RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780644|ref|YP_003065057.1| hypothetical protein CLIBASIA_02655 [Candidatus Liberibacter asiaticus str. psy62] (289 letters) >d1scya_ g.3.7.2 (A:) Scyllatoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]} Length = 31 Score = 26.4 bits (58), Expect = 2.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 240 APANLSECQLNCLGLAVWGSC 260 A NL CQL+C L + G C Sbjct: 1 AFCNLRMCQLSCRSLGLLGKC 21 >d1vdha_ d.58.4.10 (A:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus [TaxId: 274]} Length = 247 Score = 26.7 bits (59), Expect = 2.6 Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 124 EEFAHSLSARIASSENAQVIEALYDIVKNRNDIMLLTKYGESLQILRRLTQE 175 EE + E Q +Y +V ++ D++ L L L Sbjct: 40 EELKGLVREWRELEEAGQGSYGIYQVVGHKADLLFLN-LRPGLDPLLEAEAR 90 >d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 88 Score = 26.3 bits (58), Expect = 3.0 Identities = 8/52 (15%), Positives = 19/52 (36%) Query: 120 MPIGEEFAHSLSARIASSENAQVIEALYDIVKNRNDIMLLTKYGESLQILRR 171 M E+ +L+ + + V+ L D D + + + +R+ Sbjct: 1 MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDEEIANQLNIKVNDVRK 52 >d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Score = 26.1 bits (56), Expect = 3.6 Identities = 8/52 (15%), Positives = 14/52 (26%) Query: 7 KLKEACDVATDSIRSFFMQAKPYILPALSKEEQKSLKYFFLPENTLCQKFFN 58 K K + ++K P + + L +F N K Sbjct: 201 KTKGFYCLRDSGKDRCLHESKGRAHPQVDPKLLDKLHEYFHEPNKKFFKLVG 252 >d1zpya1 a.25.1.5 (A:4-94) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]} Length = 91 Score = 24.7 bits (54), Expect = 8.4 Identities = 7/49 (14%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Query: 132 ARIASSENAQVIEALYDIVKNRNDIMLLTKYGESLQILRRLTQETEKHI 180 R+ + ++ ++ L R++ L+ +RR +K + Sbjct: 36 QRVNACKDKELKAILAHN---RDEEK--EHAAMLLEWIRRCDPAFDKEL 79 >d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Length = 275 Score = 24.7 bits (53), Expect = 8.6 Identities = 10/35 (28%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Query: 17 DSIRSFFMQAK-----PYILPALSKEEQKSLKYFF 46 + + SF+ +A P+ +PAL K E+ + +F Sbjct: 7 EKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFL 41 >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 86 Score = 24.8 bits (53), Expect = 8.8 Identities = 13/47 (27%), Positives = 21/47 (44%) Query: 49 ENTLCQKFFNAFDRHATAGIEIKKTMNATLQFLQKVPTADPQAVEYE 95 E C K F+ FDR+A + TM+ + Q + +A+ E Sbjct: 12 EKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKE 58 >d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 145 Score = 24.6 bits (53), Expect = 9.1 Identities = 8/52 (15%), Positives = 17/52 (32%) Query: 99 STVIANLTDSHQKYATNIATYMPIGEEFAHSLSARIASSENAQVIEALYDIV 150 V+ +H + A + I L+++ + A L +V Sbjct: 90 VCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVV 141 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.131 0.383 Gapped Lambda K H 0.267 0.0533 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,018,229 Number of extensions: 43325 Number of successful extensions: 149 Number of sequences better than 10.0: 1 Number of HSP's gapped: 149 Number of HSP's successfully gapped: 19 Length of query: 289 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 205 Effective length of database: 1,254,276 Effective search space: 257126580 Effective search space used: 257126580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.3 bits)