Query gi|254780642|ref|YP_003065055.1| hypothetical protein CLIBASIA_02645 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 66 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 20:46:54 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780642.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam01452 Rota_NSP4 Rotavirus 38.8 17 0.00043 18.7 1.5 22 5-27 149-170 (174) 2 TIGR01719 euk_UDPppase uridine 24.3 29 0.00073 17.6 0.7 17 42-62 90-106 (301) 3 cd04885 ACT_ThrD-I Tandem C-te 19.0 39 0.00099 16.9 0.4 45 9-56 16-60 (68) 4 PRK06770 hypothetical protein; 18.3 57 0.0015 16.1 1.1 14 9-22 118-131 (185) 5 pfam00585 Thr_dehydrat_C C-ter 17.0 46 0.0012 16.5 0.4 45 9-56 28-72 (91) 6 KOG3082 consensus 15.9 77 0.002 15.4 1.3 34 23-57 141-174 (338) 7 pfam01270 Glyco_hydro_8 Glycos 12.1 78 0.002 15.4 0.5 20 13-32 109-128 (325) 8 pfam08695 DUF1783 Fungal prote 11.5 53 0.0013 16.3 -0.5 17 15-31 58-74 (125) 9 TIGR02130 dapB_plant dihydrodi 11.3 1.2E+02 0.003 14.6 1.1 37 3-39 163-199 (275) 10 KOG2720 consensus 11.2 1.2E+02 0.0031 14.5 1.2 18 10-27 76-97 (431) No 1 >pfam01452 Rota_NSP4 Rotavirus non structural protein. This protein has been called NSP4, NSP5, NS28, and NCVP5. The final steps in the assembly of rotavirus occur in the lumen of the endoplasmic reticulum (ER). Targeting of the immature inner capsid particle (ICP) to this compartment is mediated by the cytoplasmic tail of NSP4, located in the ER membrane. Probab=38.82 E-value=17 Score=18.74 Aligned_cols=22 Identities=50% Similarity=0.795 Sum_probs=16.1 Q ss_pred CHHHHHHHHHHHHCCCCCCCCHH Q ss_conf 41346899987642776755013 Q gi|254780642|r 5 NQKSAKALHERWSQGKFNYDQDR 27 (66) Q Consensus 5 nqksakalherwsqgkfnydqdr 27 (66) |||.-|.|+| |+.||-.|+..+ T Consensus 149 NqK~~ktl~e-w~~gknpyep~e 170 (174) T pfam01452 149 NRKAYKTLHE-WSSDKDPYQPTR 170 (174) T ss_pred HHHHHHHHHH-HHCCCCCCCCCC T ss_conf 6765421787-844899999751 No 2 >TIGR01719 euk_UDPppase uridine phosphorylase; InterPro: IPR010059 This entry represents a clade of mainly eukaryotic uridine phosphorylases. Genes from human and mouse have been characterised. This enzyme is a member of the PHP/UDP subfamily and is closely related to the bacterial uridine (IPR010058 from INTERPRO) and inosine (IPR004402 from INTERPRO) phosphorylase equivalogs. In addition to the eukaryotes, a gene from Mycobacterium leprae is included in this equivalog and may have resulted from lateral gene transfer.; GO: 0004850 uridine phosphorylase activity, 0009166 nucleotide catabolic process, 0005737 cytoplasm. Probab=24.31 E-value=29 Score=17.57 Aligned_cols=17 Identities=41% Similarity=0.640 Sum_probs=10.5 Q ss_pred ECCCEEHHHHHHHHHHHHHHH Q ss_conf 334000787765456751212 Q gi|254780642|r 42 INTKMELTELEKSLSIVLHEK 62 (66) Q Consensus 42 intkmeltelekslsivlhek 62 (66) ++.