RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780645|ref|YP_003065058.1| hypothetical protein CLIBASIA_02660 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 628 Score = 27.2 bits (60), Expect = 0.41 Identities = 7/30 (23%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 25 KDLNHIRQIINEGDFKSAAVK-MRILVESF 53 DL+H+ ++I G+ ++ + + +L + F Sbjct: 119 TDLHHVLKVIAAGNIRTLCHRRLVLLEQKF 148 >d1nm8a2 c.43.1.3 (A:386-599) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Score = 23.7 bits (51), Expect = 4.6 Identities = 8/33 (24%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Query: 54 LRKLSEKESISIPG----SIKARKNCWNLSTST 82 L+ + ++ +S P + A ++LSTS Sbjct: 117 LKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQ 149 >d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 190 Score = 22.4 bits (48), Expect = 9.8 Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Query: 38 DFKSAAVKMRILVESFLRKLSEKESISIPGSIKARKNCWNLSTSTGAYLRIRG 90 D S + R + E L L E + K+ + Y+R G Sbjct: 139 DRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGL----YMRHLG 187 >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Score = 22.5 bits (47), Expect = 10.0 Identities = 9/40 (22%), Positives = 16/40 (40%) Query: 37 GDFKSAAVKMRILVESFLRKLSEKESISIPGSIKARKNCW 76 G+ + + I E LR + ++ S PG + C Sbjct: 7 GNLAAKVELVDIQREGALRFMVADDAASGPGGTAQWQKCR 46 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.131 0.371 Gapped Lambda K H 0.267 0.0638 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 317,866 Number of extensions: 11656 Number of successful extensions: 32 Number of sequences better than 10.0: 1 Number of HSP's gapped: 32 Number of HSP's successfully gapped: 8 Length of query: 91 Length of database: 2,407,596 Length adjustment: 55 Effective length of query: 36 Effective length of database: 1,652,446 Effective search space: 59488056 Effective search space used: 59488056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.1 bits)