RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780649|ref|YP_003065062.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] (216 letters) >gnl|CDD|31257 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism]. Length = 197 Score = 126 bits (319), Expect = 3e-30 Identities = 50/193 (25%), Positives = 94/193 (48%), Gaps = 7/193 (3%) Query: 18 PGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISL 77 KI LFGG+F+PPH+GH+ IA+ A+ +L LD++ ++ +P K +S E R+++ Sbjct: 1 KMKKIALFGGSFDPPHYGHLLIAEEALDQLGLDKVIFLPSPVPPHKKKKELASAEHRLAM 60 Query: 78 SQSLIK-NPRIRITAFEAYLNH-TETFHTILQVK-KHNKSVNFVWIMGADNIKSFHQWHH 134 + I+ NPR ++ E + T T+ ++ ++ V +I+GADN+ S +W+ Sbjct: 61 LELAIEDNPRFEVSDREIKRGGPSYTIDTLEHLRQEYGPDVELYFIIGADNLASLPKWYD 120 Query: 135 WKRIVTTVPIAIIDR---FDVTFNYISS-PMAKTFEYARLDESLSHILCTTSPPSWLFIH 190 W ++ V + R ++ + +SS + RLD S + I + + Sbjct: 121 WDELLKLVTFVVAPRPGYGELELSLLSSGGAIILLDLPRLDISSTEIRERIRRGASVDYL 180 Query: 191 DRHHIISSTAIRK 203 ++S R Sbjct: 181 LPDSVLSYIEERG 193 >gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase. Nicotinamide/nicotinate mononucleotide (NMN/ NaMN)adenylyltransferase (NMNAT). NMNAT represents the primary bacterial and eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide. It is an indispensable enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. Human NMNAT displays unique dual substrate specificity toward both NMN and NaMN, and can participate in both de novo and salvage pathways of NAD synthesis. Length = 192 Score = 117 bits (296), Expect = 2e-27 Identities = 44/195 (22%), Positives = 90/195 (46%), Gaps = 20/195 (10%) Query: 22 IGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSL 81 I LFGG+F+PPH GH+ IA+ A+++L LD++ + + K +S E R+ + + Sbjct: 1 IALFGGSFDPPHLGHLAIAEEALEELGLDRVLLLPSANPPHKPPKP-ASFEHRLEMLKLA 59 Query: 82 IK-NPRIRITAFEAYLN-HTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIV 139 I+ NP+ ++ E + + T T+ ++++ + +I+G+DN+ +W+ W+ ++ Sbjct: 60 IEDNPKFEVSDIEIKRDGPSYTIDTLEELRERYPNAELYFIIGSDNLIRLPKWYDWEELL 119 Query: 140 TTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISST 199 + V + + R S + + + ISST Sbjct: 120 SLVHLVVAPRPGYPIEDASLEKLLLPGG-----------------RIILLDNPLLNISST 162 Query: 200 AIRKKIIEQDNTRTL 214 IR+++ + R L Sbjct: 163 EIRERLKNGKSIRYL 177 >gnl|CDD|144891 pfam01467, CTP_transf_2, Cytidylyltransferase. This family includes: Cholinephosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase. Length = 148 Score = 79.4 bits (196), Expect = 6e-16 Identities = 39/182 (21%), Positives = 75/182 (41%), Gaps = 35/182 (19%) Query: 24 LFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIK 83 LFGG F+P H GH+ + + A + +LD++ + + + K+ S E+R+ + + ++ Sbjct: 1 LFGGTFDPIHLGHLRLLEQAKELFDLDKIVGVPSDESPHKDTKNLFSAEERLEMLELALE 60 Query: 84 -NPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTV 142 +P + + FE ++ +I+GAD + + W ++ Sbjct: 61 VDPNLEVDDFE--------------------DLDVYFIIGADALVNLRGWRGVTELLPEF 100 Query: 143 PIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIR 202 I +++R P+ E L E L L +D ISST IR Sbjct: 101 QIVVVNR----------PLDYGLETVFLREELDKYPLGKIVIPDLPYND----ISSTEIR 146 Query: 203 KK 204 ++ Sbjct: 147 ER 148 >gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain. Cytidylyltransferase-like domain. Many of these proteins are known to use CTP or ATP and release pyrophosphate. Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown. Length = 143 Score = 41.3 bits (97), Expect = 2e-04 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 8/142 (5%) Query: 22 IGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIIT--PFNSVKNYNLSSSLEKRISLSQ 79 +G+ G F P H GH+++ + A + LD++ II P +N + S E+ L + Sbjct: 1 VGIIIGRFEPFHLGHLKLIKEA-LEEALDEVIIIIVSNPPKKKRNKDPFSLHERVEMLKE 59 Query: 80 SLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQW--HHWKR 137 L ++ F IL++ V +G D + K Sbjct: 60 ILKDRLKVVPVDFPEVKI-LLAVVFILKILLKVGPDKVV--VGEDFAFGKNASYNKDLKE 116 Query: 138 IVTTVPIAIIDRFDVTFNYISS 159 + + I + R S+ Sbjct: 117 LFLDIEIVEVPRVRDGKKISST 138 >gnl|CDD|31013 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism]. Length = 159 Score = 39.4 bits (92), Expect = 7e-04 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Query: 20 MKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQ 79 MKI ++ G+F+P +GH++I + A D++ + N K SLE+R+ L + Sbjct: 2 MKIAVYPGSFDPITNGHLDIIKRASAL--FDEVIVAVA-INPSKKPLF--SLEERVELIR 56 Query: 80 SLIKN-PRIRITAFEAYL 96 K+ P + + F L Sbjct: 57 EATKHLPNVEVVGFSGLL 74 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 35.4 bits (82), Expect = 0.011 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 21/96 (21%) Query: 15 KVEPGMKIGLFGGN-------------FNPPHHGHIEIAQIAIKKLNLDQLWWIIT---- 57 ++PG K+ + G + P G I I + ++ L+L+ L I Sbjct: 24 TIKPGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEILIDGVDLRDLDLESLRKNIAYVPQ 83 Query: 58 -PF---NSVKNYNLSSSLEKRISLSQSLIKNPRIRI 89 PF +++ LS +RI+++++L+++P I I Sbjct: 84 DPFLFSGTIRENILSGGQRQRIAIARALLRDPPILI 119 >gnl|CDD|31256 COG1056, NadR, Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism]. Length = 172 Score = 34.1 bits (78), Expect = 0.031 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 18 PGMKIGLFGGNFNPPHHGHIEIAQIAIKK 46 MK G++ G F P H GH+ + + A+ K Sbjct: 1 SRMKRGVYFGRFQPLHTGHLYVIKRALSK 29 >gnl|CDD|173914 cd02163, PPAT, Phosphopantetheine adenylyltransferase. Phosphopantetheine adenylyltransferase (PPAT). PPAT is an essential enzyme in bacteria, responsible for catalyzing the rate-limiting step in coenzyme A (CoA) biosynthesis. The dinucleotide-binding fold of PPAT is homologous to class I aminoacyl-tRNA synthetases. CoA has been shown to inhibit PPAT and competes with ATP, PhP, and dPCoA. PPAT is a homohexamer in E. coli. Length = 153 Score = 31.7 bits (73), Expect = 0.18 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 8/74 (10%) Query: 22 IGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPF-NSVKNYNLSSSLEKRISL-SQ 79 I ++ G+F+P +GH++I + A K D++ I+ N K SLE+R+ L + Sbjct: 1 IAVYPGSFDPITNGHLDIIERASKL--FDEV--IVAVAVNPSKKPLF--SLEERVELIRE 54 Query: 80 SLIKNPRIRITAFE 93 + P + + F+ Sbjct: 55 ATKHLPNVEVDGFD 68 >gnl|CDD|30545 COG0196, RibF, FAD synthase [Coenzyme metabolism]. Length = 304 Score = 30.6 bits (69), Expect = 0.35 Identities = 37/186 (19%), Positives = 61/186 (32%), Gaps = 36/186 (19%) Query: 27 GNFNPPHHGH---IEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIK 83 GNF+ H GH + A A +K L + +IT + R++ Sbjct: 22 GNFDGVHLGHQKLLAQALEAAEKRGLPVV--VITFEPHPRELLKPDKPPTRLT------- 72 Query: 84 NPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVP 143 R +I Y + + + + F + + ++ + + K IV Sbjct: 73 PLREKIRLLAGYG--------VDALVVLDFDLEFANLSAEEFVELLVEKLNVKHIVVG-- 122 Query: 144 IAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRK 