BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780653|ref|YP_003065066.1| phosphoglycerate kinase
[Candidatus Liberibacter asiaticus str. psy62]
         (400 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780653|ref|YP_003065066.1| phosphoglycerate kinase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040330|gb|ACT57126.1| phosphoglycerate kinase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 400

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/400 (100%), Positives = 400/400 (100%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS
Sbjct: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR
Sbjct: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML
Sbjct: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC
Sbjct: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK
Sbjct: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT
Sbjct: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400
           ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
Sbjct: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400


>gi|315122161|ref|YP_004062650.1| phosphoglycerate kinase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495563|gb|ADR52162.1| phosphoglycerate kinase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 421

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/397 (80%), Positives = 356/397 (89%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS LRTM+DL DIRG RCLLRVDWNVPFI+GK+ADVTRIER VPTILELV KKAK+VI S
Sbjct: 1   MSYLRTMDDLNDIRGRRCLLRVDWNVPFIEGKIADVTRIERSVPTILELVRKKAKIVILS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP +KSDKD SL +V+ IAESIL K ILFV DCIG +LSQS++SLSEGGIIL ENVR
Sbjct: 61  HLGRPNNKSDKDSSLCQVIPIAESILKKKILFVEDCIGFSLSQSVSSLSEGGIILTENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE NDPDFV ML+ NGDFYINDAFSVSHR HASI GLS LLPSY+GRAMQKELSML
Sbjct: 121 FYPGEENNDPDFVNMLAENGDFYINDAFSVSHRVHASIEGLSRLLPSYMGRAMQKELSML 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E CFS SKKPLVAI+GGSKVSTKI LL NLVKKVDKLVIGGGMANSFLVA GMGVGRSLC
Sbjct: 181 EVCFSVSKKPLVAIIGGSKVSTKIDLLGNLVKKVDKLVIGGGMANSFLVADGMGVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           QRDFS++V QI +EA++S+CEII+P+DVVVA+EMK GI TQ VS +SVP DS+ILD+GFK
Sbjct: 241 QRDFSESVRQIVFEAQKSSCEIILPQDVVVAKEMKKGIATQSVSTRSVPSDSMILDIGFK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+EYIKQVI+QA+TV+WNGPLGVFEIEPFD ATVE+A YVAKLTKE++IISIAGGGDTIT
Sbjct: 301 TIEYIKQVISQAKTVIWNGPLGVFEIEPFDLATVEIARYVAKLTKEKKIISIAGGGDTIT 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL+HAGI +EFTY STAGGAF EWLEGKDLPG+ ALS
Sbjct: 361 ALSHAGIVDEFTYASTAGGAFFEWLEGKDLPGLAALS 397


>gi|110635765|ref|YP_675973.1| phosphoglycerate kinase [Mesorhizobium sp. BNC1]
 gi|122965543|sp|Q11CR7|PGK_MESSB RecName: Full=Phosphoglycerate kinase
 gi|110286749|gb|ABG64808.1| phosphoglycerate kinase [Chelativorans sp. BNC1]
          Length = 398

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/396 (54%), Positives = 291/396 (73%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL+D+ G R LLRVD NVP  DG+V D TRIERV PTI EL +K AKV++ +
Sbjct: 1   MAGFKTLDDLKDVAGKRVLLRVDLNVPVKDGEVTDTTRIERVAPTITELSDKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D + SL  +    E++L + + F + CIG    +++  ++ G I+L EN R
Sbjct: 61  HFGRPKGKPDAEASLQPIAHAVEAVLDRRVHFASSCIGEPAKKAVDEMTGGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP+F + L+ NGD Y+NDAFS +HRAHAS  GL+HLLP+Y GR +Q EL  L
Sbjct: 121 FHAGEEKNDPEFTKALAANGDIYVNDAFSAAHRAHASTEGLAHLLPAYAGRTIQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +    + K+P+VAIVGG+KVSTKI LL NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 QRGLGDPKRPVVAIVGGAKVSTKIDLLTNLVKKVDCLVIGGGMANTFLAARGTSVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   QI  +A  + C II+P D VVAR+ + G  T+ V   +VP D++ILDVG K
Sbjct: 241 EHDLRETAKQIMIDAAEAGCAIILPVDAVVARKFEAGAETETVDIDAVPEDAMILDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +K+ + +A T++WNGPLG FE+ PFD+AT+EVA Y A+ T+E  ++S+AGGGDT+ 
Sbjct: 301 SVEKVKEWLDRADTLVWNGPLGAFELSPFDKATMEVAKYAARRTRESLLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  A +S++F+YVSTAGGAFLEW+EGKDLPG+ AL
Sbjct: 361 ALNQADVSDDFSYVSTAGGAFLEWMEGKDLPGVAAL 396


>gi|209550817|ref|YP_002282734.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|259530815|sp|B5ZPA0|PGK_RHILW RecName: Full=Phosphoglycerate kinase
 gi|209536573|gb|ACI56508.1| Phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 400

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/397 (54%), Positives = 285/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DIRG R L+RVD NVP  DGKV D TRIERV PTILEL EK AKV++ +
Sbjct: 1   MPSFKTLDDLSDIRGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSEKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  +    E +L   +   +DCIG   + ++A++++G I+L EN R
Sbjct: 61  HFGRPKDGPSPELSLSLIAPSVEEVLDHAVSTASDCIGEAAASAVAAMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDPDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 181 EKGLGDPARPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C II+P D V+ARE K G   + V   ++P D+++LDVG K
Sbjct: 241 EHDLAETARQIMIEAATSGCAIILPEDGVIAREFKAGAANETVDIDAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+ I   I +A T++WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++
Sbjct: 301 SVQAISAWIERASTLVWNGPLGAFEIEPFDAATVGAAKYAAERTTAGKLTSVAGGGDTVS 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 397


>gi|332716470|ref|YP_004443936.1| phosphoglycerate kinase [Agrobacterium sp. H13-3]
 gi|325063155|gb|ADY66845.1| phosphoglycerate kinase [Agrobacterium sp. H13-3]
          Length = 400

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 219/397 (55%), Positives = 289/397 (72%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL EK AKV++ +
Sbjct: 1   MPAFKTIDDLNDIAGKRVLVRVDLNVPVADGKVTDSTRIERVAPTILELSEKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   D SL ++V   E +L   + F +DCIG+  + ++A +++G I+L EN R
Sbjct: 61  HFGRPKGEPVADMSLSQIVPAVEEVLDHAVFFASDCIGAPAADAVAKMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+ND  FV  L+ NGD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDTAFVEALAANGDIYVNDAFSAAHRAHASTEGLARHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVS+KI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGQPVRPVVAIVGGAKVSSKIDLLMNLVKKVDALVIGGGMANTFLAARGAQVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C I++P D VVARE K G   ++V   ++P D+++LDVG K
Sbjct: 241 EHDLAETAKQIMIEAATSGCAIVLPEDGVVAREFKAGAANEIVDINAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE IK  I++A T++WNGPLG FEIEPFD ATV  A + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SVESIKAWISRAETLVWNGPLGAFEIEPFDVATVAAAKHAAECTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+S++FTY+STAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVSDDFTYISTAGGAFLEWMEGKELPGVAILT 397


>gi|222087013|ref|YP_002545547.1| phosphoglycerate kinase protein [Agrobacterium radiobacter K84]
 gi|221724461|gb|ACM27617.1| phosphoglycerate kinase protein [Agrobacterium radiobacter K84]
          Length = 415

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/396 (55%), Positives = 288/396 (72%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL  K AKV++ +
Sbjct: 16  MAAFKTLDDLTDITGKRVLVRVDLNVPVKDGKVTDATRIERVAPTILELSGKGAKVILLA 75

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  ++   E +L   +LF +DC+G+  ++++A +  G I+L EN R
Sbjct: 76  HFGRPKDGPSPDLSLSLIIPAVEEVLDHAVLFASDCVGAPAAEAVAKMGNGDILLLENTR 135

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+ND  F + L+ NGD Y+NDAFS +HRAHAS  GL+HLLP+Y GR MQ EL+ L
Sbjct: 136 FHKEEEKNDAAFTKALAANGDIYVNDAFSAAHRAHASTEGLAHLLPAYAGRTMQGELTAL 195

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVS+KI LL NLV KVD LVIGGGMAN+FL A G+ VG+SLC
Sbjct: 196 EKGLGNPVRPVVAIVGGAKVSSKIDLLKNLVHKVDALVIGGGMANTFLAANGIDVGKSLC 255

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EAK S C+I++P D VVARE K G   +VV+  ++P D+++LDVG K
Sbjct: 256 EHDLAETAKQIIAEAKASNCQIVLPTDGVVAREFKAGAANEVVAIDAIPADAMVLDVGPK 315

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +K++I  + T++WNGPLG FEI PFD ATV  A Y A+ TK  ++ S+AGGGDT++
Sbjct: 316 SVEAVKKIIEGSTTLVWNGPLGAFEITPFDAATVAAAQYAAERTKAGKLTSVAGGGDTVS 375

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++++FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 376 ALNHAGVADDFTYVSTAGGAFLEWMEGKVLPGVAVL 411


>gi|159185882|ref|NP_356882.2| phosphoglycerate kinase [Agrobacterium tumefaciens str. C58]
 gi|24418593|sp|Q8U9I9|PGK_AGRT5 RecName: Full=Phosphoglycerate kinase
 gi|159141016|gb|AAK89667.2| phosphoglycerate kinase [Agrobacterium tumefaciens str. C58]
          Length = 400

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/397 (54%), Positives = 287/397 (72%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL  K AKV++ +
Sbjct: 1   MPAFKTIDDLNDIAGKRVLVRVDLNVPVADGKVTDATRIERVAPTILELSSKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL ++V   E +L   I F  DCIG+  + ++A +++G I+L EN R
Sbjct: 61  HFGRPKGEPVAEMSLSQIVPTVEDVLDHAISFATDCIGAPAADAVAKMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP FV  L+ NGD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDPAFVEELAANGDIYVNDAFSAAHRAHASTEGLARHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVS+KI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGQPVRPVVAIVGGAKVSSKIDLLMNLVKKVDALVIGGGMANTFLAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C I++P D VVARE   G   ++V   ++P D+++LDVG K
Sbjct: 241 EHDLAETAKQIMIEAATSGCAIVLPEDGVVAREFTAGAANEIVDINAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE IK  I++A T++WNGPLG FEIEPFD ATV  A + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SVESIKAWISRAETLVWNGPLGAFEIEPFDAATVAAAKHAAECTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+S++FTY+STAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVSDDFTYISTAGGAFLEWMEGKELPGVAILT 397


>gi|222149683|ref|YP_002550640.1| phosphoglycerate kinase [Agrobacterium vitis S4]
 gi|259530688|sp|B9JS00|PGK_AGRVS RecName: Full=Phosphoglycerate kinase
 gi|221736665|gb|ACM37628.1| phosphoglycerate kinase [Agrobacterium vitis S4]
          Length = 400

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/397 (53%), Positives = 284/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R LLRVD NVP   GKV D TRIERV PTI EL  K AKV++ +
Sbjct: 1   MPAFKTLDDLTDIAGKRVLLRVDLNVPVSGGKVTDATRIERVAPTIKELSAKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   D SL +++S  E +L + + F  DC+G    +++A+L+ G I+L EN R
Sbjct: 61  HFGRPKGEPVADMSLSQIISAVEEVLDQAVAFGEDCVGEPAERAVAALNNGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+ND DF   L++NGD Y+NDAFS +HRAHAS  GL+H+LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDADFTAELAKNGDIYVNDAFSAAHRAHASTEGLAHILPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +   P+VAIVGG+KVS+KI LL+NLVKKVD LVIGGGMAN+F+ AQG+ VG+SLC
Sbjct: 181 EKGLGKPTHPVVAIVGGAKVSSKIDLLMNLVKKVDALVIGGGMANTFIAAQGIDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    QI  EA+ + C I++P D VVARE K     + VS  ++P D+++LDVG K
Sbjct: 241 EHDLAATAKQIMIEAETAGCTIVLPVDGVVAREFKANAANETVSVSAIPADAMMLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V  +   I +A T++WNGPLG FEI PFD ATV  A + A+ +K  +++S+AGGGDT++
Sbjct: 301 SVAVVNDWITKAATLVWNGPLGAFEIPPFDTATVSAAKHAAERSKAGKLVSVAGGGDTVS 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+ ++F+YVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVVDDFSYVSTAGGAFLEWMEGKELPGVAVLT 397


>gi|86359090|ref|YP_470982.1| phosphoglycerate kinase [Rhizobium etli CFN 42]
 gi|86283192|gb|ABC92255.1| phosphoglycerate kinase protein [Rhizobium etli CFN 42]
          Length = 418

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/397 (54%), Positives = 282/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL +K AKV++ +
Sbjct: 19  MPSFKTLDDLSDISGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSDKGAKVILLA 78

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  +    E +L   +L  +DCIG   + ++A ++ G I+L EN R
Sbjct: 79  HFGRPKDGPSPDLSLSLIAPSVEEVLDHAVLTASDCIGEAATAAVAGMNNGDILLLENTR 138

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 139 FHKGEEKNDPDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 198

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 199 EKGLGAPARPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 258

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C II+P D VVARE + G   + V   ++P D+++LDVG K
Sbjct: 259 EHDLAETAKQIMIEAATSGCAIILPEDGVVAREFRAGAANETVDINAIPADAMVLDVGPK 318

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE I   I +A T++WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++
Sbjct: 319 SVEAINAWIERAATLVWNGPLGAFEIEPFDTATVAAAKYAAERTAAGKLTSVAGGGDTVS 378

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 379 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 415


>gi|241206227|ref|YP_002977323.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860117|gb|ACS57784.1| Phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 400

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 218/397 (54%), Positives = 284/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DIRG R L+RVD NVP  DGKV DVTRIERV PTILEL EK AKV++ +
Sbjct: 1   MPSFKTLDDLSDIRGKRVLVRVDLNVPVKDGKVTDVTRIERVAPTILELSEKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  +    E +L   +L  +DCIG   + ++A++++G I+L EN R
Sbjct: 61  HFGRPKDGPSPDLSLSLIAPSVEEVLDHAVLTASDCIGEAAASAVAAMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE ND +F + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 121 FHKGEENNDSNFTKTLAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    E  +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 181 EKGLGEPARPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  + C II+P D V+ARE K G   + V   ++P D+++LDVG K
Sbjct: 241 EHDLAETAKQIMIEAATAGCAIILPEDGVIAREFKAGAANETVDINAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++E I   I +A T++WNGPLG FEIEPFD ATV  A Y A  T   ++ S+AGGGDT++
Sbjct: 301 SIEAINAWIERAATLVWNGPLGAFEIEPFDAATVAAAKYAAGRTVAGKLTSVAGGGDTVS 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 397


>gi|116253750|ref|YP_769588.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. viciae 3841]
 gi|259530810|sp|Q1MC31|PGK_RHIL3 RecName: Full=Phosphoglycerate kinase
 gi|115258398|emb|CAK09501.1| putative phosphoglycerate kinase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 401

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 218/397 (54%), Positives = 283/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DIRG R L+RVD NVP  DGKV DVTRIERV PTILEL EK AKV++ +
Sbjct: 1   MPSFKTLDDLSDIRGKRVLVRVDLNVPVKDGKVTDVTRIERVAPTILELSEKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  +    E +L   +L  +DCIG   + ++A++++G I+L EN R
Sbjct: 61  HFGRPKDGPSSDLSLSLIAPSVEEVLDHAVLTASDCIGEAAASAVAAMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE ND DF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 121 FHKGEENNDSDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 181 EKGLGDPARPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  + C II+P D V+ARE K G   + V   ++P D+++LDVG K
Sbjct: 241 EHDLAETAKQIMIEAATAGCAIILPEDGVIAREFKAGAANETVDINAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE I   I +A T++WNGPLG FEI PFD ATV  A Y A  T   ++ S+AGGGDT++
Sbjct: 301 SVEAINAWIERAATLVWNGPLGAFEIGPFDAATVAAAKYAAGRTIAGKLTSVAGGGDTVS 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 397


>gi|15966518|ref|NP_386871.1| phosphoglycerate kinase [Sinorhizobium meliloti 1021]
 gi|307300444|ref|ZP_07580224.1| Phosphoglycerate kinase [Sinorhizobium meliloti BL225C]
 gi|307318309|ref|ZP_07597744.1| Phosphoglycerate kinase [Sinorhizobium meliloti AK83]
 gi|21263811|sp|Q92M79|PGK_RHIME RecName: Full=Phosphoglycerate kinase
 gi|15075789|emb|CAC47344.1| Probable phosphoglycerate kinase [Sinorhizobium meliloti 1021]
 gi|306895991|gb|EFN26742.1| Phosphoglycerate kinase [Sinorhizobium meliloti AK83]
 gi|306904610|gb|EFN35194.1| Phosphoglycerate kinase [Sinorhizobium meliloti BL225C]
          Length = 399

