RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780645|ref|YP_003065058.1| hypothetical protein CLIBASIA_02660 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >2aaz_A TS, tsase, thymidylate synthase; methyl transferase, nucleotide biosynthesis, transferase; HET: UMP CB3; 2.08A {Filobasidiella neoformans} (A:) Length = 317 Score = 26.2 bits (57), Expect = 1.6 Identities = 8/36 (22%), Positives = 16/36 (44%) Query: 6 TPPSKKSKGAQVKENLGLQKDLNHIRQIINEGDFKS 41 + K + + + L+ IR+IIN G+ + Sbjct: 3 ATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRP 38 >2a3l_A AMP deaminase, AMPD; atampd, AT2G38280, adenosine 5'-monophosphate deaminase, coformycin 5'-phosphate, structural genomics; HET: CF5; 3.34A {Arabidopsis thaliana} (A:1-258,A:325-701) Length = 635 Score = 24.7 bits (53), Expect = 4.1 Identities = 7/30 (23%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 25 KDLNHIRQIINEGDFKSAAVK-MRILVESF 53 DL+H+ ++I G+ ++ + + +L + F Sbjct: 192 TDLHHVLKVIAAGNIRTLCHRRLVLLEQKF 221 >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding, GET5, GET4; 1.99A {Saccharomyces cerevisiae} (A:1-130) Length = 130 Score = 24.7 bits (54), Expect = 4.5 Identities = 11/54 (20%), Positives = 19/54 (35%) Query: 12 SKGAQVKENLGLQKDLNHIRQIINEGDFKSAAVKMRILVESFLRKLSEKESISI 65 L K L I GD+ A +R + ++R S + +I + Sbjct: 2 VPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIEL 55 >1xl7_A COT, peroxisomal carnitine O-octanoyltransferase; selenomethionine, hepes; HET: EPE; 2.00A {Mus musculus} (A:1-95,A:393-612) Length = 315 Score = 24.2 bits (52), Expect = 6.4 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Query: 54 LRKLSEKESISIPG-------SIKARKNCWNLSTSTGAYLRIRGA 91 L ++++E + +P S + LSTS YLR++G Sbjct: 213 LLLIAKEEGLPVPELFEDPLFSRSGGGGNFVLSTSLVGYLRVQGV 257 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.131 0.371 Gapped Lambda K H 0.267 0.0546 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 634,786 Number of extensions: 21973 Number of successful extensions: 53 Number of sequences better than 10.0: 1 Number of HSP's gapped: 53 Number of HSP's successfully gapped: 7 Length of query: 91 Length of database: 4,956,049 Length adjustment: 52 Effective length of query: 39 Effective length of database: 3,198,189 Effective search space: 124729371 Effective search space used: 124729371 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.5 bits)