-|-. -|+||+|||- T Consensus 90 ~SHGmG~----pS~SI~L~EL 106 (301) T TIGR01719 90 VSHGMGI----PSISIMLHEL 106 (301) T ss_pred EECCCCC----HHHHHHHHHH T ss_conf 8558685----5689999999 No 3 >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase). This CD includes each of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) which catalyzes the committed step in branched chain amino acid biosynthesis in plants and microorganisms, the pyridoxal 5'-phosphate (PLP)-dependent dehydration/deamination of L-threonine (or L-serine) to 2-ketobutyrate (or pyruvate). ThrD-I is a cooperative, feedback-regulated (isoleucine and valine) allosteric enzyme that forms a tetramer and contains four pyridoxal phosphate moieties. Members of this CD belong to the superfamily of ACT regulatory domains. Probab=18.97 E-value=39 Score=16.91 Aligned_cols=45 Identities=24% Similarity=0.323 Sum_probs=32.9 Q ss_pred HHHHHHHHHCCCCCCCCHHHHHHEEEHHEEEEEECCCEEHHHHHHHHH Q ss_conf 689998764277675501302520230100155334000787765456 Q gi|254780642|r 9 AKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLS 56 (66) Q Consensus 9 akalherwsqgkfnydqdridiiriasslleiqintkmelteleksls 56 (66) ..+|..+|+--.|||--.. -..|.-+.-||+...-+..+|.+.|. T Consensus 16 ~~~l~~~~~ITeF~YR~~~---~~~a~vlvGi~~~~~~d~~~l~~~L~ 60 (68) T cd04885 16 LELLGPPRNITEFHYRNQG---GDEARVLVGIQVPDREDLAELKERLE 60 (68) T ss_pred HHHHCCCCCEEEEEEEECC---CCEEEEEEEEEECCHHHHHHHHHHHH T ss_conf 9984998743589997069---86067999999598888999999999 No 4 >PRK06770 hypothetical protein; Provisional Probab=18.25 E-value=57 Score=16.08 Aligned_cols=14 Identities=43% Similarity=0.933 Sum_probs=10.4 Q ss_pred HHHHHHHHHCCCCC Q ss_conf 68999876427767 Q gi|254780642|r 9 AKALHERWSQGKFN 22 (66) Q Consensus 9 akalherwsqgkfn 22 (66) --+.-+||++|.|. T Consensus 118 ~l~Il~RW~~gDFS 131 (185) T PRK06770 118 LLAILERWEKGDFS 131 (185) T ss_pred HHHHHHHHHCCCHH T ss_conf 99999988516724 No 5 >pfam00585 Thr_dehydrat_C C-terminal regulatory domain of Threonine dehydratase. Threonine dehydratases pfam00291 all contain a carboxy terminal region. This region may have a regulatory role. Some members contain two copies of this region. This family is homologous to the pfam01842 domain. Probab=17.00 E-value=46 Score=16.55 Aligned_cols=45 Identities=22% Similarity=0.305 Sum_probs=33.7 Q ss_pred HHHHHHHHHCCCCCCCCHHHHHHEEEHHEEEEEECCCEEHHHHHHHHH Q ss_conf 689998764277675501302520230100155334000787765456 Q gi|254780642|r 9 AKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLS 56 (66) Q Consensus 9 akalherwsqgkfnydqdridiiriasslleiqintkmelteleksls 56 (66) ..++-.||+--.|||-...- ..|+-|.-||+..+-+..++.+.|. T Consensus 28 l~~l~~~~~ITeF~YR~~~~---~~a~VlvGi~~~~~~e~~~l~~~L~ 72 (91) T pfam00585 28 LDLLGGRNNITLFHYRKHGA---KNGSILVGVQLSQASDLDEFIERLE 72 (91) T ss_pred HHHHCCCCCEEEEEEECCCC---CCEEEEEEEEECCHHHHHHHHHHHH T ss_conf 99829955555899854589---7035999999798889999999999 No 6 >KOG3082 consensus Probab=15.85 E-value=77 Score=15.44 Aligned_cols=34 Identities=32% Similarity=0.287 Sum_probs=26.0 Q ss_pred CCCHHHHHHEEEHHEEEEEECCCEEHHHHHHHHHH Q ss_conf 55013025202301001553340007877654567 Q gi|254780642|r 23 YDQDRIDIIRIASSLLEIQINTKMELTELEKSLSI 57 (66) Q Consensus 23 ydqdridiiriasslleiqintkmeltelekslsi 57 (66) -+.