HHsearch alignment for GI: 254780648 and conserved domain: cd01879

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily. E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=100.00  E-value=3.7e-37  Score=245.12  Aligned_cols=156  Identities=23%  Similarity=0.367  Sum_probs=128.3

Q ss_pred             EEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEECCEEEEEECCCCCC--CCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             442167775303541014540121211000000102663298689982264212--473116775123443333357887
Q gi|254780648|r  164 IIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGII--KNAHQGAGIGDRFLKHTERTHVLL  241 (335)
Q Consensus       164 lVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~~~~~~i~D~PGlI--egA~~~~glG~~FLrhIer~~vLl  241 (335)
T Consensus         1 ivG~pNvGKSTL~N~L~g~~~~vs~~pgtTrd~~~~~~~~~~~~~~lvDtpGi~~~~~~~~~e~i~~~~~~~-~~~d~vl   79 (158)
T cd01879           1 LVGNPNVGKTTLFNALTGARQKVGNWPGVTVEKKEGRFKLGGKEIEIVDLPGTYSLSPYSEDEKVARDFLLG-EKPDLIV   79 (158)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCEECCCCCCEEEEEEEEEEECCEEEEEEECCCCCCCCCCCHHHHHHHHHHHH-CCCCCEE
T ss_conf             979898889999999959986461789827634788996299379999798741256413567899999985-1787179


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             52022221101346667899877766750598899997465899889999999999862994899988878899999999
Q gi|254780648|r  242 HIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILEC  321 (335)
Q Consensus       242 ~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~~~~~~vi~ISA~tg~GI~eL~~~  321 (335)
T Consensus        80 ~vvD~~~--~~~~l~~~~-~l~~-----~~~p~ivV~NK~D~~~~~~~~~~~~~l~~~~~~~ii~iSA~~g~Gi~~L~~~  151 (158)
T cd01879          80 NVVDATN--LERNLYLTL-QLLE-----LGLPVVVALNMIDEAEKRGIKIDLDKLSELLGVPVVPTSARKGEGIDELKDA  151 (158)
T ss_pred             EEEECCH--HHHHHHHHH-HHHH-----CCCCEEEEEEHHHHHHHCCCHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
T ss_conf             9977740--677689999-9986-----5998899940277655225466799999871994899987789799999999


Q ss_pred             HHHHHHH
Q ss_conf             9999985
Q gi|254780648|r  322 LHDKIFS  328 (335)
Q Consensus       322 I~e~L~~  328 (335)
T Consensus       152 i~el~~k  158 (158)
T cd01879         152 IAELAEK  158 (158)
T ss_pred             HHHHHCC
T ss_conf             9998675