BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780650|ref|YP_003065063.1| hypothetical protein CLIBASIA_02685 [Candidatus Liberibacter asiaticus str. psy62] (170 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780650|ref|YP_003065063.1| hypothetical protein CLIBASIA_02685 [Candidatus Liberibacter asiaticus str. psy62] Length = 170 Score = 350 bits (898), Expect = 8e-99, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%) Query: 1 MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTS 60 MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTS Sbjct: 1 MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHLLSKTLPRAISKLYTS 60 Query: 61 ESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFF 120 ESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFF Sbjct: 61 ESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYSGLDSTVPGWTELPCFF 120 Query: 121 KNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF 170 KNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF Sbjct: 121 KNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEACFENF 170 >gi|254780569|ref|YP_003064982.1| phosphoribosylaminoimidazole synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 26.9 bits (58), Expect = 0.17, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 43 GHLLSKTLPRAISKLYTSESVLLTTRLMQMVSWL 76 G L++ +PRAI T+ L + + Q++SWL Sbjct: 256 GGGLTENIPRAIPAHLTASINLNSVEVPQIISWL 289 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 7/44 (15%) Query: 127 SSQLQRRIVLLDQEIYRADFDEISRGP---NHVQTQIKLLEACF 167 SS +++ IVL+ +EI RA ISR V+++I++LE + Sbjct: 197 SSAVRKEIVLMTEEIDRA----ISRASELEKTVRSEIEVLENNY 236 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 76 LFLQRALEDGNMTLEQVMSEKEKIKF 101 L + + L DG+ + +SE EKI+F Sbjct: 450 LHMDKKLGDGSTLRSRALSEVEKIRF 475 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.135 0.387 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,900 Number of Sequences: 1233 Number of extensions: 3410 Number of successful extensions: 11 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 5 length of query: 170 length of database: 328,796 effective HSP length: 68 effective length of query: 102 effective length of database: 244,952 effective search space: 24985104 effective search space used: 24985104 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)