203 FD F E R + T P I++ ISSTAIR+ Sbjct: 123 ------FDFRFGK---GRQGNAELLR-ELGQKGFEVTIVPK----INEEGIRISSTAIRQ 168 Query: 204 KIIEQD 209 + E D Sbjct: 169 ALREGD 174 >gnl|CDD|173919 cd02168, NMNAT_Nudix, Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain. N-terminal NMNAT (Nicotinamide/nicotinate mononucleotide adenylyltransferase) domain of a novel bifunctional enzyme endowed with NMN adenylyltransferase and Nudix hydrolase activities. This domain is highly homologous to the archeal NMN adenyltransferase that catalyzes NAD synthesis from NMN and ATP. NMNAT is an essential enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. The C-terminal domain of this enzyme shares homology with the archaeal ADP-ribose pyrophosphatase, a member of the 'Nudix' hydrolase family. Length = 181 Score = 30.0 bits (68), Expect = 0.46 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 22 IGLFGGNFNPPHHGHIEIAQIAIKK 46 ++ G F P H+GH+ + IA++K Sbjct: 1 YLVYIGRFQPFHNGHLAVVLIALEK 25 >gnl|CDD|173918 cd02167, NMNAT_NadR, Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins. NMNAT domain of NadR protein. The NadR protein (NadR) is a bifunctional enzyme possessing both NMN adenylytransferase (NMNAT) and ribosylnicotinamide kinase (RNK) activities. Its function is essential for the growth and survival of H. influenzae and thus may present a new highly specific anti-infectious drug target. The N-terminal domain that hosts the NMNAT activity is closely related to archaeal NMNAT. The bound NAD at the active site of the NMNAT domain reveals several critical interactions between NAD and the protein.The NMNAT domain of hiNadR defines yet another member of the pyridine nucleotide adenylyltransferase. Length = 158 Score = 27.8 bits (62), Expect = 2.2 Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Query: 22 IGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSL 81 IG+ G F P H GH+ + A+ + +D+L I+ ++ + LEKR+ + + Sbjct: 1 IGIVFGKFAPLHTGHVYLIYKALSQ--VDELLIIVGSDDTRDDARTGLPLEKRLRWLREI 58 Query: 82 IKNPR-IRITAFE 93 + I + Sbjct: 59 FPDQENIVVHTLN 71 >gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]. Length = 245 Score = 27.6 bits (61), Expect = 2.6 Identities = 11/58 (18%), Positives = 30/58 (51%), Gaps = 8/58 (13%) Query: 66 NLSSSLEKRISLSQSLIKNPRIRITAFEAYLN-----HTETFHT-ILQVKKHNKSVNF 117 S+ ++++++++++L+ +P I + + + FH I Q+K ++V F Sbjct: 133 EFSTGMKQKVAIARALVHDPSILV--LDEPTSGLDIRTRRKFHDFIKQLKNEGRAVIF 188 >gnl|CDD|173895 cd00517, ATPS, ATP-sulfurylase. ATP-sulfurylase (ATPS), also known as sulfate adenylate transferase, catalyzes the transfer of an adenylyl group from ATP to sulfate, forming adenosine 5'-phosphosulfate (APS). This reaction is generally accompanied by a further reaction, catalyzed by APS kinase, in which APS is phosphorylated to yield 3'-phospho-APS (PAPS). In some organisms the APS kinase is a separate protein, while in others it is incorporated with ATP sulfurylase in a bifunctional enzyme that catalyzes both reactions. In bifunctional proteins, the domain that performs the kinase activity can be attached at the N-terminal end of the sulfurylase unit or at the C-terminal end, depending on the organism. While the reaction is ubiquitous among organisms, the physiological role of the reaction varies. In some organisms it is used to generate APS from sulfate and ATP, while