HHsearch alignment for GI: 254780648 and conserved domain: PRK05291

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed.
Probab=99.94  E-value=9.6e-28  Score=188.01  Aligned_cols=152  Identities=24%  Similarity=0.236  Sum_probs=119.8

Q ss_pred             ECEEEEECCCCCCCEEEEEECCCCCH-HHHHHHCCCEECCEEEEECCEEEEEECCCCCCCCCCCCCCCHHH-HHHHHHHH
Q ss_conf             01124421677753035410145401-21211000000102663298689982264212473116775123-44333335
Q gi|254780648|r  160 ADIGIIGLPNAGKSTFLASVTRAKPK-IADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDR-FLKHTERT  237 (335)
Q Consensus       160 aDVglVG~PNaGKSTLln~ls~ak~k-Ia~ypFTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~~~glG~~-FLrhIer~  237 (335)
T Consensus       217 ~~v~i~G~PN~GKSSL~N~L~~~drAIVS~ipGTTRD~ie~~l~l~G~~v~l~DTAGiR~t~d~IE~~GI~ra~~~~~~A  296 (445)
T PRK05291        217 LKVVIAGRPNVGKSSLLNALLGEERAIVTDIAGTTRDVIEEHINLDGIPLRLIDTAGIRETEDEVEKIGIERSRKAIEEA  296 (445)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEECCCCCCCCCEEEEEEEECCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             86998899987689999998578746731899974040223689999899999899766557458899999999999839


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             78875202222110134666789987776675059889999746589988999999999986299489998887889999
Q gi|254780648|r  238 HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQ  317 (335)
Q Consensus       238 ~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~~~~~~vi~ISA~tg~GI~e  317 (335)
T Consensus       297 Dlil~v~D~s~~~~~~~~~~~--------~~~~~~~~i~V~NK~DL~~~~~-----------~~~~~i~iSak~g~Gi~~  357 (445)
T PRK05291        297 DLVLLVLDASEPLTEEDKEIL--------EEFKNKPVIVVLNKADLTGEKI-----------DGLPVIRISAKTGEGIDE  357 (445)
T ss_pred             CEEEEEEECCCCCCCCHHHHH--------HHCCCCCEEEEEEHHHCCCCCC-----------CCCCEEEEECCCCCCHHH
T ss_conf             999999879988872259999--------8517998799985120466534-----------789759998378869999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999998545
Q gi|254780648|r  318 ILECLHDKIFSIR  330 (335)
Q Consensus       318 L~~~I~e~L~~~r  330 (335)
T Consensus       358 L~~~i~~~~~~~~  370 (445)
T PRK05291        358 LEEALKQLVGFQG  370 (445)
T ss_pred             HHHHHHHHHHCCC
T ss_conf             9999999970468