HHsearch alignment of GI: 254780653 and MMDB domain: 16pk_A_204-415

>16pk_A (A:204-415) PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei}
Probab=100.00  E-value=0  Score=516.88  Aligned_cols=212  Identities=40%  Similarity=0.683  Sum_probs=208.5

Q ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             78718999607802557889987730688886205789999983014343333100001356889987530245543035
Q gi|254780653|r  188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRD  267 (400)
Q Consensus       188 ~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantfL~A~G~~IG~Sl~e~~~~~~ak~i~~~a~~~~~~I~lP~D  267 (400)
                      .||+++||||||+||||++|++|++|||+|++||+||||||+|+|++||+|++|++.++.++++++++++++++|++|+|
T Consensus         1 pRP~vaIlGGaKvsdKi~~l~~ll~k~D~iligG~ma~~Fl~A~G~~iG~s~~e~~~~~~a~~i~~~a~~~~~kI~lPvD   80 (212)
T 16pk_A            1 PRPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPID   80 (212)
T ss_dssp             CSSEEEEECSSCSGGGHHHHHHHGGGCSEEEECTTHHHHHHHHHTCCCTTCCCCGGGHHHHHHHHHHHHHTTCEEECCSS
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             65517998525434379999988753543653222888999983982544312455443466774320025157752010


Q ss_pred             EECCCCCCCCCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             41134323233331025321201334576520035677764057767999766253227436588999999998611148
Q gi|254780653|r  268 VVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKER  347 (400)
Q Consensus       268 ~~v~~~~~~~~~~~~~~~~~i~~~~~i~DIGp~Ti~~~~~~I~~AktI~WNGP~GvfE~~~F~~GT~~l~~~ia~~~~~~  347 (400)
                      |+|+++++...+.++++.+++|++|+++||||+|++.|+++|.+|+|||||||||+||+++|+.||.+++++++++++++
T Consensus        81 ~~v~~~~~~~~~~~~~~~~~i~~~~~~~DIG~~Ti~~~~~~i~~aktI~wNGP~GvfE~~~F~~GT~~l~~aia~~t~~~  160 (212)
T 16pk_A           81 HVCHTEFKAVDSPLITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRGTHEH  160 (212)
T ss_dssp             EEEESSSSCCSSCEECSSSCCCTTCEEEEECHHHHHHHHHHHTTCSEEEEESCSSCTTSGGGCHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             33031123344430023222346436777777666677776651245889555021115616389999999999841448


Q ss_pred             CCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCHHHHHHCCC
Q ss_conf             8589974804699899848876864687507998998748998689884079
Q gi|254780653|r  348 RIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH  399 (400)
Q Consensus       348 ~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~~  399 (400)
                      +++||||||||++|++++|+.++|+||||||||+|+||+|++||||+||+++
T Consensus       161 ~a~sivGGGdt~aa~~~~g~~~~~shvSTgGGA~L~~L~Gk~LPgieaL~~~  212 (212)
T 16pk_A          161 GLMSIIGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLDDK  212 (212)
T ss_dssp             CCEEEECSHHHHHHHHHTTCTTTSSEECSCHHHHHHHHTTCCCHHHHTSCBC
T ss_pred             CCEEEECCHHHHHHHHHCCCCCCCEEEECCHHHHHHHHCCCCCCHHHHHHCC
T ss_conf             9989987789999999719745870797778999999879996257785069