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/390 (55%), Positives = 280/390 (71%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL DI G R L+RVD NVP  DG+V D TRIERV PTI EL EK AKVV+ +H G
Sbjct: 3   FKTLDDLTDIAGKRVLVRVDLNVPVKDGQVTDTTRIERVAPTIRELSEKGAKVVLLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   D SL  + S  E IL + + F  DCIG   + +IA L++G ++L EN RF+ 
Sbjct: 63  RPKGEPVADMSLKAIASAVEEILDQRVYFAADCIGDKAANAIAELNDGEVLLLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND DFV  L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  LE  
Sbjct: 123 GEEKNDSDFVTALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEALEKG 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P+VAIVGG+KVSTKI LL NLVKKVD LVIGGGMAN+FL AQG+ VG+SLC+ D
Sbjct: 183 LGNPKRPVVAIVGGAKVSTKIDLLQNLVKKVDALVIGGGMANTFLAAQGVDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++    I   A  + C I++P D VVARE K G   +VV  +++P D+++LDVG K++E
Sbjct: 243 LAETAKAILAAASEAGCAIVLPVDGVVAREFKAGADNEVVDIKAIPADAMVLDVGPKSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I + I++A T++WNGPLG FEI PFDRATV  A + A  T+   ++S+AGGGDT+ AL 
Sbjct: 303 AINEWISRAETLVWNGPLGAFEIAPFDRATVAAAKHAAARTRAGSLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HA ++++FTYVSTAGGAFLEW+EGK LPG+
Sbjct: 363 HAEVADDFTYVSTAGGAFLEWMEGKPLPGV 392


>gi|190893316|ref|YP_001979858.1| phosphoglycerate kinase [Rhizobium etli CIAT 652]
 gi|190698595|gb|ACE92680.1| phosphoglycerate kinase protein [Rhizobium etli CIAT 652]
          Length = 418

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/397 (54%), Positives = 282/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL E  AKV++ +
Sbjct: 19  MPAFKTLDDLTDISGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSENGAKVILLA 78

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  +    E +L   +   +DC G   + ++A++++G I+L EN R
Sbjct: 79  HFGRPKDGPSPDLSLSLIAPSVEEVLDHAVATASDCTGEAAAAAVAAMNDGDILLLENTR 138

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 139 FHKGEEKNDPDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 198

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 199 EKGLGAPVRPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 258

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  + C II+P D VVARE K G  ++ V   ++P D+++LD+G K
Sbjct: 259 EHDLAETAKQIMIEAATAGCAIILPEDGVVAREFKAGAASETVDINAIPADAMVLDLGPK 318

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE I   I +A T++WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++
Sbjct: 319 SVEAINAWIERAATLVWNGPLGAFEIEPFDTATVAAAKYAAERTAAGKLTSVAGGGDTVS 378

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 379 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 415


>gi|220927024|ref|YP_002502326.1| phosphoglycerate kinase [Methylobacterium nodulans ORS 2060]
 gi|219951631|gb|ACL62023.1| phosphoglycerate kinase [Methylobacterium nodulans ORS 2060]
          Length = 398

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/396 (52%), Positives = 273/396 (68%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+R RT++D  D++G R L+RVD NVP  +G+V D TRI RV+PTI E+ E   +VV+ +
Sbjct: 1   MTRFRTLDDAGDLKGKRVLVRVDLNVPMENGRVTDATRITRVLPTIREIAEAGGRVVLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  +       L + + F  DCIG   ++++A+L +GG+ + EN R
Sbjct: 61  HFGRPKGKPDPKESLRPIAEAVAKDLGRPVAFAEDCIGPKAAEAVAALGDGGVAMLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP FV+ L+ NGD Y+N+AFS SHRAHAS  GL+H+LP+Y GR MQ E+  L
Sbjct: 121 FHAGEEKNDPAFVQALAANGDVYVNEAFSASHRAHASTEGLAHVLPAYAGRLMQAEIEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P+VAIVGGSKVSTKI LL+NLV KVD LVIGGGMAN+FL A G+GVGRSLC
Sbjct: 181 TKGLEAPARPVVAIVGGSKVSTKIDLLVNLVGKVDALVIGGGMANTFLHATGLGVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +RD +    +I   A+   C II+P D VVA E K   P       ++P   +ILDVG +
Sbjct: 241 ERDLAGTALRIIEAAREKNCAIILPVDAVVAEEFKANAPHHTYGIDAIPESGMILDVGAQ 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +   +  A+T++WNGPLG FE  PFD+ TV  A + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SVERVAAALNDAKTLVWNGPLGAFEFPPFDQGTVAAARHAAERTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++  FTYVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 361 ALNHAGVAEAFTYVSTAGGAFLEWLEGKPLPGVDAL 396


>gi|319781128|ref|YP_004140604.1| phosphoglycerate kinase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167016|gb|ADV10554.1| Phosphoglycerate kinase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 398

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/393 (53%), Positives = 278/393 (70%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++D+ +I G R L+RVD NVP  +GKV D TRIER+ PTI EL  K AKV++ +
Sbjct: 1   MAAFKTLDDIGNISGKRVLVRVDLNVPVTEGKVTDATRIERIAPTIAELSAKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  +      +L + + F +DC+G T   ++A++++G ++L EN R
Sbjct: 61  HFGRPKDGPSPEFSLEPIAKATAEVLGRPVGFASDCVGDTAGSAVAAMNKGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE+NDP F   L+ NGD ++NDAFS +HRAH+S  GL+HLLP++ GR MQ EL  L
Sbjct: 121 FYKAEEKNDPAFTEKLAANGDIFVNDAFSAAHRAHSSTEGLAHLLPAFAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGKPVRPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFLAARGTDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    QI  EA  + C II+P D VVARE K G   + V+   VP D +ILDVG K
Sbjct: 241 EHDLASTAKQIMIEAAEAGCAIILPVDGVVAREFKAGAACETVAISDVPADGMILDVGAK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  I + I +A T++WNGPLG FEI PFD ATV  A + A  TKE +++S+AGGGDT+ 
Sbjct: 301 TVTTIGEWIDRAATLVWNGPLGAFEIAPFDHATVAAAKHAASRTKEGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           AL HAG++++FTYVSTAGGAFLEW+EGK LPG+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKPLPGV 393


>gi|170744059|ref|YP_001772714.1| phosphoglycerate kinase [Methylobacterium sp. 4-46]
 gi|168198333|gb|ACA20280.1| Phosphoglycerate kinase [Methylobacterium sp. 4-46]
          Length = 398

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+R RT++D  D++G R L+RVD NVP  +G+V+D TRI RV+PTI E+ E   +VV+ +
Sbjct: 1   MTRFRTLDDAGDLKGKRVLVRVDLNVPMENGRVSDATRITRVLPTIREIAEAGGRVVLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  +     + L + + F  DC+G   + ++A+L +G +++ EN R
Sbjct: 61  HFGRPKGKPDPKESLRPIAEAVAADLGRPVAFAEDCVGEAAAAAVAALGDGDVVMLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF R L+RNGD Y+N+AFS SHRAHAS  GL+H+LP+Y GR MQ E+  L
Sbjct: 121 FHPGEEKNDPDFARALARNGDVYVNEAFSASHRAHASTEGLAHVLPAYAGRLMQAEIEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P+VAIVGGSKVSTKI LL+NLV KVD LVIGGGMAN+FL A G+GVG+SLC
Sbjct: 181 TKGLEAPARPVVAIVGGSKVSTKIDLLVNLVGKVDALVIGGGMANTFLHAAGLGVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +    +I   A+   C II+P D VVA E K   P       ++P   +ILDVG +
Sbjct: 241 EKDLAGTALRIIEAAREKNCAIILPVDAVVAEEFKANAPHHTYGVDAIPQAGMILDVGSQ 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +   +  ART++WNGPLG FE  PFD+ TV  A + A+ T+  R++S+AGGGDT+ 
Sbjct: 301 SVERVAAALNDARTLVWNGPLGAFEFPPFDQGTVAAARHAAERTRAGRLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++  FTYVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 361 ALNHAGVAEAFTYVSTAGGAFLEWLEGKPLPGVDAL 396


>gi|150397851|ref|YP_001328318.1| phosphoglycerate kinase [Sinorhizobium medicae WSM419]
 gi|166987814|sp|A6UCV3|PGK_SINMW RecName: Full=Phosphoglycerate kinase
 gi|150029366|gb|ABR61483.1| Phosphoglycerate kinase [Sinorhizobium medicae WSM419]
          Length = 399

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/390 (54%), Positives = 279/390 (71%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL DI G R L+RVD NVP  DG+V D TRIERV PTI EL EK AKVV+ +H G
Sbjct: 3   FKTLDDLTDIAGKRVLVRVDLNVPVKDGQVTDTTRIERVAPTIRELSEKGAKVVLLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   D SL  + S  E IL + + F  DCIG   + +IA L++G ++L EN RF+ 
Sbjct: 63  RPKGEPVADMSLKTIASAVEEILDQRVYFAPDCIGDKAANAIADLNDGEVLLLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP FV  L+ NGD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  LE  
Sbjct: 123 GEEKNDPAFVTALAANGDIYVNDAFSAAHRAHASTEGLAQHLPAYAGRTMQAELEALEKG 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VAIVGG+KVSTKI LL NLVKKVD LVIGGGMAN+FL AQG+ VG+SLC+ D
Sbjct: 183 LGNPQRPVVAIVGGAKVSTKIDLLQNLVKKVDALVIGGGMANTFLAAQGVDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++    I   A  + C I++P D VVARE K G   +VV  +++P D+++LDVG K+++
Sbjct: 243 LAETAKAILAAASEAGCAIVLPVDGVVAREFKAGADNEVVDVKAIPADAMMLDVGPKSID 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I + I++A T++WNGPLG FEI PFD+ATV  A + A  T+   ++S+AGGGDT+ AL 
Sbjct: 303 AINEWISRAETLVWNGPLGAFEITPFDKATVAAAKHAAARTRSGSLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HA ++++FTYVSTAGGAFLEW+EGK LPG+
Sbjct: 363 HAEVADDFTYVSTAGGAFLEWMEGKPLPGV 392


>gi|218463497|ref|ZP_03503588.1| phosphoglycerate kinase [Rhizobium etli Kim 5]
          Length = 385

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 275/381 (72%)

Query: 17  RCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLF 76
           R LLRVD NVP  DGKV D TRIERV PTILEL +K AKV++ +H GRP+     + SL 
Sbjct: 2   RVLLRVDLNVPVKDGKVTDTTRIERVAPTILELSDKGAKVILLAHFGRPKDGPSPELSLS 61

Query: 77  KVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRML 136
            +    E +L   +L  +DCIG   + ++A++++G I+L EN RF+  EE+N+PDF + L
Sbjct: 62  LIAPSVEEVLDHAVLTASDCIGEAAASAVAAMNDGDILLMENTRFHKGEEKNEPDFTKAL 121

Query: 137 SRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVG 196
           + NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  LE       +P+VAIVG
Sbjct: 122 AANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEALEKGLGAPARPVVAIVG 181

Query: 197 GSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAK 256
           G+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC+ D ++   QI  EA 
Sbjct: 182 GAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLCEHDLAETAKQIMIEAA 241

Query: 257 RSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVM 316
            S C II+P D VVARE K G   ++V   ++P D+++LDVG K+VE I   I +A T++
Sbjct: 242 TSGCAIILPEDGVVAREFKAGAANEIVDIDAIPADAMVLDVGPKSVEAINAWIERAATLV 301

Query: 317 WNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVST 376
           WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++AL HAG++++FTYVST
Sbjct: 302 WNGPLGAFEIEPFDTATVAAAKYAAERTAAGKLTSVAGGGDTVSALNHAGVADDFTYVST 361

Query: 377 AGGAFLEWLEGKDLPGIVALS 397
           AGGAFLEW+EGK+LPG+  L+
Sbjct: 362 AGGAFLEWMEGKELPGVAVLN 382


>gi|163758825|ref|ZP_02165912.1| phosphoglycerate kinase [Hoeflea phototrophica DFL-43]
 gi|162284115|gb|EDQ34399.1| phosphoglycerate kinase [Hoeflea phototrophica DFL-43]
          Length = 404

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/393 (51%), Positives = 279/393 (70%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL D+ G R LLRVD NVP  DGKV D TRIERV PTI+EL  K A+V++ +
Sbjct: 7   MTAFKTLDDLTDLPGKRVLLRVDLNVPVKDGKVTDTTRIERVAPTIMELSTKGARVILLA 66

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ ++    SL  +  + E +L   + F  DCIG   ++++ ++ +G ++L EN R
Sbjct: 67  HFGRPKGEAVPSMSLAPIAGVVEDVLDHRVHFAADCIGEVSAKAVNAMVDGDVLLLENTR 126

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+S EE+NDP FV  L++NGD ++NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 127 FHSGEEKNDPGFVIELAKNGDIFVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELLAL 186

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL NLV +VD LVIGGGMAN+F+ A+G+ VG+SLC
Sbjct: 187 EKGLGNPARPVVAIVGGAKVSTKIDLLKNLVNQVDALVIGGGMANTFIAARGIDVGKSLC 246

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    +I   A  S C I++P D VVARE K     + V+  ++P D+++LDVG K
Sbjct: 247 EHDLAATAKEIEAAAAASGCAIVLPVDGVVAREFKAEADNETVAIDAIPADAMMLDVGPK 306

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++ +   I +A T++WNGPLG FEI PFD ATV  A + A  T+E  ++S+AGGGDT++
Sbjct: 307 SIDAVNAWITKADTLVWNGPLGAFEIPPFDAATVSAAKHAAARTREGLLVSVAGGGDTVS 366

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           AL HAG+++EFTYVSTAGGAFLEW+EGK LPG+
Sbjct: 367 ALNHAGVTDEFTYVSTAGGAFLEWMEGKPLPGV 399


>gi|260461527|ref|ZP_05809774.1| Phosphoglycerate kinase [Mesorhizobium opportunistum WSM2075]
 gi|259032597|gb|EEW33861.1| Phosphoglycerate kinase [Mesorhizobium opportunistum WSM2075]
          Length = 398

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 276/393 (70%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D+ +I G R L+RVD NVP  DGKV D TRIER+ PTI EL  K AKV++ +
Sbjct: 1   MAAFRTLDDIGNISGKRVLVRVDLNVPVADGKVTDATRIERIAPTIAELSGKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  +      +L + + F +DC+G T   ++A++++G ++L EN R
Sbjct: 61  HFGRPKDGPSPEFSLEPIAKATAQVLGRPVGFASDCVGDTAGSAVAAMNKGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE+NDP F   L+ NGD ++NDAFS +HRAH+S  GL+HLLP++ GR MQ EL  L
Sbjct: 121 FYKAEEKNDPAFTERLAANGDIFVNDAFSAAHRAHSSTEGLAHLLPAFAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGNPVRPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFLAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    QI  EA  + C II+P D VVA+E K G   + V+   VP D +ILDVG K
Sbjct: 241 EHDLAATAKQIMIEAAEAGCAIILPVDGVVAKEFKAGAACETVAISEVPADGMILDVGAK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  + + I +A T++WNGPLG FEI PFD ATV  A + A  TK  +++S+AGGGDT+ 
Sbjct: 301 TVTAVGEWIDRAATLVWNGPLGAFEIAPFDHATVAAAKHAAARTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           AL HAG++++FTYVSTAGGAFLEW+EGK LPG+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKPLPGV 393


>gi|307944524|ref|ZP_07659864.1| phosphoglycerate kinase [Roseibium sp. TrichSKD4]
 gi|307772273|gb|EFO31494.1| phosphoglycerate kinase [Roseibium sp. TrichSKD4]
          Length = 397

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 281/393 (71%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL DI G R L+RVD NVP    KV D TRIERV+PT+ EL +K AKVV+ +H G
Sbjct: 3   FKTLDDLSDITGKRVLVRVDLNVPMDGTKVTDTTRIERVLPTLRELSDKGAKVVLLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      +L K + F +DCIG+  + ++A+L  GG++L EN R++S
Sbjct: 63  RPKGERVAEMSLAPVAPAVAELLAKPVSFADDCIGAAAADAVAALENGGVLLLENTRYHS 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           +EE+NDPDF + L++NGD Y+NDAFS +HRAH S  G++ LLP+Y GR MQ EL  L S 
Sbjct: 123 DEEKNDPDFAKALAQNGDIYVNDAFSAAHRAHGSTEGIAKLLPAYAGRTMQAELEALGSA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             E K+P++A+VGG+KVS+KI LL NLV KVD LVIGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 183 LGEPKRPVLAVVGGAKVSSKIDLLENLVSKVDMLVIGGGMANTFLAAKGINVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +   + I   A+++ CEI++P D VVARE K G   + VS  ++P D++ILDVG  +V 
Sbjct: 243 LAGTANTIMTAAEKAGCEIVLPTDAVVAREFKAGAENETVSLDAIPEDAMILDVGVDSVN 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            ++  I  A T++WNGPLG FEIEPFD ATV  A + A  TK  ++ S+AGGGDT+ AL 
Sbjct: 303 NVRTKIDGASTLVWNGPLGAFEIEPFDTATVAAAQHAANRTKAGKLNSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HA  ++ F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 363 HADAADSFSYVSTAGGAFLEWLEGKELPGVKAL 395


>gi|163851791|ref|YP_001639834.1| phosphoglycerate kinase [Methylobacterium extorquens PA1]
 gi|259530774|sp|A9W5A7|PGK_METEP RecName: Full=Phosphoglycerate kinase
 gi|163663396|gb|ABY30763.1| Phosphoglycerate kinase [Methylobacterium extorquens PA1]
          Length = 400

