HHsearch alignment of GI: 254780653 and MMDB domain: 1qpg_A_202-415

>1qpg_A (A:202-415) PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae}
Probab=100.00  E-value=0  Score=498.99  Aligned_cols=211  Identities=37%  Similarity=0.606  Sum_probs=201.8

Q ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHHHH-HHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             787189996078025578899877306888862057899999-8301434333310000135688998753024554303
Q gi|254780653|r  188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLV-AQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPR  266 (400)
Q Consensus       188 ~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantfL~-A~G~~IG~Sl~e~~~~~~ak~i~~~a~~~~~~I~lP~  266 (400)
                      .||+++|+||||+||||++|++|+++||+|++||+|||+||+ |+|++||+|++|++.++.++++++.+++++++|++|+
T Consensus         1 tRP~vaIlGGaKvsdKi~~l~~Ll~kvD~iligG~~a~~Fl~aa~G~~ig~s~~e~~~~~~~~~~~~~~~~~~~~I~lPv   80 (214)
T 1qpg_A            1 TRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAFTFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPV   80 (214)
T ss_dssp             CSSEEEEECSSCSGGGHHHHHHHTTTCSEEEECGGGHHHHHHHHSCCCCCSCCCCHHHHHHHHHHHHHHHHHTCEEECCS
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             99869998446353589999988752022551528999998742335578516665400028999999997499473024


Q ss_pred             EEECCCCCCCCCCCC-CCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             541134323233331-0253212013345765200356777640577679997662532274365889999999986111
Q gi|254780653|r  267 DVVVAREMKTGIPTQ-VVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTK  345 (400)
Q Consensus       267 D~~v~~~~~~~~~~~-~~~~~~i~~~~~i~DIGp~Ti~~~~~~I~~AktI~WNGP~GvfE~~~F~~GT~~l~~~ia~~~~  345 (400)
                      |++|+++++.+.+.+ +.+.+.+|++|+++||||+|++.|+++|++|+|||||||||+||+++|+.||.++++++++.++
T Consensus        81 D~~v~~~~~~~~~~~~v~~~~~ip~~~~~~DIG~~Ti~~~~~~i~~aktI~wNGP~GvfE~~~F~~GT~~i~~aia~~~~  160 (214)
T 1qpg_A           81 DFIIADAFSADANTKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSA  160 (214)
T ss_dssp             EEEEESSSSSSCCCCEEETTTCCCTTCEEEEECHHHHHHHHHHHTTCSEEEEESCSSCTTSGGGCHHHHHHHHHHHHHHH
T ss_pred             CEEEECCCCCCCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             67984454554673252563546876500345577899999999877988997675453565240689999999997116


Q ss_pred             CCCCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCHHHHHHCCC
Q ss_conf             488589974804699899848876864687507998998748998689884079
Q gi|254780653|r  346 ERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH  399 (400)
Q Consensus       346 ~~~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~~  399 (400)
                       .+++||+|||||++|++++|+.++|+||||||||+|+||+|++||||+||+++
T Consensus       161 -~~~~sivGGGdt~~Ai~~~g~~~~~shvSTGGGA~L~~L~Gk~LPgieaL~~~  213 (214)
T 1qpg_A          161 -AGNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLSEK  213 (214)
T ss_dssp             -HTCEEEECCHHHHHHHHHTTCGGGSSEECCCTHHHHHHHTSCCCHHHHTSCBC
T ss_pred             -CCCEEEEECHHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCCHHHHHHHC
T ss_conf             -89839995789999999749856882593678999999879997279887508