+|.|+=.|-.+ -+.+||++...+||++|||- T Consensus 141 i~p~rFD~G~ilAQ-~~l~v~~~~t~~~L~~~Ls~ 174 (338) T KOG3082 141 IDPKRFDKGPILAQ-EYLAVNPKETAPELTASLSS 174 (338) T ss_pred ECCCCCCCCCCEEC-CEECCCCCCCCHHHHHHHHH T ss_conf 34011566660001-11225852220689999985 No 7 >pfam01270 Glyco_hydro_8 Glycosyl hydrolases family 8. Probab=12.11 E-value=78 Score=15.43 Aligned_cols=20 Identities=40% Similarity=0.891 Sum_probs=17.0 Q ss_pred HHHHHCCCCCCCCHHHHHHE Q ss_conf 98764277675501302520 Q gi|254780642|r 13 HERWSQGKFNYDQDRIDIIR 32 (66) Q Consensus 13 herwsqgkfnydqdridiir 32 (66) .+||..|.++|.++.+.++. T Consensus 109 ~~~Wg~~~y~y~~~a~~~~~ 128 (325) T pfam01270 109 GKQWGSGRYNYIQDAKNIIN 128 (325) T ss_pred HHHHCCCCHHHHHHHHHHHH T ss_conf 87658862417999999999 No 8 >pfam08695 DUF1783 Fungal protein of unknown function (DUF1783). This is a fungal family of uncharacterized proteins. Probab=11.55 E-value=53 Score=16.26 Aligned_cols=17 Identities=47% Similarity=0.767 Sum_probs=15.1 Q ss_pred HHHCCCCCCCCHHHHHH Q ss_conf 76427767550130252 Q gi|254780642|r 15 RWSQGKFNYDQDRIDII 31 (66) Q Consensus 15 rwsqgkfnydqdridii 31 (66) -|-+|..|-.|.||||- T Consensus 58 PWI~G~lN~~~GrIDis 74 (125) T pfam08695 58 PWISGELNQVQGRIDIS 74 (125) T ss_pred CCEECCCCCEEEEEEEE T ss_conf 70353200212477799 No 9 >TIGR02130 dapB_plant dihydrodipicolinate reductase; InterPro: IPR011859 This narrow family includes genes from Arabidopsis and Fibrobacter succinogenes (which probably recieved the gene from a plant via lateral gene transfer). The sequences are distantly related to the dihydrodipicolinate reductases from archaea. In Fibrobacter this gene is the only candidate DHPR in the genome.. Probab=11.26 E-value=1.2e+02 Score=14.56 Aligned_cols=37 Identities=30% Similarity=0.438 Sum_probs=29.9 Q ss_pred CCCHHHHHHHHHHHHCCCCCCCCHHHHHHEEEHHEEE Q ss_conf 2541346899987642776755013025202301001 Q gi|254780642|r 3 LDNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLE 39 (66) Q Consensus 3 ldnqksakalherwsqgkfnydqdridiiriasslle 39 (66) +|.--.|||.---+..=-|.||.|.|..||-...-+| T Consensus 163 ~D~SGTA~AV~~~FQKlG~~Y~~D~I~~~R~~K~Q~E 199 (275) T TIGR02130 163 LDASGTAKAVVSTFQKLGVDYDMDDIEKVRDEKEQIE 199 (275) T ss_pred CCCCCCHHHHHHHHHHCCCCCCHHHHHHHCCCCCCEE T ss_conf 6756530220102422473247215763227014162 No 10 >KOG2720 consensus Probab=11.16 E-value=1.2e+02 Score=14.48 Aligned_cols=18 Identities=33% Similarity=0.789 Sum_probs=14.0 Q ss_pred HHHHHHHHC----CCCCCCCHH Q ss_conf 899987642----776755013 Q gi|254780642|r 10 KALHERWSQ----GKFNYDQDR 27 (66) Q Consensus 10 kalherwsq----gkfnydqdr 27 (66) .++|+||.+ |-|+||-.. T Consensus 76 ~l~~~rWe~~~q~glF~Y~l~~ 97 (431) T KOG2720 76 SLVKGRWEDRFQRGLFRYDLTA 97 (431) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999899878760611144433 Done!