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + +IA+L +G +IL EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSEKLGRPVAFGEDCVGEAAASAIAALKDGDVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAKRILAAAKEKNCTIILPVDALVAREFKANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|319406264|emb|CBI79901.1| phosphoglycerate kinase [Bartonella sp. AR 15-3]
          Length = 397

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/395 (50%), Positives = 289/395 (73%), Gaps = 1/395 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           + +T++D+ D+ G R L+RVD+NVP + G+V D TRIER   TI+EL ++ AKV+I SH 
Sbjct: 2   KFQTLDDV-DVTGKRVLVRVDFNVPILKGQVCDATRIERHKDTIVELQKRGAKVIILSHC 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + ++  V+   E I+ + +LF +DCIG     +  ++ EG I+L ENVRFY
Sbjct: 61  GRPKGQFVPEFTVRPVIEALEKIIEQPVLFASDCIGDVAQSAAGTVQEGQILLLENVRFY 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             EE+ND  F + L+ NGD Y+NDAFSVSHRAHASI G++HLLPSY GRA+QKEL  LE 
Sbjct: 121 PGEEKNDRSFAKALAHNGDLYVNDAFSVSHRAHASIEGITHLLPSYAGRALQKELQALEK 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                  P++A+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC++
Sbjct: 181 GLDCPTHPVIAVVGGAKVSSKLFVLNHLVEKVDYLVIGGGMANSFLAAQGVSVGKSLCEK 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                + +I  +A ++ C +++P DV+V    +   P Q  + + +P + +ILD+G +++
Sbjct: 241 TLMTTIKEIIEKAHQNHCTLLLPLDVIVGFHFEQETPHQCYALEEIPEEGMILDIGPRSL 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
            +I+  I +A+T++WNGPLGVFE+ PFD+ TV VA YVAK +++ +++SIAGGGDT+ AL
Sbjct: 301 AHIQAAIDKAKTLVWNGPLGVFEMSPFDQGTVAVARYVAKRSQQGQLVSIAGGGDTVFAL 360

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            HAG++N+FTY+STAGGAFLEW+EGK LPGI+AL 
Sbjct: 361 NHAGVANDFTYLSTAGGAFLEWMEGKGLPGILALQ 395


>gi|254561562|ref|YP_003068657.1| phosphoglycerate kinase [Methylobacterium extorquens DM4]
 gi|254268840|emb|CAX24801.1| phosphoglycerate kinase [Methylobacterium extorquens DM4]
          Length = 400

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + ++A+L +G +IL EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSEKLGRPVAFGEDCVGEAAASAVAALKDGDVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEVPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAQRILAAAKEKNCTIILPVDALVAREFKANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|254501167|ref|ZP_05113318.1| phosphoglycerate kinase [Labrenzia alexandrii DFL-11]
 gi|222437238|gb|EEE43917.1| phosphoglycerate kinase [Labrenzia alexandrii DFL-11]
          Length = 400

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 279/393 (70%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ D+ G R L+RVD NVP  + KV D TRIERV+PTI EL EK AKV++ +H G
Sbjct: 6   FKTIDDITDLAGKRVLVRVDLNVPMDNYKVTDTTRIERVLPTIKELSEKGAKVILLAHFG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +  K+ SL  V      +L K + F  DC+G + + ++A +  G ++L EN RF+ 
Sbjct: 66  RPKGEKVKEMSLAAVARAVSDLLGKTVGFAEDCMGPSAAGAVAVMQSGQVLLMENTRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+F + L+ NGD Y+NDAFS +HRAH S  G++ LLP+Y GR MQ EL  L S 
Sbjct: 126 GEEKNDPEFAKALAANGDVYVNDAFSAAHRAHGSTEGIAQLLPAYAGRTMQAELEALGSA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             E  +P++A+VGG+KVS+KI LL NLV KV+ LVIGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 186 LGEPVRPVLAVVGGAKVSSKIDLLENLVAKVNMLVIGGGMANTFLAAKGVNVGKSLCEHD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I   A+ + CEI++P D VVA+E K G   + VS  ++P D +ILDVG  +VE
Sbjct: 246 LADTAKKIMAAAETAGCEIVLPVDAVVAKEFKAGADNETVSVDAIPEDGMILDVGAASVE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +K  I  A+T++WNGPLG FEI PFD ATV  A + A+ TK  ++ S+AGGGDT+ AL 
Sbjct: 306 VVKSKIDAAKTLVWNGPLGAFEIAPFDIATVAAAKHAAENTKSGKLNSVAGGGDTVAALN 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG +++F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 366 HAGAASDFSYVSTAGGAFLEWLEGKELPGVKAL 398


>gi|218530597|ref|YP_002421413.1| phosphoglycerate kinase [Methylobacterium chloromethanicum CM4]
 gi|259530770|sp|B7KNP6|PGK_METC4 RecName: Full=Phosphoglycerate kinase
 gi|218522900|gb|ACK83485.1| Phosphoglycerate kinase [Methylobacterium chloromethanicum CM4]
          Length = 400

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + ++A+L +G +IL EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSEKLGRPVAFGEDCVGEAAASAVAALKDGDVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE +     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAKRILAAAKEKNCTIILPVDALVAREFRANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|240138954|ref|YP_002963429.1| phosphoglycerate kinase [Methylobacterium extorquens AM1]
 gi|240008926|gb|ACS40152.1| phosphoglycerate kinase [Methylobacterium extorquens AM1]
          Length = 400

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + ++A+L +G ++L EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSDKLGRPVAFGEDCVGEAAASAVAALKDGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAKRILAAAKEKNCTIILPVDALVAREFKANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|240851241|ref|YP_002972644.1| phosphoglycerate kinase [Bartonella grahamii as4aup]
 gi|240268364|gb|ACS51952.1| phosphoglycerate kinase [Bartonella grahamii as4aup]
          Length = 397

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 285/393 (72%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+ G R L+RVD+NVP   GKV D TR+ER   T++EL ++ AK+++ SH G
Sbjct: 3   FRTLDDV-DVTGKRVLVRVDFNVPMAQGKVCDTTRLERHKETLVELQKRGAKLILLSHCG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  VV + E I++K + F  DCIGS +  ++ SL  GG++L ENVRFY+
Sbjct: 62  RPKGKVEPEFSLRPVVQVLEKIINKPVSFAPDCIGSVVQVAVESLQNGGVLLLENVRFYA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND  F   L+ NGD Y+NDAFSVSHRAHAS+ G++HLLPSY GR++Q E+  LE  
Sbjct: 122 GEEKNDCSFAEALAHNGDLYVNDAFSVSHRAHASVEGITHLLPSYAGRSLQGEMQALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                 P+VAIVGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC+  
Sbjct: 182 LGNPTHPVVAIVGGAKVSSKLFVLNHLVEKVDHLVIGGGMANSFLAAQGVSVGKSLCEHA 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D + +I  +A+   C +++P+D VV    +   P ++   + +P D +ILD+G +++ 
Sbjct: 242 LMDTIKKIIKKAQECQCTLLLPQDAVVGFRFEKDAPHRLYDIEDIPQDGMILDIGTRSIA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
           +I  VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+ +   +++SIAGGGDT+ AL 
Sbjct: 302 HINTVIDKAATLVWNGPLGVFEMSPFDKGTIAVARHAAERSLTGKLVSIAGGGDTVFALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++N+FTY+STAGGAFLEW+EGK LPGI+AL
Sbjct: 362 HAGVANDFTYLSTAGGAFLEWMEGKVLPGILAL 394


>gi|328542525|ref|YP_004302634.1| phosphoglycerate kinase [polymorphum gilvum SL003B-26A1]
 gi|326412271|gb|ADZ69334.1| Phosphoglycerate kinase [Polymorphum gilvum SL003B-26A1]
          Length = 397

 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/393 (52%), Positives = 278/393 (70%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL  I G R L+RVD NVP  DG++ D TRI  V PTIL+L  K AKVV+ +H G
Sbjct: 3   FKTLDDLAGIAGKRALVRVDLNVPMKDGRITDDTRIRAVAPTILDLAAKGAKVVLLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ ++  D SL  V      +L + + F  DCIG   S ++ ++++G ++L EN RF++
Sbjct: 63  RPKGQAVADMSLAPVAPAVAEVLGRPVAFAADCIGDAASAAVDAMADGEVLLLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND  F + L+ NGD Y+NDAFS +HRAHAS  GL+ LLP+Y GR MQ EL  L + 
Sbjct: 123 GEEKNDDAFAKALAANGDLYVNDAFSAAHRAHASTEGLARLLPAYAGRTMQAELEALGAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P++A+VGG+KVS+KI LL NLV KVD LVIGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 183 LGAPKRPVLAVVGGAKVSSKIDLLENLVGKVDMLVIGGGMANTFLAARGVDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++ V  I   A+RS CEI++P D VVARE K G   + V   ++P D++ILDVG  ++E
Sbjct: 243 LAETVRTIMAAAERSGCEIVLPADAVVAREFKAGAANETVGLDAIPADAMILDVGAASIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +K  I +A T++WNGPLG FEIEPFD+ATV  A + A  TK  +++S+AGGGDT+ AL 
Sbjct: 303 AVKAAIDRAATLVWNGPLGAFEIEPFDKATVAAARHAADRTKAGKLLSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG   +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 363 HAGAGADFSYVSTAGGAFLEWLEGKELPGVKAL 395


>gi|13473223|ref|NP_104790.1| phosphoglycerate kinase [Mesorhizobium loti MAFF303099]
 gi|21263815|sp|Q98FJ1|PGK_RHILO RecName: Full=Phosphoglycerate kinase
 gi|14023971|dbj|BAB50576.1| phosphoglycerate kinase [Mesorhizobium loti MAFF303099]
          Length = 398

 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 276/393 (70%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++D+ +I G R L+RVD NVP  DGKV D TRIER+ PTI EL  K AKV++ +
Sbjct: 1   MAAFKTLDDIGNISGKRVLVRVDLNVPVADGKVTDATRIERIAPTIAELSGKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  +      +L + + F +DC+G     ++A++++G ++L EN R
Sbjct: 61  HFGRPKDGPSPEFSLEPIARATAEVLGRPVGFASDCVGDMAGSAVAAMNKGDVLLFENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE+NDP F   L+ NGD ++NDAFS +HRAH+S  GL+ LLPS+ GR MQ EL  L
Sbjct: 121 FYKAEEKNDPAFSERLAANGDIFVNDAFSAAHRAHSSTEGLARLLPSFAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGNPVRPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFLAARGTDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    QI  EA  + C II+P D VVA+E K G   + V+   VP D +ILDVG K
Sbjct: 241 EHDLAPTAKQIMIEAAEAGCAIILPVDGVVAKEFKAGAACETVAISDVPADGMILDVGEK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV+ I + I +A T++WNGPLG FEIEPFD ATV  A + A  TK  +++S+AGGGDT+ 
Sbjct: 301 TVKTIGEWIDRAATLVWNGPLGAFEIEPFDHATVAAAKHAAARTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           AL HAG++++FTYVSTAGGAFLEW+EGK LPG+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKPLPGV 393


>gi|254719729|ref|ZP_05181540.1| phosphoglycerate kinase [Brucella sp. 83/13]
          Length = 395

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 275/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSRRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L +++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDRSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 361 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 390


>gi|265984744|ref|ZP_06097479.1| phosphoglycerate kinase [Brucella sp. 83/13]
 gi|306839922|ref|ZP_07472718.1| phosphoglycerate kinase [Brucella sp. NF 2653]
 gi|264663336|gb|EEZ33597.1| phosphoglycerate kinase [Brucella sp. 83/13]
 gi|306404989|gb|EFM61272.1| phosphoglycerate kinase [Brucella sp. NF 2653]
          Length = 396

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 275/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSRRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L +++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDRSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|225853183|ref|YP_002733416.1| phosphoglycerate kinase [Brucella melitensis ATCC 23457]
 gi|256263327|ref|ZP_05465859.1| phosphoglycerate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|225641548|gb|ACO01462.1| Phosphoglycerate kinase [Brucella melitensis ATCC 23457]
 gi|263093325|gb|EEZ17394.1| phosphoglycerate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409741|gb|ADZ66806.1| phosphoglycerate kinase [Brucella melitensis M28]
          Length = 396

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/393 (50%), Positives = 275/393 (69%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGVNVL 394


>gi|326539452|gb|ADZ87667.1| phosphoglycerate kinase [Brucella melitensis M5-90]
          Length = 395

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/393 (50%), Positives = 275/393 (69%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 361 HAGVADDFTYISTAGGAFLEWMEGKPLPGVNVL 393


>gi|225628297|ref|ZP_03786331.1| Phosphoglycerate kinase [Brucella ceti str. Cudo]
 gi|237816104|ref|ZP_04595100.1| Phosphoglycerate kinase [Brucella abortus str. 2308 A]
 gi|225616143|gb|EEH13191.1| Phosphoglycerate kinase [Brucella ceti str. Cudo]
 gi|237788767|gb|EEP62979.1| Phosphoglycerate kinase [Brucella abortus str. 2308 A]
          Length = 404

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 11  FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 69

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 70  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 129

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 130 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 189

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 190 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 249

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 250 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 309

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 310 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 369

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 370 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 399


>gi|163845306|ref|YP_001622961.1| phosphoglycerate kinase [Brucella suis ATCC 23445]
 gi|189024817|ref|YP_001935585.1| phosphoglycerate kinase [Brucella abortus S19]
 gi|254708741|ref|ZP_05170552.1| phosphoglycerate kinase [Brucella pinnipedialis B2/94]
 gi|256061765|ref|ZP_05451900.1| phosphoglycerate kinase [Brucella neotomae 5K33]
 gi|256114294|ref|ZP_05455039.1| phosphoglycerate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|256160441|ref|ZP_05458130.1| phosphoglycerate kinase [Brucella ceti M490/95/1]
 gi|256258148|ref|ZP_05463684.1| phosphoglycerate kinase [Brucella abortus bv. 9 str. C68]
 gi|260547158|ref|ZP_05822896.1| phosphoglycerate kinase [Brucella abortus NCTC 8038]
 gi|260755427|ref|ZP_05867775.1| phosphoglycerate kinase [Brucella abortus bv. 6 str. 870]
 gi|260758649|ref|ZP_05870997.1| phosphoglycerate kinase [Brucella abortus bv. 4 str. 292]
 gi|260762481|ref|ZP_05874818.1| phosphoglycerate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884443|ref|ZP_05896057.1| phosphoglycerate kinase [Brucella abortus bv. 9 str. C68]
 gi|261222850|ref|ZP_05937131.1| phosphoglycerate kinase [Brucella ceti B1/94]
 gi|261315905|ref|ZP_05955102.1| phosphoglycerate kinase [Brucella pinnipedialis M163/99/10]
 gi|261316233|ref|ZP_05955430.1| phosphoglycerate kinase [Brucella pinnipedialis B2/94]
 gi|261325767|ref|ZP_05964964.1| phosphoglycerate kinase [Brucella neotomae 5K33]
 gi|261750883|ref|ZP_05994592.1| phosphoglycerate kinase [Brucella suis bv. 5 str. 513]
 gi|261757381|ref|ZP_06001090.1| phosphoglycerate kinase [Brucella sp. F5/99]
 gi|265987295|ref|ZP_06099852.1| phosphoglycerate kinase [Brucella pinnipedialis M292/94/1]
 gi|265995600|ref|ZP_06108157.1| phosphoglycerate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|265998809|ref|ZP_06111366.1| phosphoglycerate kinase [Brucella ceti M490/95/1]
 gi|297248998|ref|ZP_06932706.1| phosphoglycerate kinase [Brucella abortus bv. 5 str. B3196]
 gi|68067490|sp|Q9L560|PGK_BRUAB RecName: Full=Phosphoglycerate kinase
 gi|163676029|gb|ABY40139.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189020389|gb|ACD73111.1| phosphoglycerate kinase [Brucella abortus S19]
 gi|260095523|gb|EEW79401.1| phosphoglycerate kinase [Brucella abortus NCTC 8038]
 gi|260668967|gb|EEX55907.1| phosphoglycerate kinase [Brucella abortus bv. 4 str. 292]
 gi|260672907|gb|EEX59728.1| phosphoglycerate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675535|gb|EEX62356.1| phosphoglycerate kinase [Brucella abortus bv. 6 str. 870]
 gi|260873971|gb|EEX81040.1| phosphoglycerate kinase [Brucella abortus bv. 9 str. C68]
 gi|260921434|gb|EEX88087.1| phosphoglycerate kinase [Brucella ceti B1/94]
 gi|261295456|gb|EEX98952.1| phosphoglycerate kinase [Brucella pinnipedialis B2/94]
 gi|261301747|gb|EEY05244.1| phosphoglycerate kinase [Brucella neotomae 5K33]
 gi|261304931|gb|EEY08428.1| phosphoglycerate kinase [Brucella pinnipedialis M163/99/10]
 gi|261737365|gb|EEY25361.1| phosphoglycerate kinase [Brucella sp. F5/99]
 gi|261740636|gb|EEY28562.1| phosphoglycerate kinase [Brucella suis bv. 5 str. 513]
 gi|262553498|gb|EEZ09267.1| phosphoglycerate kinase [Brucella ceti M490/95/1]
 gi|262766884|gb|EEZ12502.1| phosphoglycerate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|264659492|gb|EEZ29753.1| phosphoglycerate kinase [Brucella pinnipedialis M292/94/1]
 gi|297174131|gb|EFH33488.1| phosphoglycerate kinase [Brucella abortus bv. 5 str. B3196]
          Length = 396

