>cd01886 EF-G Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group conta

Probab=99.25 E-value=3.7e-11 Score=87.44 Aligned_cols=123 Identities=20% Similarity=0.240 Sum_probs=76.0 Q ss_pred CEEEEECCCCCCCEEEEEE---CCC---CCH------HHHHH------HCCCEECCEEEEECCEEEEEECCCCCCCCCCC Q ss_conf 1124421677753035410---145---401------21211------00000010266329868998226421247311 Q gi|254780648|r 161 DIGIIGLPNAGKSTFLASV---TRA---KPK------IADYP------FTTLYPNLGIVKEGYKEFILADIPGIIKNAHQ 222 (335) Q Consensus 161 DVglVG~PNaGKSTLln~l---s~a---k~k------Ia~yp------FTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~ 222 (335) T Consensus 1 Niai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~----- 75 (270) T cd01886 1 NIGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHV----- 75 (270) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCH----- T ss_conf 989996899998899999998668735581553897556684889876870733668999899899998696967----- Q ss_pred CCCCHHHHHHHHHH----HHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHH Q ss_conf 67751234433333----57887520222211013466678998777667505988999974658998899999999998 Q gi|254780648|r 223 GAGIGDRFLKHTER----THVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELAT 298 (335) Q Consensus 223 ~~glG~~FLrhIer----~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~ 298 (335) T Consensus 76 ------DF~~e~~~aL~~~D~AviVv~a~~G-Ve~~T~~~w~~~~~-----~~lP~i~fINKmDre~ad-~~~~l~~i~~ 142 (270) T cd01886 76 ------DFTIEVERSLRVLDGAVAVFDAVAG-VEPQTETVWRQADR-----YNVPRIAFVNKMDRTGAD-FFRVVEQIRE 142 (270) T ss_pred ------HHHHHHHHHHHHHCEEEEEEECCCC-HHHHHHHHHHHHHH-----CCCCEEEEEECCCCCCCC-CHHHHHHHHH T ss_conf ------8899999998775559999846764-42636999988998-----499989999887877887-1668999999 Q ss_pred HCC Q ss_conf 629 Q gi|254780648|r 299 QCG 301 (335) Q Consensus 299 ~~~ 301 (335) T Consensus 143 ~lg 145 (270) T cd01886 143 KLG 145 (270) T ss_pred HHC T ss_conf 858

HHsearch alignment for GI: 254780648 and conserved domain: cd01886