>cd04149 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed t

Probab=99.76 E-value=2.4e-18 Score=131.09 Aligned_cols=152 Identities=18% Similarity=0.190 Sum_probs=100.4 Q ss_pred EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEECCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHH Q ss_conf 12442167775303541014540121211000000102663298689982264212473116775123443333357887 Q gi|254780648|r 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLL 241 (335) Q Consensus 162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~~~glG~~FLrhIer~~vLl 241 (335) T Consensus 12 ililG~~~sGKTsil~~l~~~~~~-~~~--pTvg~~~~~~~~~~~~l~iwD~~Gq----e~~r~l~~~y---~~~~~~ii 81 (168) T cd04149 12 ILMLGLDAAGKTTILYKLKLGQSV-TTI--PTVGFNVETVTYKNVKFNVWDVGGQ----DKIRPLWRHY---YTGTQGLI 81 (168) T ss_pred EEEECCCCCCHHHHHHHHHCCCCC-CCC--CCCCCEEEEEEECCEEEEEEECCCC----CCCCCHHHHH---CCCCCEEE T ss_conf 999999999989999999669987-602--6267007999989889999989999----7466065764---37886689 Q ss_pred HHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHH--H--HHCCCCEEEEECCCCCCHHH Q ss_conf 5202222110134666789987776675059889999746589988999999999--9--86299489998887889999 Q gi|254780648|r 242 HIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNEL--A--TQCGQVPFEFSSITGHGIPQ 317 (335) Q Consensus 242 ~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l--~--~~~~~~vi~ISA~tg~GI~e 317 (335) T Consensus 82 fVvDstd~~~~~~~~~~l~~~l~-~~~~~~~pilI~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gv~e 160 (168) T cd04149 82 FVVDSADRDRIDEARQELHRIIN-DREMRDALLLVFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYE 160 (168) T ss_pred EEEECCCHHHHHHHHHHHHHHHH-CHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCHHHHHCCCCEEEEEECCCCCCHHH T ss_conf 99837767899999999999971-45227986999997566777889999999978765517980999806878969799 Q ss_pred HHHHHHH Q ss_conf 9999999 Q gi|254780648|r 318 ILECLHD 324 (335) Q Consensus 318 L~~~I~e 324 (335) T Consensus 161 ~f~WL~~ 167 (168) T cd04149 161 GLTWLSS 167 (168) T ss_pred HHHHHHC T ss_conf 9999865

HHsearch alignment for GI: 254780648 and conserved domain: cd04149