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|62290601|ref|YP_222394.1| phosphoglycerate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82700518|ref|YP_415092.1| phosphoglycerate kinase [Brucella melitensis biovar Abortus 2308]
 gi|148559840|ref|YP_001259580.1| phosphoglycerate kinase [Brucella ovis ATCC 25840]
 gi|254689895|ref|ZP_05153149.1| phosphoglycerate kinase [Brucella abortus bv. 6 str. 870]
 gi|254698045|ref|ZP_05159873.1| phosphoglycerate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700387|ref|ZP_05162215.1| phosphoglycerate kinase [Brucella suis bv. 5 str. 513]
 gi|254708406|ref|ZP_05170234.1| phosphoglycerate kinase [Brucella pinnipedialis M163/99/10]
 gi|254730929|ref|ZP_05189507.1| phosphoglycerate kinase [Brucella abortus bv. 4 str. 292]
 gi|256030266|ref|ZP_05443880.1| phosphoglycerate kinase [Brucella pinnipedialis M292/94/1]
 gi|256255647|ref|ZP_05461183.1| phosphoglycerate kinase [Brucella ceti B1/94]
 gi|256370136|ref|YP_003107647.1| phosphoglycerate kinase [Brucella microti CCM 4915]
 gi|260167941|ref|ZP_05754752.1| phosphoglycerate kinase [Brucella sp. F5/99]
 gi|62196733|gb|AAX75033.1| Pgk, phosphoglycerate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82616619|emb|CAJ11698.1| Phosphoglycerate kinase:G-protein beta WD-40 repeat [Brucella
           melitensis biovar Abortus 2308]
 gi|148371097|gb|ABQ61076.1| phosphoglycerate kinase [Brucella ovis ATCC 25840]
 gi|256000299|gb|ACU48698.1| phosphoglycerate kinase [Brucella microti CCM 4915]
          Length = 395

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 361 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 390


>gi|254717483|ref|ZP_05179294.1| phosphoglycerate kinase [Brucella ceti M13/05/1]
 gi|261219316|ref|ZP_05933597.1| phosphoglycerate kinase [Brucella ceti M13/05/1]
 gi|261322377|ref|ZP_05961574.1| phosphoglycerate kinase [Brucella ceti M644/93/1]
 gi|260924405|gb|EEX90973.1| phosphoglycerate kinase [Brucella ceti M13/05/1]
 gi|261295067|gb|EEX98563.1| phosphoglycerate kinase [Brucella ceti M644/93/1]
          Length = 396

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASTIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|306841447|ref|ZP_07474148.1| phosphoglycerate kinase [Brucella sp. BO2]
 gi|306288485|gb|EFM59840.1| phosphoglycerate kinase [Brucella sp. BO2]
          Length = 396

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMTKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|254714586|ref|ZP_05176397.1| phosphoglycerate kinase [Brucella ceti M644/93/1]
          Length = 395

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIASTIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 361 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 390


>gi|254703504|ref|ZP_05165332.1| phosphoglycerate kinase [Brucella suis bv. 3 str. 686]
          Length = 395

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+R+D NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSKRVLVRIDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 361 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 390


>gi|161619655|ref|YP_001593542.1| phosphoglycerate kinase [Brucella canis ATCC 23365]
 gi|260568811|ref|ZP_05839279.1| phosphoglycerate kinase [Brucella suis bv. 4 str. 40]
 gi|261754136|ref|ZP_05997845.1| phosphoglycerate kinase [Brucella suis bv. 3 str. 686]
 gi|161336466|gb|ABX62771.1| Phosphoglycerate kinase [Brucella canis ATCC 23365]
 gi|260154195|gb|EEW89277.1| phosphoglycerate kinase [Brucella suis bv. 4 str. 40]
 gi|261743889|gb|EEY31815.1| phosphoglycerate kinase [Brucella suis bv. 3 str. 686]
          Length = 396

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+R+D NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRIDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|256045336|ref|ZP_05448230.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565772|ref|ZP_05836255.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|265991761|ref|ZP_06104318.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|24418595|sp|Q8YIY0|PGK_BRUME RecName: Full=Phosphoglycerate kinase
 gi|260151145|gb|EEW86240.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|263002717|gb|EEZ15120.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 396

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D +V        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAIVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|261214697|ref|ZP_05928978.1| phosphoglycerate kinase [Brucella abortus bv. 3 str. Tulya]
 gi|260916304|gb|EEX83165.1| phosphoglycerate kinase [Brucella abortus bv. 3 str. Tulya]
          Length = 396

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIALAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|254694387|ref|ZP_05156215.1| phosphoglycerate kinase [Brucella abortus bv. 3 str. Tulya]
          Length = 395

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIALAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 361 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 390


>gi|17986592|ref|NP_539226.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|17982203|gb|AAL51490.1| phosphoglycerate kinase [Brucella melitensis bv. 1 str. 16M]
          Length = 404

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 11  FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 69

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 70  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 129

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 130 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 189

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 190 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 249

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D +V        P Q     SVP D++ILD G  + +
Sbjct: 250 LASTAREIMAKAETTKCAIILPVDAIVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 309

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 310 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 369

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 370 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 399


>gi|306844719|ref|ZP_07477304.1| phosphoglycerate kinase [Brucella sp. BO1]
 gi|306274891|gb|EFM56661.1| phosphoglycerate kinase [Brucella sp. BO1]
          Length = 396

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 273/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSRRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L   + F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHGVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAVNGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|294850978|ref|ZP_06791654.1| phosphoglycerate kinase [Brucella sp. NVSL 07-0026]
 gi|294821621|gb|EFG38617.1| phosphoglycerate kinase [Brucella sp. NVSL 07-0026]
          Length = 396

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NG+ Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGNLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|188581576|ref|YP_001925021.1| phosphoglycerate kinase [Methylobacterium populi BJ001]
 gi|259530778|sp|B1Z980|PGK_METPB RecName: Full=Phosphoglycerate kinase
 gi|179345074|gb|ACB80486.1| Phosphoglycerate kinase [Methylobacterium populi BJ001]
          Length = 400

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/396 (50%), Positives = 275/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ E   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIAEAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +   SL  ++      L + + F  DC+G   ++++A+L +G ++L EN R
Sbjct: 61  HFGRPKGKPEPKDSLKPILPTLSEKLGRPVAFGEDCVGEAAAKAVAALKDGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+N P+F + L+ NGD Y+N+AFS +HRAHAS  GL+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNAPEFAQALAANGDLYVNEAFSAAHRAHASTEGLARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V+  +VP D++ILDVG  
Sbjct: 241 EKDLAETAQRILAAAKEKNCTIILPADALVAREFKANAENETVTVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ T+  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIDEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTRAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|56551074|ref|YP_161913.1| phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761353|ref|ZP_04759441.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753267|ref|YP_003226160.1| phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|129931|sp|P09404|PGK_ZYMMO RecName: Full=Phosphoglycerate kinase
 gi|155604|gb|AAA27699.1| phosphoglycerate kinase [Zymomonas mobilis]
 gi|56542648|gb|AAV88802.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374260|gb|EER63757.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552630|gb|ACV75576.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 397

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/393 (49%), Positives = 275/393 (69%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R L+R D NVP    +V D TR+   +PT+ EL EK AKV+I +H G
Sbjct: 3   FRTLDDIGDVKGKRVLVREDLNVPMDGDRVTDDTRLRAAIPTVNELAEKGAKVLILAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL ++      +L + + F+ND  G   ++++ +L+ G + L EN RFY+
Sbjct: 63  RPKGQPNPEMSLARIKDALAGVLGRPVHFINDIKGEAAAKAVDALNPGAVALLENTRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP     +++ GDFY+NDAFS +HRAH S  GL+H LP++ GRAMQKEL  LE+ 
Sbjct: 123 GEEKNDPALAAEVAKLGDFYVNDAFSAAHRAHVSTEGLAHKLPAFAGRAMQKELEALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             +   P+ A+VGG+KVSTK+ +L NLV KVD L+IGGGMAN+FL AQG+ VG+SLC+ +
Sbjct: 183 LGKPTHPVAAVVGGAKVSTKLDVLTNLVSKVDHLIIGGGMANTFLAAQGVDVGKSLCEHE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D V  I   A+++ C+I +P DVVVA+E K   P + +    V  D +ILDVG K V 
Sbjct: 243 LKDTVKGIFAAAEKTGCKIHLPSDVVVAKEFKANPPIRTIPVSDVAADEMILDVGPKAVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V+  ++T++WNGPLG FEIEPFD+ATV +A   A LTK   +IS+AGGGDT+ AL 
Sbjct: 303 ALTEVLKASKTLVWNGPLGAFEIEPFDKATVALAKEAAALTKAGSLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++ +F++VSTAGGAFLEW+EGK+LPG+ AL
Sbjct: 363 HAGVAKDFSFVSTAGGAFLEWMEGKELPGVKAL 395


>gi|8037939|gb|AAF71544.1|AF256214_1 phosphoglycerate kinase [Brucella abortus]
          Length = 396

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/390 (50%), Positives = 274/390 (70%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 3   FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKPAVDALKDGDVLLLENTRFHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+++LP++ GRAMQ EL  LE  
Sbjct: 122 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLANVLPAFAGRAMQAELEALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 182 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 242 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 302 LIASAIDDAATLVWNGPLGAFELSPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 391


>gi|27376633|ref|NP_768162.1| phosphoglycerate kinase [Bradyrhizobium japonicum USDA 110]
 gi|46576802|sp|Q89U95|PGK_BRAJA RecName: Full=Phosphoglycerate kinase
 gi|27349774|dbj|BAC46787.1| phosphoglycerate kinase [Bradyrhizobium japonicum USDA 110]
          Length = 398

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/395 (50%), Positives = 273/395 (69%), Gaps = 2/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           ++ RT++D+ D++G R LLRVD NVP  +G+V D TR+ERV PTI EL +K  KV++ +H
Sbjct: 3   NKFRTLDDV-DVKGKRVLLRVDLNVPMENGRVTDATRLERVAPTITELADKGGKVILLAH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ +  K+ SL  V      +L+K + F +DCIG   + ++A+L +G I+  EN RF
Sbjct: 62  FGRPKGRDAKE-SLKPVTEALSKVLNKPVAFADDCIGEPAATAVAALKDGDILCLENTRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  LE
Sbjct: 121 HKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDALE 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  KP++AI+GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+G+G+SL +
Sbjct: 181 KALGSPTKPVIAIIGGAKVSTKIDLLENLVSKVDALVIGGGMANTFLHAQGVGIGKSLAE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           +D +    +I  +A+ + C II+P D  VA       P+      ++P D +ILDVG ++
Sbjct: 241 KDLAPTALRIIEKAEAANCAIILPVDATVAYHFAANAPSHAYGLDAIPADGMILDVGPQS 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  +   I  A T++WNGPLG FE++PFDR TV  A + A+ TK +++ISIAGGGDT+ A
Sbjct: 301 VARVHAAIDDAATLVWNGPLGAFEMQPFDRGTVAAAKHAAERTKAKKLISIAGGGDTVAA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L  A ++ +FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 361 LNQAHVAGDFTYVSTAGGAFLEWMEGKPLPGVEVL 395


>gi|118588348|ref|ZP_01545757.1| phosphoglycerate kinase [Stappia aggregata IAM 12614]
 gi|118439054|gb|EAV45686.1| phosphoglycerate kinase [Stappia aggregata IAM 12614]
          Length = 397

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 277/393 (70%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL DI G R L+RVD NVP   GKV D TRIERV+PTI EL +KKAKV++ +H G
Sbjct: 3   FKTLDDLTDIAGKRVLVRVDLNVPMDGGKVTDTTRIERVLPTIRELSDKKAKVILLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +     SL  V     ++L + ++F +DCIG     ++  + +G ++L EN R+++
Sbjct: 63  RPKGERVASMSLGPVAPAVAALLGRPVVFADDCIGQAAKDAVDVMVDGDVLLLENTRYHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDPDF + L+ NGD Y+NDAFS +HRAH S  G++ LLP+Y GR MQ EL  L S 
Sbjct: 123 GEEKNDPDFAKALAANGDVYVNDAFSAAHRAHGSTEGIARLLPAYAGRTMQAELEALGSA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P++A+VGG+KVS+KI LL NLV +VD LVIGGGMAN+FL A+G  VG+SLC+ D
Sbjct: 183 LGNPVRPVLAVVGGAKVSSKIDLLENLVTRVDMLVIGGGMANTFLAAKGTDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++   +I   A ++ CEI++P D VVA+E K G   + V+  ++P D +ILDVG  ++E
Sbjct: 243 LAETAKRIMTAADKAGCEIVLPADAVVAKEFKAGAENETVALDAIPSDGMILDVGAASIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +K  I  A+T++WNGPLG FEI PFD ATV  A + A  TK  ++ S+AGGGDT+ AL 
Sbjct: 303 TVKTKIDAAKTLVWNGPLGAFEIAPFDTATVAAAKHAAAKTKAGKLNSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG +++F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 363 HAGAADDFSYVSTAGGAFLEWLEGKELPGVKAL 395


>gi|23502586|ref|NP_698713.1| phosphoglycerate kinase [Brucella suis 1330]
 gi|30173003|sp|Q8FYX8|PGK_BRUSU RecName: Full=Phosphoglycerate kinase
 gi|23348589|gb|AAN30628.1| phosphoglycerate kinase [Brucella suis 1330]
          Length = 395

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/390 (50%), Positives = 272/390 (69%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  +++  R L+R+D NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 2   FRTLDD-ANVQSKRVLVRIDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 61  RPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+H+LP++ GRAMQ EL  LE  
Sbjct: 121 GEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKG 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC+ +
Sbjct: 181 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLCEHE 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  + +
Sbjct: 241 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGELSTD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ AL 
Sbjct: 301 LIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG+ ++FTY+STAGGAFLEW+EGK LP +
Sbjct: 361 HAGVVDDFTYISTAGGAFLEWMEGKPLPSV 390


>gi|227823336|ref|YP_002827308.1| phosphoglycerate kinase [Sinorhizobium fredii NGR234]
 gi|254782213|sp|C3MIJ2|PGK_RHISN RecName: Full=Phosphoglycerate kinase
 gi|227342337|gb|ACP26555.1| phosphoglycerate kinase [Sinorhizobium fredii NGR234]
          Length = 399

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 276/390 (70%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL DI G R L+RVD NVP  DG+V D TRIERV PTI EL EK AK+++ +H G
Sbjct: 3   FKTLDDLTDIAGKRVLVRVDLNVPVKDGQVTDTTRIERVAPTIRELSEKGAKIILLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   D SL  +    E IL + + F  DCIG   + +IA +++G ++L EN RF+ 
Sbjct: 63  RPKGEPVADMSLKAIAPAVEEILDQRVHFAADCIGDKAANAIAEMNDGDVLLLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP FV  L+ NGD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  LE  
Sbjct: 123 GEEKNDPAFVTALAANGDLYVNDAFSAAHRAHASTEGLAQHLPAYAGRTMQAELEALEKG 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P+VAIVGG+KVSTKI LL NLVKKVD LVIGGGMAN+FL AQG+ VG+SLC+ D
Sbjct: 183 LGNPKRPVVAIVGGAKVSTKIDLLQNLVKKVDALVIGGGMANTFLAAQGVDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++    I   A  + C I++P D VVARE K G    VV  +++P D+++LDVG K+V 
Sbjct: 243 LAETAKSIIAAAAAAGCAIVLPEDGVVAREFKAGADNAVVDIKAIPADAMVLDVGPKSVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I++A T++WNGPLG FEI PFD+ATV  A + A  T++  ++S+AGGGDT+ AL 
Sbjct: 303 AINDWISRAETLVWNGPLGAFEIAPFDKATVAAAKHAAARTRQGSLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HA ++++FTYVSTAGGAFLEW+EGK LPG+
Sbjct: 363 HAEVADDFTYVSTAGGAFLEWMEGKPLPGV 392


>gi|329890472|ref|ZP_08268815.1| phosphoglycerate kinase [Brevundimonas diminuta ATCC 11568]
 gi|328845773|gb|EGF95337.1| phosphoglycerate kinase [Brevundimonas diminuta ATCC 11568]
          Length = 398

