>cd04163 Era Era subfamily. Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.

Probab=100.00 E-value=3.3e-35 Score=233.29 Aligned_cols=160 Identities=26% Similarity=0.334 Sum_probs=127.3 Q ss_pred CEEEEECCCCCCCEEEEEECCCCCH-HHHHHHCCCEECCEEEEECCEEEEEECCCCCCCCCCC-CCCCHHHHHHHHHHHH Q ss_conf 1124421677753035410145401-2121100000010266329868998226421247311-6775123443333357 Q gi|254780648|r 161 DIGIIGLPNAGKSTFLASVTRAKPK-IADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQ-GAGIGDRFLKHTERTH 238 (335) Q Consensus 161 DVglVG~PNaGKSTLln~ls~ak~k-Ia~ypFTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~-~~glG~~FLrhIer~~ 238 (335) T Consensus 5 ~V~ivG~pN~GKSsL~N~L~~~~~a~vs~~~gtTr~~~~~~~~~~~~~~~l~DtpG~~~~~~~~~~~~~~~~~~~l~~~D 84 (168) T cd04163 5 FVAIVGRPNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIYTDDDAQIIFVDTPGIHKPKKKLGERMVKAAWSALKDVD 84 (168) T ss_pred EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCEEECCCEEEEEECCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCC T ss_conf 89999999999999999995897033238898263442368984997899995898665145677899999998651365 Q ss_pred HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCH-HHHHHHHHHHHHHCC-CCEEEEECCCCCCHH Q ss_conf 887520222211013466678998777667505988999974658998-899999999998629-948999888788999 Q gi|254780648|r 239 VLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDS-DTLARKKNELATQCG-QVPFEFSSITGHGIP 316 (335) Q Consensus 239 vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~-e~~~~~~~~l~~~~~-~~vi~ISA~tg~GI~ 316 (335) T Consensus 85 ~il~vvD~~~~~~~~d~~-i~~~l~~-----~~~~~iivlNK~Dl~~~~~~~~~~~~~~~~~~~~~~vi~iSA~~g~Gid 158 (168) T cd04163 85 LVLFVVDASEPIGEGDEF-ILELLKK-----SKTPVILVLNKIDLVKDKEDLLPLLEKLKELGPFAEIFPISALKGENVD 158 (168) T ss_pred EEEEEEECCCCCCHHHHH-HHHHHHH-----CCCCEEEEEECEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHH T ss_conf 589999789898667799-9999998-----0998599997887047877899999999961899968999777896999 Q ss_pred HHHHHHHHHH Q ss_conf 9999999999 Q gi|254780648|r 317 QILECLHDKI 326 (335) Q Consensus 317 eL~~~I~e~L 326 (335) T Consensus 159 ~L~~~i~~~L 168 (168) T cd04163 159 ELLEEIVKYL 168 (168) T ss_pred HHHHHHHHHC T ss_conf 9999999539

HHsearch alignment for GI: 254780648 and conserved domain: cd04163