HHsearch alignment of GI: 254780653 and MMDB domain: 1fw8_A_1-131_347-416

>1fw8_A (A:1-131,A:347-416) PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae}
Probab=99.94  E-value=1.8e-27  Score=197.21  Aligned_cols=68  Identities=38%  Similarity=0.652  Sum_probs=64.1

Q ss_pred             CCCCCCHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCE-EEEEECCCCCCCCCC
Q ss_conf             888771010015996899982016713185777258999988989999988980-999913778889847
Q gi|254780653|r    2 SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFSHLGRPQSKSD   70 (400)
Q Consensus         2 ~~~~ti~d~~d~~gk~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~ak-vii~SH~GRPkg~~~   70 (400)
                      |.++||+|+ |++||+||||||||||+++|+|+|++||++++|||++|+++||| |||+||||||||+.|
T Consensus       132 m~~~ti~d~-d~~gK~VlvRvD~NvPi~~g~I~Dd~RI~a~lpTI~~ll~~gak~vIL~SHlGRPkgk~d  200 (200)
T 1fw8_A          132 SSKLSVQDL-DLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLASHLGRPNGERN  200 (200)
T ss_dssp             SCSCBGGGS-CCTTCEEEEECCCCCCBSSSSBSCTHHHHHHHHHHHHHHHTCCSEEEEECCCSCCCSSCC
T ss_pred             HHCCCCCCC-CCCCCEEEEEEECCCCCCCCCCCCHHHHHHHCCHHHHHHHCCCCEEEEHHHCCCCCCCCC
T ss_conf             313010232-346847999985267666010430677875231579998559828986864389987889