RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780650|ref|YP_003065063.1| hypothetical protein CLIBASIA_02685 [Candidatus Liberibacter asiaticus str. psy62] (170 letters) >gnl|CDD|148751 pfam07323, DUF1465, Protein of unknown function (DUF1465). This family consists of several hypothetical bacterial proteins of around 180 residues in length. The function of this family is unknown. Length = 156 Score = 132 bits (334), Expect = 5e-32 Identities = 66/155 (42%), Positives = 89/155 (57%), Gaps = 5/155 (3%) Query: 14 RRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESVLLTTRLMQMV 73 R FS + LY+E + LVEET+ Y D EG +K L R S Y +ES+ LTTRLMQ+ Sbjct: 6 RFAFSRAFERLYREGMLLVEETAAYLDGEGRDAAKALSREASLAYAAESMRLTTRLMQVA 65 Query: 74 SWLFLQRALEDGNMTLEQVMSEKEKIKFD-YSGLDSTVPGWTELPCFFKNLVERSSQLQR 132 SWL LQRA+ +G M+ EQ EK +++ D S D GW ELP ++L+ RS +L Sbjct: 66 SWLLLQRAVREGEMSREQAAREKYRVRLDTPSPPDP--AGWAELPEALRDLIARSERLYA 123 Query: 133 RIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACF 167 R+ LD+E+Y D N V Q+ L+A F Sbjct: 124 RVARLDEELY-GDA-AAVAEDNPVSEQLARLKAAF 156 >gnl|CDD|178038 PLN02417, PLN02417, dihydrodipicolinate synthase. Length = 280 Score = 27.3 bits (61), Expect = 2.1 Identities = 9/34 (26%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 47 SKTLPRAISKL-YTSESVLLTTRLMQMVSWLFLQ 79 S +P + KL + ++ L +L+ ++ WLF + Sbjct: 202 SNLVPGLMHKLMFAGKNKELNDKLLPLMDWLFCE 235 >gnl|CDD|147864 pfam05942, PaREP1, Archaeal PaREP1/PaREP8 family. This family consists of several archaeal PaREP1 and PaREP8 proteins the function of this family is unknown. Length = 114 Score = 27.2 bits (61), Expect = 2.2 Identities = 14/75 (18%), Positives = 28/75 (37%), Gaps = 8/75 (10%) Query: 29 IALVEETSCYFDREGHLLSKTLPRAISKLYTS---ESVLLTTRLMQMVSWLFLQRALEDG 85 + + +G + L +A++KL E V L + + + + F D Sbjct: 42 EKNRLKLAEKARGKGRWSHRLLMKAVAKLLEEGGEEVVDLWSLALDLHVYQFY-----DP 96 Query: 86 NMTLEQVMSEKEKIK 100 + L V +E +K Sbjct: 97 ELDLSDVEDREEAVK 111 >gnl|CDD|165239 PHA02928, PHA02928, Hypothetical protein; Provisional. Length = 214 Score = 26.9 bits (59), Expect = 2.9 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 12 LNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTSESV 63 L +++ S R++ + K S L T YF++ GHL+ TLP ++ + S+ Sbjct: 126 LFKKIDSYRIRAINKYSKELGLATE-YFNKYGHLMFYTLPIPYNRFFCRNSI 176 >gnl|CDD|184098 PRK13507, PRK13507, formate--tetrahydrofolate ligase; Provisional. Length = 587 Score = 26.6 bits (59), Expect = 3.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 120 FKNLVERSSQLQRRIVLLDQEIYRAD 145 FK L L+ RI + +E+Y AD Sbjct: 463 FKFLYPLEMPLRERIETIAREVYGAD 488 >gnl|CDD|132565 TIGR03526, selenium_YgeY, putative selenium metabolism hydrolase. SelD, selenophosphate synthase, is the selenium donor protein for both selenocysteine and selenouridine biosynthesis systems, but it occurs also in a few prokaryotes that have neither of those pathways. The method of partial phylogenetic profiling, starting from such orphan-selD genomes, identifies this protein as one of those most strongly correlated to SelD occurrence. Its distribution is also well correlated with that of family TIGR03309, a putative accessory protein of labile selenium (non-selenocysteine) enzyme maturation. This family includes the uncharacterized YgeY of Escherichia coli, and belongs to a larger family of metalloenzymes in which some are known peptidases, others enzymes of different types. Length = 395 Score = 26.7 bits (59), Expect = 3.3 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Query: 31 LVEETSCYFD----REGHLLSKTLPRAISKLYTSESVL 64 LV T CYF E HL++K +L+ E + Sbjct: 299 LVYPTECYFPTWVLPEDHLITKAALETYKRLFGKEPGV 336 >gnl|CDD|173597 PTZ00407, PTZ00407, DNA topoisomerase IA; Provisional. Length = 805 Score = 26.4 bits (58), Expect = 3.3 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 11/64 (17%) Query: 40 DREGHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKI 99 DREG L++ + I +LY V + M ++ EDG + + M E+ Sbjct: 135 DREGELIAVHALQTIKRLYPKLKVPFSRAYMHSIT--------EDG---IRKAMRERHVE 183 Query: 100 KFDY 103 DY Sbjct: 184 ACDY 187 >gnl|CDD|181640 PRK09077, PRK09077, L-aspartate oxidase; Provisional. Length = 536 Score = 26.4 bits (59), Expect = 3.5 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 8/42 (19%) Query: 113 WTELPCFFKNLV------ERSSQLQRRIVLLDQEI--YRADF 146 W EL F + V +R + RI LL QEI Y A+F Sbjct: 439 WHELRLFMWDYVGIVRTTKRLERALHRIRLLQQEIDEYYANF 480 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.135 0.387 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,647,774 Number of extensions: 153916 Number of successful extensions: 272 Number of sequences better than 10.0: 1 Number of HSP's gapped: 270 Number of HSP's successfully gapped: 13 Length of query: 170 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 83 Effective length of database: 4,114,577 Effective search space: 341509891 Effective search space used: 341509891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.8 bits)