RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780645|ref|YP_003065058.1| hypothetical protein CLIBASIA_02660 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|35409 KOG0188, KOG0188, KOG0188, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 895 Score = 28.0 bits (62), Expect = 0.52 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 9/63 (14%) Query: 23 LQKDLNHIRQIINEGD--FKSAAVKMRILVESFLRKLSEKESISIPGSIKARKNCWNLST 80 L++D H+ IINE + F + R L + R+L S +IPG W L Sbjct: 350 LKRDPQHVIDIINEEEAQFLKTLDRGRKLFDRVAREL--GSSKTIPG-----DVAWRLYD 402 Query: 81 STG 83 + G Sbjct: 403 TYG 405 >gnl|CDD|35620 KOG0399, KOG0399, KOG0399, Glutamate synthase [Amino acid transport and metabolism]. Length = 2142 Score = 27.6 bits (61), Expect = 0.74 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Query: 24 QKDLNHIRQIINEGDFKSAAVK--MRILVESFLRKLSEKESISIPGSIKARKNCWNLSTS 81 + +LN + I+ EG SAA+ + +LV S R L E + +P +A +N N+ Sbjct: 339 KDELNKLLPIVEEGGSDSAALDNVLELLVRSGGRSLPEAVMMMVP---EAWQNDKNMDPE 395 Query: 82 TGAYLR 87 A+ Sbjct: 396 KKAFYD 401 >gnl|CDD|35098 COG5539, COG5539, Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]. Length = 306 Score = 27.3 bits (60), Expect = 1.0 Identities = 10/62 (16%), Positives = 23/62 (37%) Query: 6 TPPSKKSKGAQVKENLGLQKDLNHIRQIINEGDFKSAAVKMRILVESFLRKLSEKESISI 65 S + V E++ Q D + + Q ++ K+R +V + + + +I Sbjct: 100 FEKSVSQQSINVLEDMPGQDDNSRLFQAERYSLRDASVAKLREVVSLEVLSNPDLYNPAI 159 Query: 66 PG 67 Sbjct: 160 LE 161 >gnl|CDD|185748 cd09235, V_Alix, Middle V-domain of mammalian Alix and related domains are dimerization and protein interaction modules. This family contains the middle V-shaped (V) domain of mammalian Alix (apoptosis-linked gene-2 interacting protein X) and related domains. It belongs to the V_Alix_like superfamily which includes the V-domains of Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, mammalian His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), and related domains. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), is part of the ESCRT (Endosomal Sorting Complexes Required for Transport) system, and participates in membrane remodeling processes, including the budding of enveloped viruses, vesicle budding inside late endosomal multivesicular bodies (MVBs), the abscission reactions of mammalian cell division, and in apoptosis. The Alix V-domain is a dimerization domain, and contains a binding site, partially conserved in the V_Alix_like superfamily, for the retroviral late assembly (L) domain YPXnL motif. In addition to the V-domain, Alix also has an N-terminal Bro1-like domain, which binds components of the ESCRT-III complex, in particular CHMP4. The Bro1-like domain of Alix can also bind to human immunodeficiency virus type 1 (HIV-1) nucleocapsid. Alix also has a C-terminal proline-rich region (PRR) that binds multiple partners including Tsg101 (tumor susceptibility gene 101, a component of ESCRT-1), and the apoptotic protein ALG-2. Length = 339 Score = 25.3 bits (56), Expect = 3.2 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 4/30 (13%) Query: 7 PPSKKSKGAQVKENLGLQKDLNHIRQIINE 36 P S K V E G+Q I Q+I E Sbjct: 55 PQSLLEKSRTVIEKGGIQT----IDQLIKE 80 >gnl|CDD|147094 pfam04762, IKI3, IKI3 family. Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation. This region contains WD40 like repeats. Length = 918 Score = 25.0 bits (55), Expect = 4.7 Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 11/40 (27%) Query: 27 LNHIRQIINEGDFKSAAVKMR-------ILV----ESFLR 55 L IR++++ +K A + R IL E FL Sbjct: 688 LAGIRKLLDAKRYKDAFLTCRTHRIDLNILHDYDPELFLD 727 >gnl|CDD|37296 KOG2085, KOG2085, KOG2085, Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]. Length = 457 Score = 24.5 bits (53), Expect = 5.9 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Query: 2 HYDFTPPSKKSKGAQVKEN--LGLQKDLNHIRQIINEGDFKSAAVKMR 47 +DF P K KG ++K L L D+ R I+E + S VKM Sbjct: 70 LFDFNDPLKDLKGKEIKRQTLLELVDDVISRRGKISEEVY-SEVVKMF 116 >gnl|CDD|31726 COG1537, PelA, Predicted RNA-binding proteins [General function prediction only]. Length = 352 Score = 24.0 bits (52), Expect = 8.9 Identities = 16/65 (24%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Query: 26 DLNHIRQIINEGDFKSAAVKMRILVESFLRKLSEKESISIPGSIKARKNCWNLSTSTGAY 85 DL H+ II +GD A R + + K+ IP ++ + Sbjct: 22 DLWHLYNIIEKGDKVFAKTTRR---DESSDVIRSKKGERIPMTLGIKVEKIEFDKFAN-R 77 Query: 86 LRIRG 90 LRI+G Sbjct: 78 LRIKG 82 >gnl|CDD|176668 cd07244, FosA, FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases. Length = 121 Score = 23.9 bits (52), Expect = 10.0 Identities = 20/71 (28%), Positives = 28/71 (39%), Gaps = 12/71 (16%) Query: 5 FTPPSKKSKGA-----------QVKENLGLQKDLNHIRQIINEGDFKSAAVKMRIL-VES 52 F + KGA V N+G KD H ++E DF S K+R V+ Sbjct: 25 FKLHVRWDKGAYLEAGDLWLCLSVDANVGPAKDYTHYAFSVSEEDFASLKEKLRQAGVKE 84 Query: 53 FLRKLSEKESI 63 + SE +S Sbjct: 85 WKENTSEGDSF 95 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.131 0.371 Gapped Lambda K H 0.267 0.0733 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 999,633 Number of extensions: 39973 Number of successful extensions: 115 Number of sequences better than 10.0: 1 Number of HSP's gapped: 115 Number of HSP's successfully gapped: 13 Length of query: 91 Length of database: 6,263,737 Length adjustment: 60 Effective length of query: 31 Effective length of database: 4,967,197 Effective search space: 153983107 Effective search space used: 153983107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.4 bits)