BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780642|ref|YP_003065055.1| hypothetical protein CLIBASIA_02645 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780642|ref|YP_003065055.1| hypothetical protein CLIBASIA_02645 [Candidatus Liberibacter asiaticus str. psy62] Length = 66 Score = 133 bits (335), Expect = 5e-34, Method: Compositional matrix adjust. Identities = 66/66 (100%), Positives = 66/66 (100%) Query: 1 MVLDNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLSIVLH 60 MVLDNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLSIVLH Sbjct: 1 MVLDNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLSIVLH 60 Query: 61 EKKENF 66 EKKENF Sbjct: 61 EKKENF 66 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 25.8 bits (55), Expect = 0.14, Method: Compositional matrix adjust. Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query: 8 SAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKME-LTELEKSLSIVLHEKKE 64 SA L R+ +F D+ ID++ AS+ + +QI+TK E L EL++ + I L +KE Sbjct: 372 SAAVLSNRYITDRFLPDK-AIDLMDEASARVRMQIDTKPEVLDELDRRI-ICLKIEKE 427 >gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62] Length = 1246 Score = 22.3 bits (46), Expect = 1.7, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 22 NYDQDRIDIIRIASSLLEIQINTK 45 N DQD+I +A +L IQ N K Sbjct: 14 NLDQDKIPSEDVAKTLTSIQDNIK 37 >gi|254780625|ref|YP_003065038.1| formamidopyrimidine-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 21.9 bits (45), Expect = 1.9, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 16/24 (66%) Query: 37 LLEIQINTKMELTELEKSLSIVLH 60 ++++ K L ELE +LSI++H Sbjct: 50 IIDVSRRAKYLLIELEGNLSIIVH 73 >gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22 [Candidatus Liberibacter asiaticus str. psy62] Length = 131 Score = 21.2 bits (43), Expect = 3.3, Method: Compositional matrix adjust. Identities = 16/62 (25%), Positives = 29/62 (46%) Query: 4 DNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLSIVLHEKK 63 DN+ +A A R S K N I R++ +L +++ + K E+ K+L + + Sbjct: 14 DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73 Query: 64 EN 65 N Sbjct: 74 NN 75 >gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 20.0 bits (40), Expect = 8.2, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 16/34 (47%) Query: 4 DNQKSAKALHERWSQGKFNYDQDRIDIIRIASSL 37 D + K +R+S D ID++R+A + Sbjct: 105 DTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNF 138 >gi|254781138|ref|YP_003065551.1| hypothetical protein CLIBASIA_05200 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 19.6 bits (39), Expect = 9.9, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 16/24 (66%) Query: 38 LEIQINTKMELTELEKSLSIVLHE 61 +E++IN + L E+E+ + + L E Sbjct: 32 IEVKINRALRLREMERKIVLSLVE 55 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.130 0.347 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,952 Number of Sequences: 1233 Number of extensions: 1168 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 66 length of database: 328,796 effective HSP length: 37 effective length of query: 29 effective length of database: 283,175 effective search space: 8212075 effective search space used: 8212075 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)