS Sbjct: 281 SLKDTLTEMEQDLQS 295 >gnl|CDD|180356 PRK06030, PRK06030, hypothetical protein; Provisional. Length = 124 Score = 24.7 bits (54), Expect = 6.6 Identities = 11/51 (21%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Query: 58 QKELQSFIHITPKNRRDKLSDILGF-----GEMTSLKTALRELQQSLQSRK 103 + L+ HI P RR++L ++ + A E+ L+ R+ Sbjct: 3 PQALERLWHIAPDKRRERLIELCEAVIDLLALAFGVSGA--EIASPLRGRR 51 >gnl|CDD|181658 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated. Length = 275 Score = 24.6 bits (54), Expect = 6.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 88 LKTALRELQQSLQSRKPNMVSAAMDPLKKC 117 L+ REL L + P ++ AA D K+ Sbjct: 195 LRARTRELAAKLLEKNPVVLRAAKDGFKRV 224 >gnl|CDD|183185 PRK11539, PRK11539, ComEC family competence protein; Provisional. Length = 755 Score = 24.6 bits (54), Expect = 6.7 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 80 LGFGEMTSLKTALRELQQ 97 L FGE S+ ++ L + Sbjct: 204 LAFGERLSVPKEIKNLLR 221 >gnl|CDD|181733 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated. Length = 569 Score = 24.2 bits (53), Expect = 8.7 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Query: 68 TPKNRRDKLSDILG-----FGEMTSLKTALRELQQSLQSRKPNMVSAAMDP 113 R DK+ + G L+ AL E ++ S KP +++ +DP Sbjct: 500 VHHARYDKMMEAFGGVGYNVTTPDELRHALTE---AIASGKPTLINVVIDP 547 >gnl|CDD|148430 pfam06818, Fez1, Fez1. This family represents the eukaryotic Fez1 protein. Fez1 contains a leucine-zipper region with similarity to the DNA-binding domain of the cAMP-responsive activating-transcription factor 5. There is evidence that Fez1 inhibits cancer cell growth through regulation of mitosis, and that its alterations result in abnormal cell growth. Note that some family members contain more than one copy of this region. Length = 199 Score = 24.1 bits (52), Expect = 9.7 Identities = 10/39 (25%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Query: 83 GEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGTR 121 GE+ SL+ LRE + L+ + + L+ + T+ Sbjct: 31 GEIVSLRAQLREARAQLRESE-----EQLQELQDALRTK 64 >gnl|CDD|150409 pfam09730, BicD, Microtubule-associated protein Bicaudal-D. BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER). For full functioning they bind with GSK-3beta pfam05350 to maintain the anchoring of microtubules to the centromere. It appears that amino-acid residues 437-617 of BicD and the kinase activity of GSK-3 are necessary for the formation of a complex between BicD and GSK-3beta in intact cells. Length = 711 Score = 24.0 bits (52), Expect = 10.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 84 EMTSLKTALRELQQSLQSRK 103 E SL L+ELQ L+ + Sbjct: 274 EKASLLANLQELQTQLEQSE 293 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.134 0.372 Gapped Lambda K H 0.267 0.0630 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,899,251 Number of extensions: 107847 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's gapped: 218 Number of HSP's successfully gapped: 29 Length of query: 121 Length of database: 5,994,473 Length adjustment: 81 Effective length of query: 40 Effective length of database: 4,244,225 Effective search space: 169769000 Effective search space used: 169769000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)