RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780647|ref|YP_003065060.1| 50S ribosomal protein L27 [Candidatus Liberibacter asiaticus str. psy62] (90 letters) >gnl|CDD|180080 PRK05435, rpmA, 50S ribosomal protein L27; Validated. Length = 82 Score = 147 bits (374), Expect = 6e-37 Identities = 55/83 (66%), Positives = 70/83 (84%), Gaps = 1/83 (1%) Query: 1 MAHKKSGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTRYHPGLNVGLGKDHTIY 60 MAHKK GGST+NGRDS +RLG+K+ GGQ V AGNII+RQRGT++HPG+NVG GKDHT++ Sbjct: 1 MAHKKGGGSTRNGRDSESKRLGVKRFGGQFVKAGNIIVRQRGTKFHPGVNVGRGKDHTLF 60 Query: 61 ALVDGHVRFFKKFSKGRAYVSVI 83 ALVDG V+ F++ + R YVSV+ Sbjct: 61 ALVDGVVK-FERKGRNRKYVSVV 82 >gnl|CDD|161685 TIGR00062, L27, ribosomal protein L27. Eubacterial, chloroplast, and mitochondrial. Mitochondrial members have an additional C-terminal domain. Length = 83 Score = 115 bits (290), Expect = 2e-27 Identities = 52/83 (62%), Positives = 68/83 (81%) Query: 1 MAHKKSGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTRYHPGLNVGLGKDHTIY 60 MA KK GST+NGRDS +RLG+K++GGQ V AG+II+RQRGT++HPG NVG+GKDHT++ Sbjct: 1 MATKKGVGSTKNGRDSEAKRLGVKRAGGQFVRAGSIIVRQRGTKFHPGNNVGMGKDHTLF 60 Query: 61 ALVDGHVRFFKKFSKGRAYVSVI 83 AL DG V+F KK + R +VSV+ Sbjct: 61 ALSDGVVKFEKKGKRSRKFVSVV 83 >gnl|CDD|173305 PRK14844, PRK14844, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional. Length = 2836 Score = 27.7 bits (61), Expect = 0.67 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 12/69 (17%) Query: 28 GQSVIAGNIIIRQ-RGTRYHPGLNVGLG-----------KDHTIYALVDGHVRFFKKFSK 75 GQ V AG++I R R + + GL K+H I + +DG+V F +K + Sbjct: 2531 GQKVHAGDVITRTPRESVKTRDITGGLPRVIELFEARRPKEHAIVSEIDGYVAFSEKDRR 2590 Query: 76 GRAYVSVIP 84 G+ + + P Sbjct: 2591 GKRSILIKP 2599 >gnl|CDD|163268 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase. Members of this protein family are L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31), product of the LYS2 gene. It is also called alpha-aminoadipate reductase. In fungi, lysine is synthesized via aminoadipate. Currently, all members of this family are fungal. Length = 1389 Score = 27.3 bits (61), Expect = 0.86 Identities = 24/81 (29%), Positives = 29/81 (35%), Gaps = 11/81 (13%) Query: 15 DSAGQRLGLKKSGGQSVIAGNIIIRQ------RGTRYHPGLNVGLGKDHTIYALVDGHVR 68 D G GL GQS IIR+ RG PG G K D Sbjct: 1138 DLMGSSKGLGTGYGQSKWVAEYIIREAGKRGLRGCIVRPGYVTGDSKTGATNT--DD--- 1192 Query: 69 FFKKFSKGRAYVSVIPKIEDT 89 F + KG + +IP I +T Sbjct: 1193 FLLRMLKGCIQLGLIPNINNT 1213 >gnl|CDD|148939 pfam07596, SBP_bac_10, Protein of unknown function (DUF1559). A large family of paralogous proteins apparently unique to planctomycetes. Length = 263 Score = 24.7 bits (54), Expect = 5.8 Identities = 17/67 (25%), Positives = 23/67 (34%), Gaps = 11/67 (16%) Query: 6 SGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTR-YHPGL-NVGLGKDHTIYALV 63 SG S +G ++ G + G+ RG HPG N + Sbjct: 199 SGPSYGSGTNTTTPTNGSGPAPSGPGGGGDNGNANRGFGSAHPGGVNFLMA--------- 249 Query: 64 DGHVRFF 70 DG VRF Sbjct: 250 DGSVRFI 256 >gnl|CDD|180950 PRK07373, PRK07373, DNA polymerase III subunit alpha; Reviewed. Length = 449 Score = 24.6 bits (54), Expect = 6.2 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Query: 37 IIRQRGTRYHPGLNVGLGKDHTIYALVDGHVR---FFKKFSKGRAYVS 81 II +R P ++G+ +DH + L +G + F K S AYV+ Sbjct: 4 IISRRSLGVQPVYDIGVAQDHN-FLLANGLIASNCFNKSHSTAYAYVT 50 >gnl|CDD|184527 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional. Length = 376 Score = 24.2 bits (53), Expect = 6.9 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Query: 46 HPGLNVGLGKDHTIYALVDGHVRFFKKFSKGRAY-VSV 82 H GL + IYALV+G + + +G AY VSV Sbjct: 305 HEGLKKSWSDE--IYALVNGKWQKVGELPQGLAYGVSV 340 >gnl|CDD|182544 PRK10555, PRK10555, aminoglycoside/multidrug efflux system; Provisional. Length = 1037 Score = 24.0 bits (52), Expect = 7.7 Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 54 GKDHTIYALVDGHVRFFKKFSKGRAYVSVIPKI 86 K T +A+++ + F K + R S P I Sbjct: 638 SKTGTSFAIIERATKAFNKIKEARVIASSPPAI 670 >gnl|CDD|183268 PRK11667, PRK11667, hypothetical protein; Provisional. Length = 163 Score = 23.9 bits (52), Expect = 9.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 5 KSGGSTQNGRDSAGQRLGLKKSGGQSVIAGN 35 GS+Q G S GL GGQ++ AG+ Sbjct: 41 GQAGSSQQGGWSLSSLTGLLSGGGQALSAGS 71 >gnl|CDD|151457 pfam11010, DUF2848, Protein of unknown function (DUF2848). This bacterial family of proteins has no known function. Length = 194 Score = 23.7 bits (52), Expect = 9.5 Identities = 8/22 (36%), Positives = 11/22 (50%), Gaps = 5/22 (22%) Query: 37 IIRQRGTRYHPGLNVGLGKDHT 58 +IR G +G+G DHT Sbjct: 61 LIRHEGRLL-----LGVGSDHT 77 >gnl|CDD|161766 TIGR00211, glyS, glycyl-tRNA synthetase, tetrameric type, beta subunit. The glycyl-tRNA synthetases differ even among the eubacteria in oligomeric structure. In Escherichia coli and most others, it is a heterodimer of two alpha chains and two beta chains, encoded by tandem genes. The genes are similar, but fused, in Chlamydia trachomatis. By contrast, the glycyl-tRNA synthetases of Thermus thermophilus and of archaea and eukaryotes differ considerably; they are homodimeric, mutually similar, and not detected by this model. Length = 691 Score = 24.0 bits (52), Expect = 9.7 Identities = 10/39 (25%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Query: 48 GLNVGLGKDHTIYALVDGHVRFFKKFSKGRAYVSVIPKI 86 G+NV +D I+ G F +K +G+ ++P + Sbjct: 99 GINV---EDAEIFQTDKGEWLFVRKIHEGQPTKDLLPPL 134 >gnl|CDD|132166 TIGR03122, one_C_dehyd_C, formylmethanofuran dehydrogenase subunit C. Members of this largely archaeal protein family are subunit C of the formylmethanofuran dehydrogenase. Nomenclature in some bacteria may reflect inclusion of the formyltransferase described by TIGR03119 as part of the complex, and therefore call this protein formyltransferase/hydrolase complex Fhc subunit C. Note that this model does not distinguish tungsten (FwdC) from molybdenum-containing (FmdC) forms of this enzyme. Length = 260 Score = 23.8 bits (52), Expect = 9.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 16 SAGQRLGLKKSGGQSVIAGN 35 +AG LG + GG+ +I GN Sbjct: 152 NAGDYLGERMRGGEILIEGN 171 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.137 0.397 Gapped Lambda K H 0.267 0.0722 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,463,075 Number of extensions: 80486 Number of successful extensions: 134 Number of sequences better than 10.0: 1 Number of HSP's gapped: 133 Number of HSP's successfully gapped: 17 Length of query: 90 Length of database: 5,994,473 Length adjustment: 59 Effective length of query: 31 Effective length of database: 4,719,601 Effective search space: 146307631 Effective search space used: 146307631 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)