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 276/393 (70%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+ G   L+RVD+NVP  DG V D TR++  +PTI  L E  AKVV+ +H  
Sbjct: 3   FRTLDDVSDLSGKAALVRVDFNVPMEDGNVTDDTRLKAALPTIHRLREAGAKVVLLAHFD 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +     SL  VV   E +LH  + F +DC+G     ++A L  GG++L ENVRF+ 
Sbjct: 63  RPKGERVPSMSLKPVVEPLELLLHGPVRFADDCVGDEAKAAVADLDAGGVLLLENVRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP F R L+  GD Y+NDAFS +HRAHAS  GL+ LLP+Y G AM +EL  L++ 
Sbjct: 123 GEEKNDPAFARQLAELGDLYVNDAFSAAHRAHASTEGLARLLPAYAGCAMARELEALDAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + +KP++ IVGG+KVSTK+ LL NLV K+D L IGGGMAN+FL AQG+ VG SLC++D
Sbjct: 183 LGKPQKPVIGIVGGAKVSTKLDLLKNLVAKLDYLAIGGGMANTFLFAQGVDVGGSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  EA+R  CE+++P DVVVA+ +K GI + V +   +  D +ILD G +TV 
Sbjct: 243 LTDTAREIIEEARRQGCELLLPVDVVVAKGVKPGIESGVRALDRIAADDLILDAGPETVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + + +  ++T++WNGPLGVFE+ PFD+ATVE A + A+L K  +++++AGGGDT+ AL 
Sbjct: 303 RLNRAMDLSKTLIWNGPLGVFEVPPFDKATVEAAKHAAELAKAGKLVAVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG +++ T+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 363 HAGTADDMTFVSTAGGAFLEWMEGKVLPGVEAL 395


>gi|154252553|ref|YP_001413377.1| phosphoglycerate kinase [Parvibaculum lavamentivorans DS-1]
 gi|154156503|gb|ABS63720.1| Phosphoglycerate kinase [Parvibaculum lavamentivorans DS-1]
          Length = 402

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/400 (51%), Positives = 276/400 (69%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMNDLR---DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVV 57
           M+  +T++DL     + GLR L+R D NVP  DGKV+D TR+ERV PT+ EL  + A+V+
Sbjct: 1   MADYKTLDDLFAAVGLDGLRILIRADLNVPMQDGKVSDATRLERVAPTLKELAGRGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+   +   SL  +     S++   + F  DCIG   S+++ ++  G I++ E
Sbjct: 61  VLSHFGRPKGAPEAKYSLKPIAEALSSVVGSKVGFAEDCIGDVASRAVEAMQPGTILVLE 120

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           N RF++ EE NDP F + L+RNG+ Y+NDAFS +HRAH S  G++H LPSY GRAM+ EL
Sbjct: 121 NTRFHAGEENNDPAFAKALARNGNVYVNDAFSCAHRAHGSTEGITHFLPSYAGRAMEAEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
           + L++     K+P+VAIVGG+K+STKI+LL NLVKKVD LVIGGGMAN+FL AQG  VG+
Sbjct: 181 AALDAALGNPKRPVVAIVGGAKISTKISLLGNLVKKVDALVIGGGMANTFLAAQGKKVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D  D    I   A+ + C+I++P DVVVA E K G  ++ VS  +VP D +ILDV
Sbjct: 241 SLCEPDLFDTARHILANARAAHCDIVLPTDVVVAAEFKAGAASKTVSVDAVPDDMMILDV 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  TV ++      A+TV+WNGPLG FE+ PFDR TVE A  VA  +K+  +IS+ GGGD
Sbjct: 301 GPDTVTHLAGRFETAKTVVWNGPLGAFEVPPFDRGTVEAARIVAMRSKQGELISVGGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           T+ AL  AG + +FTYVS AGGAFLEWLEG +LPG+ ALS
Sbjct: 361 TVAALNEAGAAEDFTYVSAAGGAFLEWLEGVELPGVAALS 400


>gi|288959351|ref|YP_003449692.1| phosphoglycerate kinase [Azospirillum sp. B510]
 gi|288911659|dbj|BAI73148.1| phosphoglycerate kinase [Azospirillum sp. B510]
          Length = 397

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/397 (49%), Positives = 276/397 (69%), Gaps = 1/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+   T++DL ++ G   L+R D NVP  DGKV+D TRI+R+ PT+ EL  K AKVV+ S
Sbjct: 1   MTDFNTIDDL-EVSGKTVLVRADLNVPMQDGKVSDTTRIDRLAPTLKELSAKGAKVVVLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP++  D   SL  V+    + + + + F  DC+G    ++IA + EG I+L EN R
Sbjct: 60  HFGRPKNGPDAKNSLRNVLDALSAAVGQKVAFAEDCVGEKAREAIAKVHEGAIVLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++EEE+NDP F + ++  GD Y+NDAFS +HRAHAS  G++ LLP+  GR M+ EL  L
Sbjct: 120 FHAEEEKNDPAFAKEMAALGDLYVNDAFSAAHRAHASTEGVARLLPNAAGRLMEAELKAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                + ++P+ A+VGG+K+STK+ LL N+V+KVD LV+GGGMAN+FL AQG+ VG SLC
Sbjct: 180 TLALEKPERPVAAVVGGAKISTKLELLGNMVRKVDLLVLGGGMANTFLFAQGIDVGASLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +D    I   AK + CEI++P+D VVA+E K G   +VV+  ++  D + LDVG  
Sbjct: 240 EKDMADQARAIMATAKEANCEILLPKDFVVAKEFKAGAANRVVAFDAIGSDEMALDVGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVE++   +  A+T++WNGPLG FEI+PFD  T  VA  VA  T+   ++S+AGGGDT+ 
Sbjct: 300 TVEFLGVKLQGAKTIVWNGPLGAFEIQPFDAGTNAVAGLVAARTEAGGLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ALAHAG  ++FTYVS AGGAFLEWLEGK+LPG+ AL+
Sbjct: 360 ALAHAGAEDKFTYVSAAGGAFLEWLEGKELPGVAALA 396


>gi|209966638|ref|YP_002299553.1| phosphoglycerate kinase [Rhodospirillum centenum SW]
 gi|238057764|sp|B6IWR7|PGK_RHOCS RecName: Full=Phosphoglycerate kinase
 gi|209960104|gb|ACJ00741.1| phosphoglycerate kinase [Rhodospirillum centenum SW]
          Length = 396

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/394 (49%), Positives = 273/394 (69%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++DL  + G   L+R D NVP  DG+V+D TR++R+ PT+ EL  K AKVV+ SH G
Sbjct: 3   FKTLDDL-SVAGKTVLVRGDLNVPVQDGRVSDTTRLDRLAPTLKELAGKGAKVVVLSHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   D   SL +VV   E+ L   + F  DC+G +   +IA++  G ++L EN RF++
Sbjct: 62  RPKGGPDAKNSLRQVVPALEAALGLPVAFAEDCVGESARAAIAAIEPGQVVLLENTRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+  R ++  GD Y+NDAFS +HRAHAS  G++HLLPS  GR MQ EL  L   
Sbjct: 122 GEEKNDPELARQMAALGDIYVNDAFSAAHRAHASTEGIAHLLPSAAGRLMQAELEALGKA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P++A+VGG+K+STK+ LL+N+V KVD LV+GGGMAN+FL AQG  VG+SL ++D
Sbjct: 182 LARPERPVMAVVGGAKISTKLDLLLNMVTKVDMLVLGGGMANTFLFAQGRPVGKSLAEKD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D    I  +A  S CEI++P+D  +A+E K G P +VV  + +  D ++LDVG  TVE
Sbjct: 242 MADQARAIMEKAAASGCEILLPQDGAMAKEFKAGAPHRVVPVEQIADDEMMLDVGPATVE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
           ++   +  A+TV+WNGP+G FEI PFD  T  VA  VA LT + R++S+AGGGDT+ AL 
Sbjct: 302 FVGLKLQGAKTVVWNGPMGAFEIRPFDSGTNAVAGLVAALTGDGRVLSVAGGGDTVAALE 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG++  F+YVSTAGGAFLEWLEGK+LPG+ AL 
Sbjct: 362 QAGVAGRFSYVSTAGGAFLEWLEGKELPGVKALG 395


>gi|254473180|ref|ZP_05086578.1| phosphoglycerate kinase [Pseudovibrio sp. JE062]
 gi|211957901|gb|EEA93103.1| phosphoglycerate kinase [Pseudovibrio sp. JE062]
          Length = 396

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/393 (50%), Positives = 279/393 (70%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D + + G R L+RVD NVP  DGKV D TRIERV+PTI E+ E   KV++ +H G
Sbjct: 3   FKTLSDAQ-LSGKRVLVRVDLNVPMKDGKVTDSTRIERVLPTIREISEAGGKVILLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V      +L K + F  DC G     ++ ++++G ++L EN RFY+
Sbjct: 62  RPKGKVVAEMSLAPVAGPVADLLGKPVAFAADCTGDVAKAAVDAMADGDVLLLENTRFYA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+F + L+ NGD Y+NDAFS +HRAH S  G++ LLP++ GR MQ EL  L S 
Sbjct: 122 GEEKNDPEFAKALAANGDLYVNDAFSAAHRAHGSTEGIAKLLPAFAGRTMQAELEALGSA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            S  ++P++A+VGG+KVS+KI LL NLV KVD LVIGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 182 LSTPERPVLAVVGGAKVSSKIDLLENLVSKVDILVIGGGMANTFLAAKGVNVGKSLCEHD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D  ++I   A+++ CEI++P D VVA E       + V+  ++P D+++LDVG  ++E
Sbjct: 242 LADTANRIMTAAEKANCEIVLPADAVVAWEFAANTKNETVALDAIPADAMMLDVGAASIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +K  I +A+T++WNGPLG FEIEPFD+ATV  A + A  TKE ++ ++AGGGDT+ AL 
Sbjct: 302 VVKAKIDKAKTLVWNGPLGAFEIEPFDKATVAAAQHAAARTKEGKLKTVAGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HA  S +F+Y+STAGGAFLEWLEGK+LPG+VAL
Sbjct: 362 HAKASEDFSYISTAGGAFLEWLEGKELPGVVAL 394


>gi|58038977|ref|YP_190941.1| phosphoglycerate kinase [Gluconobacter oxydans 621H]
 gi|81672717|sp|Q5FTL1|PGK_GLUOX RecName: Full=Phosphoglycerate kinase
 gi|58001391|gb|AAW60285.1| Phosphoglycerate kinase [Gluconobacter oxydans 621H]
          Length = 404

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/398 (50%), Positives = 281/398 (70%), Gaps = 3/398 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++ + D RG R L+R D NVP  DG + D TR++RV PTI ELV+K A+VV+FSH  
Sbjct: 3   FRTLDGV-DARGKRVLVRADLNVPMHDGVITDDTRLQRVAPTIRELVDKGARVVVFSHFD 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +     SL  +      IL + + FV +C+G T+  ++ ++++G II+ EN RF++
Sbjct: 62  RPKGQVVPAMSLRPIALKLGQILGQPVGFVAECVGPTVEAAVGAMADGDIIVLENTRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE NDP+F + L++NGD ++NDAFS +HRAHAS  G++  LPS+ GR MQ ELS L + 
Sbjct: 122 GEEANDPEFAKALAQNGDIFVNDAFSAAHRAHASTEGVARDLPSFAGRLMQAELSALSAA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+ AI+GGSK+STK+ L+ N+++KVD L I G MAN+FL A+GM VG+SL + +
Sbjct: 182 LENPERPVGAIIGGSKISTKLDLIGNVIEKVDTLFITGAMANTFLAAEGMNVGKSLQEAE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   +IA  A+   CEI++P D VVARE K  +PT+      VP D++ILD G +TVE
Sbjct: 242 MHETARKIAHLAQEKGCEIVLPVDAVVAREFKANVPTETCLIGEVPDDAMILDAGPRTVE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I+  +   +T++WNGPLG FEI PFD+ATVEVA Y A+LT+E ++ +IAGGGDT++AL 
Sbjct: 302 LIRDRLDTLKTLVWNGPLGAFEIAPFDKATVEVAQYAAQLTEEGKLKTIAGGGDTVSALR 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL--SGH 399
           HAG++NE TYVSTAGGAFLEWLEGK LPGI  L  +GH
Sbjct: 362 HAGVANEMTYVSTAGGAFLEWLEGKILPGIEVLRSAGH 399


>gi|319407741|emb|CBI81388.1| phosphoglycerate kinase [Bartonella sp. 1-1C]
          Length = 397

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/395 (51%), Positives = 294/395 (74%), Gaps = 1/395 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T++D+ D+ G R L+RVD+NVP +DGKV D TRIE    T++EL ++ AKV+I SH 
Sbjct: 2   EFQTLDDV-DVTGKRVLVRVDFNVPILDGKVCDATRIEGHKDTLVELQKRGAKVIILSHC 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + ++  VV + E I+ + +LF +DCIG    +++ ++ EG I+L ENVRFY
Sbjct: 61  GRPKGQVVPELTVRSVVEVLEKIIDQPVLFASDCIGEVAQKAVNTVQEGQILLLENVRFY 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             EE+NDP F + L+ NGD Y+NDAFSVSHRAHAS+ G++HLLPSY GRA+QKEL  LE 
Sbjct: 121 PGEEKNDPSFAQALAHNGDLYVNDAFSVSHRAHASVEGITHLLPSYAGRALQKELRALEK 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                  P+VA+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC++
Sbjct: 181 GLDRPMHPVVAVVGGAKVSSKLFVLNHLVEKVDYLVIGGGMANSFLAAQGVSVGQSLCEK 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                + +I  +A+++ C++++P DV+V    +   P Q  + + +P + +ILD+G +++
Sbjct: 241 TLMTTIKEIIEKAQKNHCKLLLPLDVIVGFHFEKETPHQCYALEDIPEEGMILDIGPRSI 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
            +I+  I +A+T++WNGPLGVFE+ PFD+ TV VA YVA+ +++ +++SIAGGGDT+ AL
Sbjct: 301 AHIQAAIDKAKTLVWNGPLGVFEMSPFDQGTVTVARYVAERSQQGQLVSIAGGGDTVFAL 360

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            HAG++N+FTY+STAGGAFLEW+EGK LPGI+AL 
Sbjct: 361 NHAGVANDFTYLSTAGGAFLEWMEGKGLPGILALQ 395


>gi|239832817|ref|ZP_04681146.1| Phosphoglycerate kinase [Ochrobactrum intermedium LMG 3301]
 gi|239825084|gb|EEQ96652.1| Phosphoglycerate kinase [Ochrobactrum intermedium LMG 3301]
          Length = 413

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 266/390 (68%), Gaps = 1/390 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  D++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +H G
Sbjct: 20  FRTLDD-ADVKSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFG 78

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +  + SL  VV     +L   + F  DCIG     ++ +L +G ++L EN RF+ 
Sbjct: 79  RPKGVASDENSLKHVVKPLAKVLGHGVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHK 138

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+FV  L+ NGD Y+NDAFS +HRAHAS  GL+H+LP+  GR MQ EL  LE  
Sbjct: 139 GEEKNDPEFVAALAANGDLYVNDAFSAAHRAHASTEGLAHVLPACAGRGMQAELEALEKG 198

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G  VG+SLC+ +
Sbjct: 199 LGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGYDVGKSLCEHE 258

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D VV        P Q     +VP D +ILD G  +++
Sbjct: 259 LASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPNQTYGVDAVPSDGMILDAGALSID 318

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGPLG FE+ PFD ATV+ A +VA  TK  +++S+ GGGDT+ AL 
Sbjct: 319 LIASAIDDAATLVWNGPLGAFELRPFDAATVKTAKHVAARTKAGKLVSVGGGGDTVAALN 378

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 379 HAGVADDFTYISTAGGAFLEWMEGKPLPGV 408


>gi|304394505|ref|ZP_07376426.1| phosphoglycerate kinase [Ahrensia sp. R2A130]
 gi|303293415|gb|EFL87794.1| phosphoglycerate kinase [Ahrensia sp. R2A130]
          Length = 399

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/396 (51%), Positives = 272/396 (68%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T++DL++I G R L+RVD NVP  +G+V+D TR+ER+VPT+ ELV+K AKV++ +H G
Sbjct: 3   IQTLDDLKNISGQRVLVRVDINVPMAEGQVSDTTRMERIVPTVSELVKKSAKVILLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K   D SL ++V     +L + + F  DC+G   +  IA +  G ++L EN RF+ 
Sbjct: 63  RPNGKVVADMSLKQIVPALSKVLGQEVRFAPDCVGGQAAAIIADMRGGDVVLLENTRFHE 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE++ P     ++  GD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  LE  
Sbjct: 123 GEEQDAPSLAAQMAELGDVYVNDAFSAAHRAHASTHGLAGSLPAYAGRTMQAELEALEKG 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P++AIVGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL A+GM VG+SLC+ D
Sbjct: 183 LGAPEHPVIAIVGGAKVSTKLDLLGNLVAKVDHLVIGGGMANTFLAARGMEVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +A  + CEII+P DVVVA       P   V     P D +ILD G +TV 
Sbjct: 243 LADTAREIEAKAAAANCEIILPVDVVVADGFAANSPNDTVPTADAPTDRMILDAGPETVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I+  IA A+T++WNGPLG FEIEPFDRATV+ A   A  TK   ++S+AGGGDT+ AL 
Sbjct: 303 LIENRIASAKTLVWNGPLGAFEIEPFDRATVQAAQAAAAATKAGTLVSVAGGGDTVAALK 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           HAG+ ++FTYVSTAGGAFLEW+EGK+LPG+ AL  H
Sbjct: 363 HAGVVDDFTYVSTAGGAFLEWMEGKELPGVAALRNH 398


