HHSEARCH alignment of GI: 254780653 and SCOP domain: d1vpea_

Alignment
>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]}
Probab=100.00  E-value=0  Score=1015.65  Aligned_cols=393  Identities=40%  Similarity=0.696  Sum_probs=382.2

Q ss_pred             CCCHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             77101001599689998201671318577725899998898999998898099991377888984733224788887643
Q gi|254780653|r    5 RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAES   84 (400)
Q Consensus         5 ~ti~d~~d~~gk~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~akvii~SH~GRPkg~~~~~~Sl~~v~~~l~~   84 (400)
                      .||+|+ |++||+||||+|||||+++|+|+|++||++++|||++|+++||||||+||||||+|++++++||+||+++|++
T Consensus         3 ltl~d~-~l~~k~Vl~R~D~NvPi~~g~i~d~~RI~~~~pTI~~l~~~~akvil~SH~GRP~g~~~~~~Sl~~~~~~L~~   81 (398)
T d1vpea_           3 MTIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPSPEFSLAPVAKRLSE   81 (398)
T ss_dssp             CBGGGS-CCTTCEEEEECCCCCCEETTEESCCHHHHHHHHHHHHHHHTTCEEEEECCCSCCCSSCCGGGCSHHHHHHHHH
T ss_pred             CCCCCC-CCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             762004-8479989999314775339958872899999999999997899899983789999988876687999999986


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCHHHHCCCCCCCHHHHHHHHCCCCCEEEECCHHHHCCCCCCEEECCCC
Q ss_conf             10133545666310255665531364648982424303432100024665312436424754404401137633302332
Q gi|254780653|r   85 ILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL  164 (400)
Q Consensus        85 ~l~~~V~fi~d~~g~~~~~~i~~l~~g~ilLLEN~Rf~~~E~~n~~~f~k~La~laDiyVnDAF~~aHR~haS~~gi~~~  164 (400)
                      +|+++|.|++||+++.+++.++++++|+|+||||+|||+||++|+++|+++||++||+|||||||||||+|||++|||++
T Consensus        82 ~l~~~v~f~~d~~~~~~~~~~~~l~~g~i~lLEN~Rf~~~E~~n~~~f~k~La~l~DiyVnDAFg~sHR~haS~~gi~~~  161 (398)
T d1vpea_          82 LLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQF  161 (398)
T ss_dssp             HHTSCCEEESCSSSHHHHHHHHTCCTTEEEEECCGGGSTHHHHTCHHHHHHHHTTCSEEEECCGGGTTSCCTTTTGGGGT
T ss_pred             HHCCEEEEEECCCCHHHHHHHHCCCCCCEEEEHHHHHCCCHHHHHHHHHHHHHHCCCEEEECCHHHHHCCCCCEECHHHH
T ss_conf             31640798503686588998615788768972444424323332477999986055603425435665158750113454


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             10003325565777653310166787189996078025578899877306888862057899999830143433331000
Q gi|254780653|r  165 LPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF  244 (400)
Q Consensus       165 lps~aG~l~ekEi~~L~~~l~~~~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantfL~A~G~~IG~Sl~e~~~  244 (400)
                      +|||+|++||+|+++|++++.+|+||+++||||||++|||++|++|++++|+|++||+||||||+|+|++||+|++|+++
T Consensus       162 lps~aG~l~ekEi~~L~k~l~~~~~P~~aIlGGaKisdKi~~i~~L~~k~D~iiigG~~antfL~a~G~~iG~sl~e~~~  241 (398)
T d1vpea_         162 IPSVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDK  241 (398)
T ss_dssp             SCEEECHHHHHHHHHHHHHHHCCCSSEEEEECSSCHHHHHHHHHHHTTTCSEEEECTTTHHHHHHHTSCCCTTSCCCGGG
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             61011477787898764221014675179961576350799999888750222324237899999749977887534125


Q ss_pred             CHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             01356889987530245543035411343232333310253-21201334576520035677764057767999766253
Q gi|254780653|r  245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA-QSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGV  323 (400)
Q Consensus       245 ~~~ak~i~~~a~~~~~~I~lP~D~~v~~~~~~~~~~~~~~~-~~i~~~~~i~DIGp~Ti~~~~~~I~~AktI~WNGP~Gv  323 (400)
                      ++.++++++.+++++++|++|+|++|+.+++...+...... +.+|++|+++||||+|++.|+++|++|+|||||||||+
T Consensus       242 ~~~~~~i~~~a~~~~~~i~lP~d~~v~~~~~~~~~~~~~~~~~~i~~~~~ilDIG~~Ti~~~~~~I~~aktI~WNGP~G~  321 (398)
T d1vpea_         242 IDLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMGV  321 (398)
T ss_dssp             HHHHHHHHHHHHHTTCEEECCSEEEEESSCSTTCCCEEEETTTCCCTTCEEEEECHHHHHHHHHHHTTCSEEEEESCSSC
T ss_pred             HHHHHHHHHHHHHCCCCCCCCHHEEECCCCCCCCCCEEECCCCCCCCCCEEECCCCCHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             67899999876652885110010121100035665202131247987653213665008999987455767999746120


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCHHHHHHCCC
Q ss_conf             2274365889999999986111488589974804699899848876864687507998998748998689884079
Q gi|254780653|r  324 FEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH  399 (400)
Q Consensus       324 fE~~~F~~GT~~l~~~ia~~~~~~~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~~  399 (400)
                      ||+++|+.||.+++++++++++ +++|||+|||||++|++++|+.++|+||||||||||+||+|++||||+||+..
T Consensus       322 fE~~~F~~GT~~l~~~ia~~t~-~~~~sIiGGGdT~aai~~~g~~~~f~hvSTGGGA~Le~L~G~~LPgi~aL~~~  396 (398)
T d1vpea_         322 FEIDDFAEGTKQVALAIAALTE-KGAITVVGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASMRIK  396 (398)
T ss_dssp             TTSGGGCHHHHHHHHHHHHHHH-TTCEEEEESHHHHHHHHHTTCGGGSSEEESCHHHHHHHHTSSCCHHHHTSCBC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHC-CCCEEEEECHHHHHHHHHCCCCCCCEEEECCHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             1166241799999999998723-89989991789999999729867960896778999999879997189998635


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate kinase
superfamily: Phosphoglycerate kinase
family: Phosphoglycerate kinase
domain: Phosphoglycerate kinase
species: Thermotoga maritima [TaxId: 2336]