HHsearch alignment for GI: 254780653 and conserved domain: KOG1367

>KOG1367 consensus.
Probab=100.00  E-value=0  Score=909.84  Aligned_cols=394  Identities=41%  Similarity=0.677  Sum_probs=379.9

Q ss_pred             CCCCCHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCE-EEEEECCCCCCCCCCCCCCHHHHHHH
Q ss_conf             88771010015996899982016713185777258999988989999988980-99991377888984733224788887
Q gi|254780653|r    3 RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFSHLGRPQSKSDKDCSLFKVVSI   81 (400)
Q Consensus         3 ~~~ti~d~~d~~gk~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~ak-vii~SH~GRPkg~~~~~~Sl~~v~~~   81 (400)
T Consensus         5 ~klti~~~-dl~GKrVf~RVDfNVPl~d~~Itnn~RI~aalPtIk~~l~~~~k~VvL~SHLGRP~G~~~~kySL~Pva~e   83 (416)
T KOG1367           5 SKLTIDNL-DLKGKRVFIRVDFNVPLKDNKITNNQRIVAALPTIKYLLSNGAKSVVLMSHLGRPKGVRNKKYSLAPVAPE   83 (416)
T ss_pred             CCCCCCCC-CCCCCEEEEEEECCCCCCCCEECCCCEEEECCCHHHHHHHCCCCEEEEHHHCCCCCCCCCCCCCCCCHHHH
T ss_conf             32451012-44686799998516634577112551222113178999857984898741058999988865243414999


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCHHHHCCCCCCCHH--------------HHHHHHCCCCCEEEECC
Q ss_conf             6431013354566631025566553136464898242430343210002--------------46653124364247544
Q gi|254780653|r   82 AESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP--------------DFVRMLSRNGDFYINDA  147 (400)
Q Consensus        82 l~~~l~~~V~fi~d~~g~~~~~~i~~l~~g~ilLLEN~Rf~~~E~~n~~--------------~f~k~La~laDiyVnDA  147 (400)
T Consensus        84 Lk~lLg~~v~flddCvg~eVe~a~~~p~~G~viLLENlRfy~eEEg~~~~~~~~~~a~~~~v~~fr~~l~~l~DvyVnDA  163 (416)
T KOG1367          84 LKSLLGKEVVFLDDCVGPEVEKAVASPAPGSVILLENLRFYVEEEGKGKDDSGKKVADPAKVKEFRASLASLGDVYVNDA  163 (416)
T ss_pred             HHHHHCCCEEEECCCCCHHHHHHHCCCCCCCEEEEECCEEEHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEECC
T ss_conf             99884765363012455789998538899838985032301244147865444523787889999999874115786400


Q ss_pred             HHHHCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHH
Q ss_conf             04401137633302332100033255657776533101667871899960780255788998773068888620578999
Q gi|254780653|r  148 FSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSF  227 (400)
Q Consensus       148 F~~aHR~haS~~gi~~~lps~aG~l~ekEi~~L~~~l~~~~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantf  227 (400)
T Consensus       164 FGtaHRahsSm~g~~~~~-~~aGfLl~KEL~yf~kalenp~rPFlaIlGGaKVadKIqlIenLldkv~~liigGGMaftF  242 (416)
T KOG1367         164 FGTAHRAHSSMVGVGLPQ-SAAGFLLQKELDYFAKALENPVRPFLAILGGAKVADKIQLIENLLDKVNELIIGGGMAFTF  242 (416)
T ss_pred             CCCCHHCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHCCCCCCHHHHHCCCHHHHHHHHHHHHHHHCCEEEECCCEEEHH
T ss_conf             020000123211468730-2245778878999999870877633544447416667999999986415288748500119


Q ss_pred             HHHH-CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCC-EECCCCCCCCCCCHHHHHH
Q ss_conf             9983-0143433331000013568899875302455430354113432323333102532-1201334576520035677
Q gi|254780653|r  228 LVAQ-GMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQ-SVPLDSIILDVGFKTVEYI  305 (400)
Q Consensus       228 L~A~-G~~IG~Sl~e~~~~~~ak~i~~~a~~~~~~I~lP~D~~v~~~~~~~~~~~~~~~~-~i~~~~~i~DIGp~Ti~~~  305 (400)
T Consensus       243 lKvl~~~eiG~Sl~de~g~e~v~~l~~kak~~~v~i~lPvDfv~adkf~~da~s~~~ta~~gIp~g~mgLD~GPes~k~f  322 (416)
T KOG1367         243 LKVLNGMEIGKSLFDEEGAEIVKDLMEKAKAKGVRILLPVDFVIADKFAEDANSKQVTAEEGIPDGWMGLDIGPESIKMF  322 (416)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCCCCCEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             99857762212332034679999999999875957982000465111067655223112358998744346586789999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHH
Q ss_conf             76405776799976625322743658899999999861114885899748046998998488768646875079989987
Q gi|254780653|r  306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWL  385 (400)
Q C