>gi|299134160|ref|ZP_07027353.1| Phosphoglycerate kinase [Afipia sp. 1NLS2]
 gi|298590907|gb|EFI51109.1| Phosphoglycerate kinase [Afipia sp. 1NLS2]
          Length = 399

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 273/395 (69%), Gaps = 1/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           S  RT++D+ D+   R LLRVD NVP  +G+V+D TR+ERV  TI E+ EK  KV++ SH
Sbjct: 3   SLFRTLDDV-DVHNKRVLLRVDLNVPMDNGRVSDATRLERVTKTITEIAEKGGKVILLSH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+   +   SL  V      +L +++ FV+DCIG     +++ +  G II  EN RF
Sbjct: 62  FGRPKGVVNPKESLKPVAITLAYMLRRHVEFVDDCIGKKAEDAVSWMKPGDIICLENTRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE+NDP FV  L++ GD +INDAFS +HRAHAS  GL H+LP+Y GR+MQ EL  L 
Sbjct: 122 HKGEEKNDPAFVAELAKLGDIWINDAFSCAHRAHASTEGLGHVLPAYAGRSMQAELDALT 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                   P+ A++GG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+
Sbjct: 182 KALEAPTHPVAAVIGGAKVSTKLDLLENLVTKVDALVIGGGMANTFLHAQGVNVGKSLCE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           ++ +    +I  +A+ + C +I+P D V+ARE     P+Q     ++P D++ILDVG K+
Sbjct: 242 KELAPTALRILEKAEAAKCAVILPVDAVIAREFVAHAPSQACGLDAIPADAMILDVGPKS 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V+ ++     A+TV+WNGPLG FE+ PFDR TV+ A + A LT+E ++IS+AGGGDT+ A
Sbjct: 302 VDRVRAAFDDAKTVVWNGPLGAFELSPFDRGTVQAARHAAGLTREGKLISVAGGGDTVAA 361

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG++ +FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 362 LNHAGVAPDFTYVSTAGGAFLEWMEGKPLPGVEVL 396


>gi|319404777|emb|CBI78378.1| phosphoglycerate kinase [Bartonella rochalimae ATCC BAA-1498]
          Length = 397

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/395 (50%), Positives = 294/395 (74%), Gaps = 1/395 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T++D+ D+ G R L+RVD+NVP ++GKV D TRIE    T++EL ++ AKV+I SH 
Sbjct: 2   EFQTLDDV-DVTGKRVLVRVDFNVPILNGKVCDATRIEGHKDTLVELQKRGAKVIILSHC 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + ++  VV + E I+++++LF +DCIG    +++ ++ EG I+L ENVRFY
Sbjct: 61  GRPKGQVVPEFTVRSVVEVLEKIINQSVLFASDCIGEVAQKAVNTVQEGQILLLENVRFY 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             EE+NDP F + L+ NGD Y+NDAFSVSHRAHAS+ G++HLLPSY GRA+QKEL  LE 
Sbjct: 121 PGEEKNDPSFAQALAHNGDLYVNDAFSVSHRAHASVEGITHLLPSYAGRALQKELRALEK 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                  P+VA+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC++
Sbjct: 181 GLDRPMHPVVAVVGGAKVSSKLFVLNHLVEKVDYLVIGGGMANSFLAAQGVSVGQSLCEK 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                + +I  +A+++ C +++P DV+V        P Q  + + +P + +ILD+G +++
Sbjct: 241 TLMTTIKEIIEKAQKNHCTLLLPLDVIVGFHFAKETPHQCYALEDIPEEGMILDIGPRSI 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
            +I+  I +A+T++WNGPLGVFE+ PFD+ TV VA YVA+ +++ +++SIAGGGDT+ AL
Sbjct: 301 AHIQAAIDKAKTLVWNGPLGVFEMSPFDQGTVTVARYVAERSQQGQLVSIAGGGDTVFAL 360

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            HAG++N+FTY+STAGGAFLEW+EGK LPGI+AL 
Sbjct: 361 NHAGVANDFTYLSTAGGAFLEWMEGKGLPGILALQ 395


>gi|86751566|ref|YP_488062.1| phosphoglycerate kinase [Rhodopseudomonas palustris HaA2]
 gi|86574594|gb|ABD09151.1| phosphoglycerate kinase [Rhodopseudomonas palustris HaA2]
          Length = 398

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/393 (50%), Positives = 271/393 (68%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R LLRVD NVP   GKV D TR++RV PTI E+  K  KV++ +H G
Sbjct: 5   FRTLDDV-DVKGQRVLLRVDLNVPMDSGKVTDTTRLDRVAPTITEIAGKGGKVILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + DK+ SL  V +    ++ K + F  DC+G   + +IA++ +G I+  EN RF+ 
Sbjct: 64  RPKGRDDKN-SLKPVAAALADVIKKPVGFAEDCVGEPAATAIAAMQDGDILCLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L+  GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  L   
Sbjct: 123 EEEKNDPTFVAKLAELGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELVALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG  VG+SLC++D
Sbjct: 183 LEAPTKPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGFKVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++   +I  +A+ ++C II+P D  VA   +   P+      ++P D++ILDVG +++E
Sbjct: 243 LAETALRIMNKAEAASCAIILPVDATVAYHFEANAPSFAYGLDAIPDDAMILDVGPRSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGP+G FE+ PFD+ TVE A + A+ TK   +IS+AGGGDT+ AL 
Sbjct: 303 RIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAARHAARRTKAGMLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 363 HAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|153008518|ref|YP_001369733.1| phosphoglycerate kinase [Ochrobactrum anthropi ATCC 49188]
 gi|151560406|gb|ABS13904.1| Phosphoglycerate kinase [Ochrobactrum anthropi ATCC 49188]
          Length = 401

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/395 (49%), Positives = 268/395 (67%), Gaps = 6/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  D++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKVV+ +H G
Sbjct: 3   FRTLDD-ADVKSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVVLLAHFG 61

Query: 64  RPQSKSDKDCSLFKVVS-----IAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           RP+  +  + SL  VV      +   I  +++ F  DCIG     ++ +L +G ++L EN
Sbjct: 62  RPKGVASDENSLKHVVKPLSKVLGPHISGRSVHFAEDCIGEHAKAAVDALKDGDVLLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF+  EE+NDP+FV  L+ NGD Y+NDAFS +HRAHAS  GL+H+LP+Y GR MQ EL 
Sbjct: 122 TRFHKGEEKNDPEFVAALAANGDLYVNDAFSAAHRAHASTEGLAHVLPAYAGRGMQAELE 181

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            LE       +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL AQG  VG+S
Sbjct: 182 ALEKGLGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAQGHDVGKS 241

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           LC+ + +    +I  +A+ + C II+P D VV        P +     +VP D +ILD G
Sbjct: 242 LCEHELAHTAREIMAKAETTKCAIILPVDAVVGWHFAADTPNKTYGVDAVPSDGMILDAG 301

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             + + I   I  A T++WNGPLG FE+ PFD ATV+ A +VA  TK  +++S+ GGGDT
Sbjct: 302 ALSTDLIASAIDDAATLVWNGPLGAFELRPFDTATVKTAKHVAARTKAGKLVSVGGGGDT 361

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           + AL HAG++++FTY+STAGGAFLEW+EGK LPG+
Sbjct: 362 VAALNHAGVADDFTYISTAGGAFLEWMEGKPLPGV 396


>gi|49476164|ref|YP_034205.1| phosphoglycerate kinase [Bartonella henselae str. Houston-1]
 gi|46576829|sp|Q8L1Z8|PGK_BARHE RecName: Full=Phosphoglycerate kinase
 gi|20465201|gb|AAL74285.1| phosphoglycerate kinase [Bartonella henselae str. Houston-1]
 gi|49238972|emb|CAF28270.1| Phosphoglycerate kinase [Bartonella henselae str. Houston-1]
          Length = 397

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/394 (49%), Positives = 286/394 (72%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+ G R L+RVD+NVP   GKV D TR++R   T+LEL ++ AK+++ SH G
Sbjct: 3   FRTLDDV-DVTGKRVLVRVDFNVPMAQGKVCDDTRLKRHKETLLELQKRGAKLILLSHCG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  VV + E I+++ + F +DCIG  +  ++ +L  GGI+L ENVRF+S
Sbjct: 62  RPKGQVEPEFSLHPVVQVLEKIINQPVNFASDCIGVAVQTAVEALQNGGILLLENVRFHS 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+N   F   L+ NGD Y+NDAFSVSHRAHAS+ G++H LPSY GR++Q EL  LE  
Sbjct: 122 GEEKNAGSFAEALAHNGDLYVNDAFSVSHRAHASVEGITHFLPSYAGRSLQCELQALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + ++P++AIVGG+KVS+K+ +L +LVKKVD LVIGGGMANSFL AQG+ VG+SLC+  
Sbjct: 182 LGKPERPVIAIVGGAKVSSKLFVLNHLVKKVDYLVIGGGMANSFLAAQGVCVGKSLCEHA 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             + V ++  +A+   C +++P D +V    +   P ++     +P D +ILDVG +++ 
Sbjct: 242 LIETVKKVIEKARECQCTLLLPVDAIVGFRFEKDAPHRLYDIGDIPEDGMILDVGTRSIA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
           +I  VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+L+   +++SIAGGGDT+ AL 
Sbjct: 302 HINAVIDKAATLVWNGPLGVFEMSPFDQGTIAVARHAAELSLTGKLVSIAGGGDTVFALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           HAG++++FTY+STAGGAFLEW+EGK LPGI+AL+
Sbjct: 362 HAGVADDFTYLSTAGGAFLEWMEGKMLPGILALT 395


>gi|91978773|ref|YP_571432.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisB5]
 gi|91685229|gb|ABE41531.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisB5]
          Length = 398

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/393 (49%), Positives = 273/393 (69%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R LLRVD NVP   GKV D TR+ERVVPTI E+  K  KV++ +H G
Sbjct: 5   FRTLDDV-DVKGKRVLLRVDLNVPMDAGKVTDATRLERVVPTITEIAGKGGKVILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + +K+ SL  V +    ++ K + F  DCIG   +++IA++ +G ++  EN RF+ 
Sbjct: 64  RPKGRDEKN-SLKPVAAALADVIKKPVAFAEDCIGEPAAKAIAAMQDGDVLCLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L+  GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ E+  L   
Sbjct: 123 EEEKNDPGFVAKLAELGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAEIVALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SLC++D
Sbjct: 183 LEAPTRPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++   +I  +A+ + C II+P D  VA   +   P+      ++P D++ILDVG +++E
Sbjct: 243 LAETALRILNKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPPDAMILDVGPRSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGP+G FE+ PFD+ TVE A + A+ TK   ++S+AGGGDT+ AL 
Sbjct: 303 RIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAARRTKAGSLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 363 HAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|49474688|ref|YP_032730.1| phosphoglycerate kinase [Bartonella quintana str. Toulouse]
 gi|81695988|sp|Q6FYN4|PGK_BARQU RecName: Full=Phosphoglycerate kinase
 gi|49240192|emb|CAF26658.1| Phosphoglycerate kinase [Bartonella quintana str. Toulouse]
          Length = 397

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/393 (49%), Positives = 281/393 (71%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+ G R L+RVD+NVP   GKV D TR++R   T+LEL ++ AK+++ SH G
Sbjct: 3   FRTLDDV-DVTGKRVLVRVDFNVPMSQGKVCDETRLKRHKETLLELQKRGAKLILLSHCG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  VV + E I+++ + F  DC+G     +I +L  GG++L ENVRF+ 
Sbjct: 62  RPKGQGEPEFSLRPVVRVLEKIINQPVAFAPDCVGVAAQTAIEALQNGGLLLLENVRFHP 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND  F   L+ NGD Y+NDAFSVSHRAHAS+ G++HLLPSY GR++Q EL  LE  
Sbjct: 122 GEEKNDCSFAEALAHNGDLYVNDAFSVSHRAHASVEGITHLLPSYAGRSLQCELQALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P+VA+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ +G+SLC+  
Sbjct: 182 LDNPKRPVVALVGGAKVSSKLFVLNHLVEKVDYLVIGGGMANSFLAAQGVHIGKSLCEHA 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
               + ++  +A+   C +++P D VV    + G P ++     +P D +ILD+G +++ 
Sbjct: 242 LMQTIKKVIEKAQEYQCTLLLPVDAVVGFRFEKGAPHRLYDIGDIPDDGMILDIGTRSIA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
           +I +VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+ +   + +SIAGGGDT+ AL 
Sbjct: 302 HINEVIDKAATLVWNGPLGVFEMSPFDQGTIAVARHAAECSLTGKCVSIAGGGDTVFALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++N+FTY+STAGGAFLEW+EGK LPGI AL
Sbjct: 362 HAGVANDFTYLSTAGGAFLEWMEGKVLPGIFAL 394


>gi|296446819|ref|ZP_06888757.1| Phosphoglycerate kinase [Methylosinus trichosporium OB3b]
 gi|296255694|gb|EFH02783.1| Phosphoglycerate kinase [Methylosinus trichosporium OB3b]
          Length = 397

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/396 (48%), Positives = 272/396 (68%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+   T+ D  D++G R LLRVD+NVP  +G V D TRI+RV+PTI E+  K  KV++ +
Sbjct: 1   MAAFNTL-DSADLKGKRVLLRVDFNVPMENGVVTDRTRIQRVLPTIEEISAKGGKVILLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +  +D SL  V +     LH+ + F  DC+G    ++I  L++G I+L EN R
Sbjct: 60  HFGRPKGERKEDESLRPVAAALAETLHRPVAFAEDCVGEPAREAIGKLADGDILLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP F+  +++ GD Y+N+AFS +HRAHA+  GL+H+LP+Y GR MQ EL  L
Sbjct: 120 FHKGEEKNDPAFIAEVAKLGDLYVNEAFSAAHRAHATTEGLAHVLPAYAGRTMQAELQAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  + P++A+VGG+K+STK+ LL NL+ KVD LVIGGGMAN+FL AQG  +G+SLC
Sbjct: 180 GQALDHPEHPVMAVVGGAKISTKLELLGNLIAKVDALVIGGGMANTFLAAQGKPIGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK + CEI++P D  VA++ +   P+ +VS   V    +ILD+G K
Sbjct: 240 EHDLLDKARAIMADAKAADCEIVLPVDATVAQKFEAHAPSHIVSVDHVGEADMILDLGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V +I+ ++ + +T++WNGPLG FE+ PFD  T  VA   A+LT E R++S+AGGGDT+ 
Sbjct: 300 SVAHIESLLEKTKTLVWNGPLGAFELPPFDEGTNAVAQTAARLTCEGRLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  A  + EFTY+STAGGAFLEWLEGK+LPG+ AL
Sbjct: 360 ALNQAHAAQEFTYLSTAGGAFLEWLEGKELPGVAAL 395


>gi|83309612|ref|YP_419876.1| phosphoglycerate kinase [Magnetospirillum magneticum AMB-1]
 gi|82944453|dbj|BAE49317.1| 3-phosphoglycerate kinase [Magnetospirillum magneticum AMB-1]
          Length = 435

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/393 (50%), Positives = 271/393 (68%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++ L D++G R L+R D NVP  DGKV D TRI+R   T+++L  K AKV++ +H G
Sbjct: 22  FRTIDKL-DVQGKRVLVRADLNVPAKDGKVTDTTRIDRSAATLIQLAAKGAKVIVLTHFG 80

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + DK      V  +A+++  K + + +DCIG  + + IAS+ +G I L ENVRF+ 
Sbjct: 81  RPKGREDKYSQKLLVEPLAKAV-GKAVAWADDCIGPDVEKLIASMKDGDIALLENVRFHP 139

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+  GD Y+NDAFS +HRAHAS  GL+HLLP+  GR MQ EL  L   
Sbjct: 140 EEEKNDPAFAKALAALGDAYVNDAFSTAHRAHASTEGLAHLLPAAAGRLMQAELEALGKA 199

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP+ AIVGG+KVSTK+ LL NLV KVD L+IGGGMAN+FL AQG  VG+SLC++D
Sbjct: 200 LEAPEKPVAAIVGGAKVSTKLDLLGNLVSKVDYLIIGGGMANTFLFAQGKQVGKSLCEKD 259

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D    I  +AK + C I++P D VVA E       +VVS  +VP D +ILD G  + E
Sbjct: 260 LADTARAILEKAKEAKCHIVLPVDAVVAGEFAENAANEVVSVDAVPADKMILDAGPASAE 319

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   +   +T++WNGPLG FEI PFD+AT  VA + A+ T + +++++ GGGDT++ALA
Sbjct: 320 AIIDRLGGCKTLVWNGPLGAFEIAPFDKATNAVAQWAAERTLQGKLLTVGGGGDTVSALA 379

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG+  +F+Y+STAGGAFLEWLEGK+LPG+ AL
Sbjct: 380 KAGVEEKFSYISTAGGAFLEWLEGKELPGVAAL 412


>gi|170746608|ref|YP_001752868.1| phosphoglycerate kinase [Methylobacterium radiotolerans JCM 2831]
 gi|259530782|sp|B1M787|PGK_METRJ RecName: Full=Phosphoglycerate kinase
 gi|170653130|gb|ACB22185.1| Phosphoglycerate kinase [Methylobacterium radiotolerans JCM 2831]
          Length = 400

