HHSEARCH alignment of GI: 254780653 and SCOP domain: d1qpga_

Alignment
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=100.00  E-value=0  Score=1004.83  Aligned_cols=396  Identities=36%  Similarity=0.605  Sum_probs=377.8

Q ss_pred             CCCCCCCHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCE-EEEEECCCCCCCCCCCCCCHHHHH
Q ss_conf             9888771010015996899982016713185777258999988989999988980-999913778889847332247888
Q gi|254780653|r    1 MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFSHLGRPQSKSDKDCSLFKVV   79 (400)
Q Consensus         1 M~~~~ti~d~~d~~gk~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~ak-vii~SH~GRPkg~~~~~~Sl~~v~   79 (400)
                      |..-.||+|+ |++||+||||||||||+++|+|+|++||++++|||++|+++||| |||+||||||+|+.++++||+||+
T Consensus         2 ~~~kltl~d~-dl~gK~VlvRvD~NvPi~~g~I~Dd~RI~~~lpTI~~L~~~~ak~vIL~SH~GRP~g~~~~~~Sl~~va   80 (415)
T d1qpga_           2 LSSKLSVQDL-DLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLASHLGQPNGERNEKYSLAPVA   80 (415)
T ss_dssp             TTSBCBGGGC-CCTTCEEEEECCCCCCBSSSSBSCCHHHHHHHHHHHHHHTTCCSEEEEECCCSCCCSSCCGGGCSHHHH
T ss_pred             CCCCCCHHHC-CCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCHHHHH
T ss_conf             8666850322-757998999932467643997896789999999999999879988999624899999879776869999


Q ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCHHHHCCCCC--------------CCHHHHHHHHCCCCCEEEE
Q ss_conf             87643101335456663102556655313646489824243034321--------------0002466531243642475
Q gi|254780653|r   80 SIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEE--------------RNDPDFVRMLSRNGDFYIN  145 (400)
Q Consensus        80 ~~l~~~l~~~V~fi~d~~g~~~~~~i~~l~~g~ilLLEN~Rf~~~E~--------------~n~~~f~k~La~laDiyVn  145 (400)
                      ++|+++|+++|.|++||+|+.+++++++|++|+|+||||+|||+||+              +|++.|+|+||++||+|||
T Consensus        81 ~~L~~~l~~~V~f~~d~~g~~~~~~i~~l~~g~I~LLENvRF~~eE~~~~~~~~~~~~~~~~n~~~fak~La~laDiyVN  160 (415)
T d1qpga_          81 KELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHIEEEGSRKVDGQKVKASKEDVQKFRHELSSLADVYIN  160 (415)
T ss_dssp             HHHHHHHTSCCEEESCSSSHHHHHHHHTCCTTEEEEECCGGGSHHHHTEEEETTEEEECCHHHHHHHHHHHHHTCSEEEE
T ss_pred             HHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             99985319846984577776311012334467579942111143310246543011100100269999987547848996


Q ss_pred             CCHHHHCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHH
Q ss_conf             44044011376333023321000332556577765331016678718999607802557889987730688886205789
Q gi|254780653|r  146 DAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMAN  225 (400)
Q Consensus       146 DAF~~aHR~haS~~gi~~~lps~aG~l~ekEi~~L~~~l~~~~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lan  225 (400)
                      ||||||||+|||++||+ ++|+|||+|||+|+++|++++++|+||+++||||||++|||++|++|++++|+|++||+|||
T Consensus       161 DAFg~aHR~haS~~g~~-~~~s~aG~lmekEl~~L~~~l~~p~rP~vaIlGGaKvsdKi~vl~~l~~k~D~iiigG~man  239 (415)
T d1qpga_         161 DAFGTAHRAHSSMVGFD-LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAF  239 (415)
T ss_dssp             CCGGGTTSCCHHHHCCC-CSCEEECHHHHHHHHHHHHHHSSCCSSEEEEECSSCSGGGHHHHHHHTTTCSEEEECGGGHH
T ss_pred             CCCCHHHCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEEECHHHH
T ss_conf             55011100565423455-78563328899999999999649999859999547644289999878753555775110357


Q ss_pred             HHHH-HHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCC-CCCCCCCEECCCCCCCCCCCHHHH
Q ss_conf             9999-83014343333100001356889987530245543035411343232333-310253212013345765200356
Q gi|254780653|r  226 SFLV-AQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP-TQVVSAQSVPLDSIILDVGFKTVE  303 (400)
Q Consensus       226 tfL~-A~G~~IG~Sl~e~~~~~~ak~i~~~a~~~~~~I~lP~D~~v~~~~~~~~~-~~~~~~~~i~~~~~i~DIGp~Ti~  303 (400)
                      |||+ ++|+++|+|++|+++.+.++++++.+++++++|++|+|++|+.++....+ +...+.+++|++|+++||||+|++
T Consensus       240 tflk~~~g~~ig~s~~e~~~~~~~~~i~~~a~~~~~~i~lP~D~~v~~~~~~~~~~~~~~~~~~i~~~~~i~DIG~~Ti~  319 (415)
T d1qpga_         240 TFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVTDKEGIPAGWQGLDNGPESRK  319 (415)
T ss_dssp             HHHHHHSCCCCCSCCCCHHHHHHHHHHHHHHHHHTCEEECCSEEEEESSSSSSCCCCEEETTTCCCTTCEEEEECHHHHH
T ss_pred             HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             78876037766653112221102368999987659867551227873024555553123001355876512346604678


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHH
Q ss_conf             77764057767999766253227436588999999998611148858997480469989984887686468750799899
Q gi|254780653|r  304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLE  383 (400)
Q Consensus       304 ~~~~~I~~AktI~WNGP~GvfE~~~F~~GT~~l~~~ia~~~~~~~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~  383 (400)
                      .|+++|++|+|||||||||+||+++|+.||.++++++++.++. +++||||||||++|++++|+.++|+||||||||+|+
T Consensus       320 ~~~~~I~~a~tI~wNGP~GvfE~~~F~~GT~~i~~~ia~~~~~-~~~sivGGGdT~aai~~~g~~~~~~hvSTGGGA~L~  398 (415)
T d1qpga_         320 LFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSAA-GNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLE  398 (415)
T ss_dssp             HHHHHHTTCSEEEEESCSSCTTSGGGCHHHHHHHHHHHHHHHH-TCEEEECCHHHHHHHHHTTCGGGSSEECCCTHHHHH
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEECHHHHHHHHHCCCCCCCCEEECCHHHHHH
T ss_conf             9998753686799977741524652406899999999972157-982999578999999975985688069677899999


Q ss_pred             HHCCCCCHHHHHHCCC
Q ss_conf             8748998689884079
Q gi|254780653|r  384 WLEGKDLPGIVALSGH  399 (400)
Q Consensus       384 ~L~G~~LPgi~aL~~~  399 (400)
                      ||+|++||||+||++.
T Consensus       399 ~L~G~~LPgi~aL~~~  414 (415)
T d1qpga_         399 LLEGKELPGVAFLSEK  414 (415)
T ss_dssp             HHTSCCCHHHHTSCBC
T ss_pred             HHCCCCCCHHHHHHHC
T ss_conf             9879997079888528


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate kinase
superfamily: Phosphoglycerate kinase
family: Phosphoglycerate kinase
domain: Phosphoglycerate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]