in others it proceeds in the opposite direction to generate ATP from APS and pyrophosphate. ATP sulfurylase can be a monomer, a homodimer, or a homo-oligomer, depending on the organism. ATPS belongs to a large superfamily of nucleotidyltransferases that includes pantothenate synthetase (PanC), phosphopantetheine adenylyltransferase (PPAT), and the amino-acyl tRNA synthetases. The enzymes of this family are structurally similar and share a dinucleotide-binding domain. Length = 353 Score = 27.6 bits (62), Expect = 2.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 30 NPPHHGHIEIAQIAIKKLNLDQL 52 NP H H E+ + A +KL D L Sbjct: 166 NPMHRAHEELMKRAAEKLLNDGL 188 >gnl|CDD|145087 pfam01747, ATP-sulfurylase, ATP-sulfurylase. This family consists of ATP-sulfurylase or sulfate adenylyltransferase EC:2.7.7.4 some of which are part of a bifunctional polypeptide chain associated with adenosyl phosphosulphate (APS) kinase pfam01583. Both enzymes are required for PAPS (phosphoadenosine-phosphosulfate) synthesis from inorganic sulphate. ATP sulfurylase catalyses the synthesis of adenosine-phosphosulfate APS from ATP and inorganic sulphate. Length = 310 Score = 26.8 bits (60), Expect = 4.4 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 29 FNPPHHGHIEIAQIAIKK 46 NP H H + + A++K Sbjct: 125 RNPMHRAHEYLMKRALEK 142 >gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381 Score = 26.8 bits (59), Expect = 4.5 Identities = 13/51 (25%), Positives = 19/51 (37%), Gaps = 13/51 (25%) Query: 15 KVEPGMKIGLFGGN-------------FNPPHHGHIEIAQIAIKKLNLDQL 52 ++PG K+G+ G P G I I + I K+ L L Sbjct: 1162 TIKPGEKVGIVGRTGAGKSSLILALFRLVEPAEGEILIDGVDISKIGLHDL 1212 >gnl|CDD|173917 cd02166, NMNAT_Archaea, Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal. This family of archaeal proteins exhibits nicotinamide-nucleotide adenylyltransferase (NMNAT) activity utilizing the salvage pathway to synthesize NAD. In some cases, the enzyme was tested and found also to have the activity of nicotinate-nucleotide adenylyltransferase an enzyme of NAD de novo biosynthesis, although with a higher Km. In some archaeal species, a number of proteins which are uncharacterized with respect to activity, are also present. Length = 163 Score = 26.9 bits (60), Expect = 4.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 23 GLFGGNFNPPHHGHIEI 39 LF G F P H GH+++ Sbjct: 2 ALFIGRFQPFHLGHLKV 18 >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both expressed ubiquitously, associate with all three D cyclins (D1, D2 and D3), and phosphorylate the retinoblastoma (pRb) protein. They are also regulated by the INK4 family of inhibitors which associate with either the CDK alone or the CDK/cyclin complex. CDK4 and CDK6 show differences in subcellular localization, sensitivity to some inhibitors, timing in activation, tumor selectivity, and possibly substrate profiles. Although CDK4 and CDK6 seem to show some redundancy, they also have discrete, nonoverlapping functions. CDK6 plays an important role in cell differentiation. Length = 287 Score = 26.8 bits (60), Expect = 4.7 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Query: 77 LSQSLIKNPRIRITAFEAYLNH 98 L + L NP RI+AFEA L H Sbjct: 264 LKKMLTFNPHKRISAFEA-LQH 284 >gnl|CDD|107215 cd06459, M3B_Oligoendopeptidase_F, Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid. Length = 427 Score = 26.4 bits (59), Expect = 6.4 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 11/52 (21%) Query: 73 KRISLSQSLI-----KNPRIRITAFEA----YLNHTETFHTIL--QVKKHNK 113 + ++LSQ+L + +R AFEA Y + T IL VK Sbjct: 31 EELTLSQNLSNLLESPDREVRKKAFEALYKAYEKYENTLAAILNTLVKLRLT 82 >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and activated by a MAPK kinase (MAP2K or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAP3K or MKKK). Each cascade is activated either by a small GTP-binding protein or by an adaptor protein, which transmits the signal either directly to a MAP3K to start the triple kinase core cascade or indirectly through a mediator kinase, a MAP4K. There are three main typical MAPK subfamilies: Extracellular signal-Regulated Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38. Some MAPKs are atypical in that they are not regulated by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7. Length = 330 Score = 26.3 bits (59), Expect = 6.5 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Query: 77 LSQSLIKNPRIRITAFEAYLNH 98 L + L+ +P+ RITA EA L H Sbjct: 269 LEKMLVFDPKKRITADEA-LAH 289 >gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 26.2 bits (58), Expect = 6.6 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Query: 38 EIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRI 87 EI +I ++KL L + LS ++KR++L+++L +P + Sbjct: 112 EIREIVLEKLEAVGL----RGAEDLYPAELSGGMKKRVALARALALDPEL 157 >gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substrates ranges from inorganic ions, nutrients such as amino acids, sugars, or peptides, hydrophobic drugs, to large polypeptides, such as HlyA.. Length = 173 Score = 26.3 bits (58), Expect = 7.2 Identities = 14/65 (21%), Positives = 27/65 (41%), Gaps = 8/65 (12%) Query: 31 PPHHGHIEIAQIAIKKLNLDQLWWIITPF--------NSVKNYNLSSSLEKRISLSQSLI 82 P G + + I + + ++L + S+ LS +R+ L+++L Sbjct: 53 RPTSGRVRLDGADISQWDPNELGDHVGYLPQDDELFSGSIAENILSGGQRQRLGLARALY 112 Query: 83 KNPRI 87 NPRI Sbjct: 113 GNPRI 117 >gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 716 Score = 26.1 bits (57), Expect = 8.1 Identities = 9/23 (39%), Positives = 19/23 (82%) Query: 67 LSSSLEKRISLSQSLIKNPRIRI 89 LS ++RI+++++L++NPR+ I Sbjct: 605 LSGGQKQRIAIARALLRNPRVLI 627 >gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 173 Score = 25.8 bits (57), Expect = 9.2 Identities = 24/100 (24%), Positives = 40/100 (40%), Gaps = 28/100 (28%) Query: 15 KVEPGMKIGLFGGN-------------FNPPHHGHIEIAQIAIKKLNLD----------- 50 VE G GL G N P G I++ IKK + Sbjct: 22 TVEKGEIYGLLGPNGAGKTTLIKIILGLLKPDSGEIKVLGKDIKKEPEEVKRRIGYLPEE 81 Query: 51 -QLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRI 89 L+ +T +N LS +++R++L+Q+L+ +P + I Sbjct: 82 PSLYENLTVR---ENLKLSGGMKQRLALAQALLHDPELLI 118 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.135 0.419 Gapped Lambda K H 0.267 0.0692 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,720,812 Number of extensions: 137681 Number of successful extensions: 426 Number of sequences better than 10.0: 1 Number of HSP's gapped: 419 Number of HSP's successfully gapped: 37 Length of query: 216 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 126 Effective length of database: 4,318,927 Effective search space: 544184802 Effective search space used: 544184802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (25.0 bits)