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS  RT++D   ++G R L+RVD NVP   G+V D TRIERV PTI E+ E+ AKV++ +
Sbjct: 1   MSAFRTLDDAGSLKGKRVLMRVDLNVPMESGRVTDATRIERVAPTIREVAEQGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +   SL  VV    + L +++ F  DC+G   +Q++A+L +G ++L EN R
Sbjct: 61  HFGRPKGKREPKDSLEPVVPALGAALGRDVAFAADCVGDAAAQAVAALKDGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+ND  F   L+ NGD Y+N+AFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDAAFADALAANGDVYVNEAFSAAHRAHASTEGLAHRLPAYAGREMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P++A+VGG+KVS+KI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLESPQRPVIALVGGAKVSSKIDLLENLVAKVDMLVIGGGMANTFLHAQGKAVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   A+++ C II+P D V A E K   P + V   +VP  S+ILD G +
Sbjct: 241 EKDLAETATRILAAAEKAGCRIILPVDAVAASEFKARAPHETVPVDAVPDASMILDAGPR 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V  I   I  A+T++WNGPLG FE+ PFD ATV  A + A  TK+ +++S+AGGGDT+ 
Sbjct: 301 SVAEINAAIDGAKTLVWNGPLGAFELAPFDAATVATAKHAAARTKDGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +FTYVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 361 ALNHAGVGQDFTYVSTAGGAFLEWLEGKALPGVEAL 396


>gi|239787537|emb|CAX84006.1| Phosphoglycerate kinase [uncultured bacterium]
          Length = 421

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/398 (47%), Positives = 277/398 (69%), Gaps = 1/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS++RT++DL D++G R LLR D NVP  DG+V +  RI+R VPT++EL +K AKV+I S
Sbjct: 25  MSKIRTIDDL-DVKGKRVLLRADLNVPMKDGQVTNANRIDRTVPTVIELADKGAKVIILS 83

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + + + +L  V         + + F  DCIG    + + ++  G I + ENVR
Sbjct: 84  HLGRPKGEKNPEFTLKPVAEAFAKACGRPVAFGTDCIGPDAEKVVNAMKNGDIAMLENVR 143

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY +EE+ND DF + L+  GD  ++DAFS +HRAHAS+  ++ ++P+  GR MQ EL  L
Sbjct: 144 FYKQEEKNDADFAKKLAALGDILVSDAFSCAHRAHASVEAVARIIPAAAGRLMQAELEAL 203

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    + KKP+ A+VGG+K+STK+ +L NL++KVD L++GG MAN+FL+AQG+ VG+SL 
Sbjct: 204 EGALEKPKKPVAAVVGGAKISTKMDVLGNLIQKVDVLIVGGAMANTFLMAQGVKVGKSLV 263

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  DN   +  +AK++ C+I++P+D VVA E K G     V+  ++P D +ILDVG K
Sbjct: 264 EADMLDNARAVMEKAKKAGCDIVLPKDAVVASEFKEGAKATTVALDAIPADQMILDVGPK 323

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE + + +   +T++WNGPLG FE++PFD  T  VA + A LTK+  ++S+AGGGDT++
Sbjct: 324 SVEDLNKRLDGCKTLLWNGPLGAFEVKPFDTGTNAVAKHAADLTKKGSLLSVAGGGDTVS 383

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AL +AG   +F+YVSTAGGAFLEW+EGK LPG+  L G
Sbjct: 384 ALKNAGAQKQFSYVSTAGGAFLEWMEGKILPGVAVLRG 421


>gi|75676920|ref|YP_319341.1| phosphoglycerate kinase [Nitrobacter winogradskyi Nb-255]
 gi|74421790|gb|ABA05989.1| phosphoglycerate kinase [Nitrobacter winogradskyi Nb-255]
          Length = 398

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/393 (49%), Positives = 264/393 (67%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+RG R LLRVD NVP   G+V D TR+ERV PTI E+ +K  K ++ +H G
Sbjct: 5   FRTLDDV-DVRGKRVLLRVDLNVPMEQGRVTDATRLERVAPTITEIADKGGKAILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+  +D   SL  V      +L K + F +DC+G    Q++A++ +G I+  EN RF+ 
Sbjct: 64  RPKG-ADPKNSLRPVAEELAKVLGKPVAFADDCVGEPAQQAVAAMKDGDILCLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L+R GD ++NDAFS +HRAHAS  GL H LP Y GR MQ EL  L   
Sbjct: 123 EEEKNDPAFVAELARLGDIWVNDAFSAAHRAHASTEGLGHKLPGYAGRTMQAELEALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++A++GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL ++D
Sbjct: 183 LEAPTKPVIAVIGGAKVSTKIDLLENLVSKVDALVIGGGMANTFLHAQGVSIGKSLAEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D  VA       P+      ++P D +ILDVG ++VE
Sbjct: 243 LAATALRIMEKAEAANCAIILPVDATVAFHFAANTPSHAYGLDAIPADGMILDVGPQSVE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            ++  I  A T++WNGPLG FE+ PFDR TV  A + A+ TK  +++S+AGGGDT+ AL 
Sbjct: 303 RVRSAIDDAATLVWNGPLGAFELTPFDRGTVAAAKHAAERTKAGKLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A ++ +FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 363 QADVAGDFTYVSTAGGAFLEWMEGKPLPGVEVL 395


>gi|323135577|ref|ZP_08070660.1| Phosphoglycerate kinase [Methylocystis sp. ATCC 49242]
 gi|322398668|gb|EFY01187.1| Phosphoglycerate kinase [Methylocystis sp. ATCC 49242]
          Length = 398

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 274/396 (69%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++++ D++G R LLRVD NVP  + +V D TRIER++PTI E+ EK  KV++ S
Sbjct: 1   MASFRTLDNV-DVKGKRVLLRVDLNVPMEETRVTDATRIERILPTINEIAEKGGKVILLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL +V+   E  L + I F +DC+G+  S  + ++ +G I L EN R
Sbjct: 60  HFGRPKGQRVDEDSLRQVLPTLEHYLKRKIAFADDCVGAPASAVVDAMKDGDIALLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+NDP FV  +++ GD +++DAFS +HRAHA+  G++H LP+Y GR MQ EL  L
Sbjct: 120 FQKGEEKNDPAFVEEIAKLGDIFVHDAFSAAHRAHATTEGVAHRLPAYAGRTMQAELEAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ES  +   +P++AIVGG+KVSTK+ LL NLV KV  LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 180 ESSLTNPARPVMAIVGGAKVSTKLELLGNLVSKVQYLVIGGGMANTFLAAQGKAVGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D + +   I  +AK + C +++P D  VA++ +   P+ +VS   V  + +ILDVG K
Sbjct: 240 EHDLAGSARGILEKAKAANCVVVLPVDATVAQKFEEHAPSHIVSVDHVGENDMILDVGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV +++ ++AQ RT++WNGP G FE+ PFD  T  VA   A+LT E +++S+AGGGDT+ 
Sbjct: 300 TVAHVEALLAQCRTLVWNGPFGAFELPPFDEGTNAVAQTAARLTVEGKLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  A    EF+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 360 ALNQAHAGQEFSYVSTAGGAFLEWLEGKTLPGVAAL 395


>gi|209886424|ref|YP_002290281.1| phosphoglycerate kinase [Oligotropha carboxidovorans OM5]
 gi|209874620|gb|ACI94416.1| phosphoglycerate kinase [Oligotropha carboxidovorans OM5]
          Length = 399

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/395 (49%), Positives = 273/395 (69%), Gaps = 1/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           S  RT++D+ D+   R LLRVD NVP  +G+V+D TR+ R+  TI E+ EK  KV++ SH
Sbjct: 3   SLFRTLDDV-DVNDKRVLLRVDLNVPMDNGRVSDATRLTRITKTITEIAEKGGKVILLSH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+   +   SL  V      +L +++ FV+DC+G     +++ +  G II  EN RF
Sbjct: 62  FGRPKGVVNPKESLKPVAITLAYMLRRHVEFVDDCVGKKAEDAVSWMKPGDIICLENTRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE+NDP FV  L++ GD +INDAFS +HRAHAS  GL H+LP+Y GR+MQ EL  L 
Sbjct: 122 HKGEEKNDPAFVAELAKLGDIWINDAFSTAHRAHASTEGLGHVLPAYAGRSMQAELDALT 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                   P+ A++GG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+
Sbjct: 182 KALEAPTHPVAAVIGGAKVSTKLDLLENLVTKVDALVIGGGMANTFLHAQGVNVGKSLCE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           ++ +    +I  +A+ + C +I+P D V+ARE     P++     ++P D++ILDVG K+
Sbjct: 242 KELAPTALRILEKAEAAKCAVILPVDAVIAREFVAHAPSEACGLDAIPSDAMILDVGPKS 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V+ ++     A+TV+WNGPLG FE+ PFDR TV+ A + A LT+E ++IS+AGGGDT+ A
Sbjct: 302 VDRVRAAFDAAKTVVWNGPLGAFELSPFDRGTVQAARHAAGLTREGKLISVAGGGDTVAA 361

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG++++FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 362 LNHAGVASDFTYVSTAGGAFLEWMEGKPLPGVEVL 396


>gi|316932483|ref|YP_004107465.1| phosphoglycerate kinase [Rhodopseudomonas palustris DX-1]
 gi|315600197|gb|ADU42732.1| Phosphoglycerate kinase [Rhodopseudomonas palustris DX-1]
          Length = 398

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 274/393 (69%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R LLRVD NVP   GKV D TR++RV PTI E+  K  KV++ +H G
Sbjct: 5   FRTLDDV-DVKGQRVLLRVDLNVPMDSGKVTDTTRLQRVAPTITEIAGKGGKVILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + DK+ SL  V +    ++ K + F  DC+G   +++IA++++G I+  EN RF+ 
Sbjct: 64  RPKGRDDKN-SLRPVAAALADVIKKPVGFAEDCVGEPAAKAIAAMADGDILCLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L+  GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  L   
Sbjct: 123 EEEKNDPAFVEKLAELGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SLC++D
Sbjct: 183 LEAPAKPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++   +I  +A+ + C II+P D  VA   +   P+      ++P DS+ILDVG +++E
Sbjct: 243 LAETALRIMNKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPPDSMILDVGPRSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGP+G FE+ PFD+ TVE A + AK TK  +++S+AGGGDT+ AL 
Sbjct: 303 RIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAAKRTKAGKLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 363 HAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|148258134|ref|YP_001242719.1| phosphoglycerate kinase [Bradyrhizobium sp. BTAi1]
 gi|146410307|gb|ABQ38813.1| phosphoglycerate kinase [Bradyrhizobium sp. BTAi1]
          Length = 396

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/396 (49%), Positives = 272/396 (68%), Gaps = 2/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ RT++D+ D +G R LLRVD NVP  +G V D TR+ERV PTI E+  K  KV++ +
Sbjct: 1   MTKFRTLDDV-DPKGKRVLLRVDLNVPTENGHVTDTTRLERVAPTINEIATKGGKVILLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +  KD SL  V +   +++ + + F +DCIG   + +IA++ +G ++  EN R
Sbjct: 60  HFGRPKGRDPKD-SLKPVAAALSAVIKRPVAFADDCIGEPAATAIAAMKDGDVLCLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  L
Sbjct: 119 FHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       KP++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL 
Sbjct: 179 EKALGSPVKPVIAIVGGAKVSTKIDLLENLVTKVDALVIGGGMANTFLHAQGVQIGKSLA 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +    +I  +A+ S C II+P D  V+       P+      ++P DS+ILDVG +
Sbjct: 239 EKDLAATALRIMEKAEASNCAIILPVDATVSYHFAANSPSFAYGLDAIPPDSMILDVGPQ 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +   I   I  A T++WNGPLG FE+ PFDR T+  A + A+ TK +++IS+AGGGDT+ 
Sbjct: 299 STARIHAAIDDAATLVWNGPLGAFELTPFDRGTMVAAKHAAERTKAKKLISVAGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  AG++++F+YVSTAGGAFLEW+EGK LPG+  L
Sbjct: 359 ALNQAGVASDFSYVSTAGGAFLEWMEGKPLPGVEVL 394


>gi|39934020|ref|NP_946296.1| phosphoglycerate kinase [Rhodopseudomonas palustris CGA009]
 gi|50402242|sp|P62419|PGK_RHOPA RecName: Full=Phosphoglycerate kinase
 gi|39647867|emb|CAE26387.1| phosphoglycerate kinase [Rhodopseudomonas palustris CGA009]
          Length = 398

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 276/394 (70%), Gaps = 2/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R LLRVD NVP   GKV D TR+ERV+PTI EL  K AKV++ +H G
Sbjct: 5   FRTLDDV-DVKGKRVLLRVDLNVPMDAGKVTDTTRLERVMPTITELSGKGAKVILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + DK+ SL  V +    ++ K + F +DCIG   +++IA++++G I+  EN RF+ 
Sbjct: 64  RPKGRDDKN-SLKPVAAALADVIKKPVGFADDCIGEPAAKAIAAMADGDILCLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L+  GD ++NDAFS +HRAHA+  GL H LP+Y GR MQ EL  L   
Sbjct: 123 EEEKNDPAFVAKLAELGDIWVNDAFSAAHRAHATTEGLGHKLPAYAGRTMQAELVALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++AIVGG+KVSTKI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SLC++D
Sbjct: 183 LEAPVKPVIAIVGGAKVSTKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D  VA   +   P+      ++P D++ILDVG +++E
Sbjct: 243 LAPTALRILDKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPDDAMILDVGPRSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGP+G FE+ PFD+ TVE A + AK TK  +++S+AGGGDT+ AL 
Sbjct: 303 RIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAAKRTKAGKLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L 
Sbjct: 363 HAGVADDFTYISTAGGAFLEWMEGKPLPGVEVLQ 396


>gi|146338223|ref|YP_001203271.1| phosphoglycerate kinase [Bradyrhizobium sp. ORS278]
 gi|146191029|emb|CAL75034.1| phosphoglycerate kinase [Bradyrhizobium sp. ORS278]
          Length = 399

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 270/396 (68%), Gaps = 2/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ RT++D+ D +G R LLRVD NVP  +G V D TR+ERV PTI EL  K  KV++ +
Sbjct: 4   MTKFRTLDDV-DPKGKRVLLRVDLNVPMENGHVTDATRLERVAPTINELATKGGKVILLA 62

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +  KD SL  V      ++ + + F +DCIG   +++IA++ +G ++  EN R
Sbjct: 63  HFGRPKGRDAKD-SLKPVADALSKVIKRPVAFADDCIGEPAAKAIAAMKDGDVLCLENTR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  L
Sbjct: 122 FHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDAL 181

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +       KP++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL 
Sbjct: 182 DKALGRPAKPVIAIVGGAKVSTKIDLLENLVTKVDALVIGGGMANTFLHAQGVQIGKSLA 241

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +    +I  +A+ + C II+P D  V+       P+      ++P DS+ILDVG +
Sbjct: 242 EKDLAATALRIMEKAEAANCAIILPVDATVSYHFAANSPSFAYGLDAIPPDSMILDVGPQ 301

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +   I   I  A T++WNGPLG FE+ PFDR T+  A + A+ TK +++IS+AGGGDT+ 
Sbjct: 302 STARIHAAIDDAATLVWNGPLGAFELNPFDRGTMVAAKHAAERTKAKKLISVAGGGDTVA 361

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  AG++ +F+YVSTAGGAFLEW+EGK LPG+  L
Sbjct: 362 ALNQAGVAGDFSYVSTAGGAFLEWMEGKPLPGVEVL 397


>gi|319899385|ref|YP_004159482.1| phosphoglycerate kinase [Bartonella clarridgeiae 73]
 gi|319403353|emb|CBI76912.1| phosphoglycerate kinase [Bartonella clarridgeiae 73]
          Length = 407

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/395 (51%), Positives = 287/395 (72%), Gaps = 1/395 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             RT++D+ D+ G R L+RVD+NVP + GKV D TRIE    T++EL ++ AKV+I SH 
Sbjct: 12  EFRTLDDV-DVTGKRVLVRVDFNVPMLKGKVCDETRIECHKDTLVELQKRGAKVIILSHC 70

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + ++  VV   E I+ K I F NDCIG    +++  + +G I+L ENVRFY
Sbjct: 71  GRPKGQVVPEFTVRPVVETLEKIIKKPIFFANDCIGDAAQKAVNKVQDGEILLLENVRFY 130

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           S EE+N+  F + L++NGD Y+NDAFSVSHRAHASI G++HLLPSY GRA+Q+EL  L+ 
Sbjct: 131 SGEEKNEHSFAKALAQNGDLYVNDAFSVSHRAHASIEGITHLLPSYAGRALQRELQALKK 190

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                  P+VA+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC+ 
Sbjct: 191 GLDHPTHPVVAVVGGAKVSSKLFVLNHLVEKVDYLVIGGGMANSFLAAQGVSVGKSLCEE 250

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                + +I  +A +S C++++P DVVV    +   P Q  + + +P   +ILD+G +++
Sbjct: 251 TLMGTIKEIIEKAYQSHCKLLLPLDVVVGFHFEKETPHQCYALEEIPEKGMILDIGPRSI 310

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
            +I+  I +A+T++WNGPLGVFE+ PFD+ TV VA YVA+ ++ R+++SIAGGGDT+ AL
Sbjct: 311 AHIQAAIDKAKTLVWNGPLGVFEMSPFDQGTVTVARYVAERSQRRQLVSIAGGGDTVFAL 370

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            HAG++N+FTY+STAGGAFLEW+EGK LPGI AL 
Sbjct: 371 NHAGVANDFTYLSTAGGAFLEWMEGKSLPGIFALQ 405


>gi|92118993|ref|YP_578722.1| phosphoglycerate kinase [Nitrobacter hamburgensis X14]
 gi|91801887|gb|ABE64262.1| phosphoglycerate kinase [Nitrobacter hamburgensis X14]
          Length = 398

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/393 (49%), Positives = 266/393 (67%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R LLRVD NVP   G+V D TR+ERV PTI E+  K  K ++ +H G
Sbjct: 5   FRTLDDV-DVKGKRVLLRVDLNVPMEQGRVTDTTRLERVAPTITEIAGKGGKAILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +  KD SL  V +    +L + + F +DCIG    +++A++ +G I+  EN RF+ 
Sbjct: 64  RPKGRDAKD-SLRPVATELAKVLGRPVAFADDCIGDAAEKAVAAMKDGDILCLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP Y GR MQ EL  L   
Sbjct: 123 EEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPGYAGRTMQAELEALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++AI+GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ VG+SL ++D
Sbjct: 183 LEAPTKPVIAIIGGAKVSTKIDLLENLVSKVDALVIGGGMANTFLHAQGVNVGKSLAEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +AK + C II+P D  VA       P+      ++P + +ILDVG ++VE
Sbjct: 243 LAATALRILDKAKAANCTIILPVDATVAFHFAANAPSHAYGLDAIPAEGMILDVGPQSVE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            ++  I  A T++WNGPLG FE+ PFDR TV  A + A+ TK  +++S+AGGGDT+ AL 
Sbjct: 303 RVRSAIDDAATLVWNGPLGAFELSPFDRGTVVAAKHAAERTKTGKLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++ +F+YVSTAGGAFLEW+EGK LPG+  L
Sbjct: 363 QAGVAGDFSYVSTAGGAFLEWMEGKPLPGVEVL 395


>gi|192289440|ref|YP_001990045.1| phosphoglycerate kinase [Rhodopseudomonas palustris TIE-1]
 gi|192283189|gb|ACE99569.1| Phosphoglycerate kinase [Rhodopseudomonas palustris TIE-1]
          Length = 398

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/394 (50%), Positives = 276/394 (70%), Gaps = 2/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D++G R LLRVD NVP   GKV D TR+ERV+PTI EL  K AKV++ +H G
Sbjct: 5   FRTLDDV-DVKGKRVLLRVDLNVPMDAGKVTDTTRLERVMPTITELSGKGAKVILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + DK+ SL  V +    ++ K + F +DCIG   +++IA++++G I+  EN RF+ 
Sbjct: 64  RPKGRDDKN-SLKPVAAALADVIKKPVGFADDCIGEPAAKAIAAMADGDILCLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L+  GD ++NDAFS +HRAHA+  GL H LP+Y GR MQ EL  L   
Sbjct: 123 EEEKNDPAFVAKLAELGDIWVNDAFSAAHRAHATTEGLGHKLPAYAGRTMQAELVALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++AIVGG+KVSTKI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SLC++D
Sbjct: 183 LEAPVKPVIAIVGGAKVSTKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D  VA   +   P+      ++P D++ILDVG +++E
Sbjct: 243 LAPTALRILDKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPDDAMILDVGPRSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGP+G FE+ PFD+ TVE A + AK T+  +++S+AGGGDT+ AL 
Sbjct: 303 RIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAAKRTRAGKLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           HAG++++FTY+STAGGAFLEW+EGK LPG+  L 
Sbjct: 363 HAGVADDFTYISTAGGAFLEWMEGKPLPGVEVLQ 396


>gi|296283932|ref|ZP_06861930.1| phosphoglycerate kinase [Citromicrobium bathyomarinum JL354]
          Length = 402

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/398 (49%), Positives = 271/398 (68%), Gaps = 2/398 (0%)

Query: 1   MSRLRTMNDL-RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+  +T++DL  D+ G   L+RVD N+P  DG   DVTR+E V PTILEL ++ AKV++ 
Sbjct: 1   MANFKTLDDLPADLSGKVALVRVDLNLPMKDGSATDVTRVEAVRPTILELCDRGAKVLLL 60

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+ + +   S   V      +L K ++F+++  G T+ QSI  L  G I L EN 
Sbjct: 61  AHFGRPKGERNSTMSTSYVQGDVADVLGKELMFISEVSGPTVDQSIGILRNGDIGLLENT 120

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF++ EE NDPDF + ++ +GDFY+NDAFS +HRAHAS  GL+HLLP+Y GRAM+ EL  
Sbjct: 121 RFWAGEEANDPDFAKAIAAHGDFYVNDAFSAAHRAHASTEGLAHLLPAYAGRAMEAELKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L++     + P+ A+VGG+KVSTK+ +L NLV KV  L+IGGGMAN+FL A+G  VG+SL
Sbjct: 181 LDAALGNPETPVAAVVGGAKVSTKLDVLENLVGKVQHLIIGGGMANTFLAARGADVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVG 298
           C+ D  D  + I  EA  + C + +P DVVVA E     P+ +  +   V  D +ILD+G
Sbjct: 241 CEHDLVDKANAIMDEADHAGCTVHLPYDVVVATEFAANPPSLRTSNVHEVAADEMILDIG 300

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +  E +  V+   +T++WNGPLG FE EPFD+ATV +A   A LTKE  ++S+AGGGDT
Sbjct: 301 PQATEALADVLKTCKTLVWNGPLGAFETEPFDQATVSLARTAAALTKEGSLVSVAGGGDT 360

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + AL  AG++++F+YVSTAGGAFLEW+EGK LPG+ AL
Sbjct: 361 VAALNVAGVADDFSYVSTAGGAFLEWMEGKTLPGVAAL 398


>gi|85708460|ref|ZP_01039526.1| phosphoglycerate kinase [Erythrobacter sp. NAP1]
 gi|85689994|gb|EAQ29997.1| phosphoglycerate kinase [Erythrobacter sp. NAP1]
          Length = 402

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/397 (48%), Positives = 270/397 (68%), Gaps = 1/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL D+ G   L+RVD N+P  DG   D+TR+E V PTILEL +K AKV++ +
Sbjct: 1   MTAFKTLDDLGDVTGKVALVRVDLNLPMKDGSATDLTRVEAVKPTILELADKGAKVLLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +     S   VV   E +L K ++F+ +  G  + QSI  L  G I L +N R
Sbjct: 61  HFGRPKGQRSSVLSTSMVVGDVEKVLDKELMFIPEVHGPVVEQSIGILRNGDIGLLDNTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE NDP+F + ++ +GDFY+NDAFS +HRAHAS  G++H LPSY GRAM++EL  L
Sbjct: 121 FWPGEEGNDPNFAQAIAAHGDFYVNDAFSAAHRAHASTEGITHFLPSYAGRAMERELKAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ++     + P+ A+VGG+KVSTK+ +L NLV +V  L+IGGGMAN+FL A+G+ VG+SLC
Sbjct: 181 DAALGNPEAPVAAVVGGAKVSTKLAVLENLVGRVQHLIIGGGMANTFLAARGVDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGF 299
           + D +D   +I  EA  S C + +P DVVVA+E      + +  +   V  D +ILD+G 
Sbjct: 241 EHDLTDTASKIMDEADHSGCTVHLPYDVVVAQEFAANPASLRTCNVHEVSSDEMILDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +  E +  V+   RT++WNGPLG FE EPFD ATV +A + A LT+E  + S+AGGGDT+
Sbjct: 301 QATEALADVLKTCRTLVWNGPLGAFETEPFDTATVALARHAAALTQEGSLTSVAGGGDTV 360

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            ALA AG++ + TY+STAGGAFLEW+EGK+LPG+ AL
Sbjct: 361 AALAQAGVTEDVTYISTAGGAFLEWMEGKELPGVAAL 397


>gi|114326976|ref|YP_744133.1| phosphoglycerate kinase [Granulibacter bethesdensis CGDNIH1]
 gi|122328040|sp|Q0BVE2|PGK_GRABC RecName: Full=Phosphoglycerate kinase
 gi|114315150|gb|ABI61210.1| phosphoglycerate kinase [Granulibacter bethesdensis CGDNIH1]
          Length = 396

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/393 (48%), Positives = 273/393 (69%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++ L D+RG R L+R+D NVP  DG+V+D+TRIER  PT+ EL E  A+V++ SH  
Sbjct: 3   FRTLDGL-DVRGRRVLVRLDLNVPMRDGRVSDLTRIERQAPTVRELAEGGARVIVMSHFD 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K  ++ SL  +     + L + + FV+DCIG T+ +++A + +G +++ EN RF++
Sbjct: 62  RPKGKRVQEMSLRPIAEALGAALGQPVAFVDDCIGGTVEEAVAGMKDGDVLVLENTRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+F R+L+   + Y+NDAFS +HRAHAS  G++  LP+Y GR MQ+E+  LE  
Sbjct: 122 AEEKNDPEFSRLLASLAEVYVNDAFSAAHRAHASTHGVTAHLPAYAGRLMQREVEALELA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+ AIVGG+KVSTK+ LL NL  KVD LVIGG MAN+FL AQG+ VG+SL + +
Sbjct: 182 LGSPTRPVAAIVGGAKVSTKLDLLGNLSTKVDVLVIGGAMANTFLAAQGIKVGKSLQEAE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    I   AK++ CEI++P D V A E +   PT+ VS   +P D+++LDVG +TV 
Sbjct: 242 MHDTARAILETAKKAGCEILLPVDAVTATEFRADPPTRTVSINEIPDDAMMLDVGPETVR 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + + ++  +T++WNGPLG FEI PFD+ATV +A  VA LT+   ++S+AGGGDT+ AL 
Sbjct: 302 LLTERLSGVKTLVWNGPLGAFEISPFDKATVALAQSVAGLTETAGLVSVAGGGDTVAALK 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG+    TYVS AGGAFLEW+EGK+LPG+  L
Sbjct: 362 HAGVVERLTYVSAAGGAFLEWMEGKELPGVAVL 394


>gi|163869158|ref|YP_001610405.1| phosphoglycerate kinase [Bartonella tribocorum CIP 105476]
 gi|189036808|sp|A9IYR6|PGK_BART1 RecName: Full=Phosphoglycerate kinase
 gi|161018852|emb|CAK02410.1| phosphoglycerate kinase [Bartonella tribocorum CIP 105476]
          Length = 397

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 283/393 (72%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+ G R L+RVD+NVP   GKV D TR+ R   T++EL ++ AK+++ SH G
Sbjct: 3   FRTLDDV-DVLGKRVLVRVDFNVPMALGKVCDETRLVRHKETLVELQKRGAKLILLSHCG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  VVS+ E I+++ + F  DCIGST+  ++ +L  G ++L ENVRFY+
Sbjct: 62  RPKGKIEPEFSLRPVVSVLEKIINQPVAFAPDCIGSTVQVAVEALQNGDVLLLENVRFYA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND  F   L+ NGD Y+NDAFSVSHRAHAS+ G++ LLPSY GR++Q EL  LE  
Sbjct: 122 GEEKNDCSFAGALAHNGDLYVNDAFSVSHRAHASVEGITRLLPSYAGRSLQGELQALEKG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+VA+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC+  
Sbjct: 182 LGNPTRPVVALVGGAKVSSKLFVLNHLVEKVDTLVIGGGMANSFLAAQGIHVGKSLCEHT 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             + V +I  +A+   C +++P DVVV    +   P ++     +P + +ILD+G +++ 
Sbjct: 242 LMETVKKIIKKAQECHCTLLLPVDVVVGFRFEKDAPHRLYDIGDIPEEGMILDIGTRSIV 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
           +I  VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+ +   R++SIAGGGDT+ AL 
Sbjct: 302 HINSVIDKAATLVWNGPLGVFEMPPFDKGTIAVARHAAERSLTGRLVSIAGGGDTVFALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HA ++N+FTY+STAGGAFLEW+EGK LPGI+AL
Sbjct: 362 HADVANDFTYLSTAGGAFLEWMEGKVLPGILAL 394


>gi|85714405|ref|ZP_01045393.1| phosphoglycerate kinase [Nitrobacter sp. Nb-311A]
 gi|85698852|gb|EAQ36721.1| phosphoglycerate kinase [Nitrobacter sp. Nb-311A]
          Length = 398

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 265/393 (67%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+RG R LLRVD NVP   G+V D TR+ERV PTI E+ +K  K ++ +H G
Sbjct: 5   FRTLDDV-DVRGKRVLLRVDLNVPMEQGRVTDATRLERVAPTIKEIADKGGKAILLAHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+    K+ SL  V +    +L K + F +DC+G +  ++I+ + +G I+  EN RF+ 
Sbjct: 64  RPKGPDPKN-SLRPVAAELAKVLGKPVAFADDCVGESAQKAISEMKDGDILCLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP Y GR MQ EL  L   
Sbjct: 123 EEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPGYAGRTMQAELEALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP++A++GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL ++D
Sbjct: 183 LEAPTKPVIAVIGGAKVSTKIDLLENLVNKVDALVIGGGMANTFLHAQGVNIGKSLAEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D  VA       P+      ++P + +ILDVG ++VE
Sbjct: 243 LAATALRIMEKAEAANCAIILPVDATVAFHFAANAPSHAYGLDAIPAEGMILDVGPQSVE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   I  A T++WNGPLG FE+ PFDR TV  A + A+ TK  +++S+AGGGDT+ AL 
Sbjct: 303 RVHSAIDDAATLVWNGPLGAFELSPFDRGTVVAAKHAAERTKAGKLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++ +FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 363 QAGVAGDFTYVSTAGGAFLEWMEGKPLPGVEVL 395


>gi|300023140|ref|YP_003755751.1| phosphoglycerate kinase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524961|gb|ADJ23430.1| Phosphoglycerate kinase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 398

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/397 (48%), Positives = 275/397 (69%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           + +L+T + + D+ G R ++R D NVP  +GKV D TR+ERVVP +  L ++ AKV++ S
Sbjct: 3   LDKLKTTDGI-DVAGKRVIVRADLNVPIKNGKVTDATRLERVVPGLKALSDRGAKVIVIS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+   D + SL  V    + +L + + F  D IG+    ++ SLS G I + EN+R
Sbjct: 62  HFGRPKG-VDPELSLRPVAQTLQDLLGRPVKFGEDSIGAAAEAAVQSLSNGDIAVLENLR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP+F   L++ GD ++ DAFS SHRAHAS  G++H LPSY G  + +E++ L
Sbjct: 121 FHKGEEKNDPEFASALAKLGDVFVGDAFSCSHRAHASTEGITHHLPSYAGPLLMEEINAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +   + ++P  A+VGG+KVSTKI +L NLV KVDKL+IGGGMAN+FL A G  VG+SL 
Sbjct: 181 RTALEKPQRPTAALVGGAKVSTKIPVLTNLVAKVDKLIIGGGMANTFLQAAGTNVGKSLA 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +F++   +I  +AK   CEI++P D V+ARE K G  ++VV+   VP D++ILDVG K
Sbjct: 241 EPEFAETAREILAKAKEKGCEIVLPVDAVIAREFKEGAASEVVAIDDVPADAMILDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V ++  V+A  +T++WNGP+G FEI PF   T  VA   A LTK  +++S+AGGGDT+ 
Sbjct: 301 SVAHVTDVLAGTKTLLWNGPMGAFEISPFGDGTFAVARAAASLTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL  A +++EFTYVSTAGGAFLEWLEG++LPGI AL+
Sbjct: 361 ALNAANVTDEFTYVSTAGGAFLEWLEGRELPGIAALA 397


>gi|16127479|ref|NP_422043.1| phosphoglycerate kinase [Caulobacter crescentus CB15]
 gi|221236294|ref|YP_002518731.1| phosphoglycerate kinase [Caulobacter crescentus NA1000]
 gi|24418596|sp|Q9A3F5|PGK_CAUCR RecName: Full=Phosphoglycerate kinase
 gi|254782194|sp|B8H4J9|PGK_CAUCN RecName: Full=Phosphoglycerate kinase
 gi|13424937|gb|AAK25211.1| phosphoglycerate kinase [Caulobacter crescentus CB15]
 gi|220965467|gb|ACL96823.1| phosphoglycerate kinase [Caulobacter crescentus NA1000]
          Length = 396

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/393 (50%), Positives = 276/393 (70%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT+ D  D+ G R L+RVD+NVP   GKVAD TR++  +PTI  L +K AKVV+ +H  
Sbjct: 3   FRTL-DTADLAGKRALVRVDFNVPVDGGKVADDTRLKAALPTIRFLADKGAKVVLLAHFD 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V     ++L   + FV DC+G   ++ +  L++GG+ L ENVRF++
Sbjct: 62  RPKGKVVPEMSLAFVAEPLAALLGAPVAFVGDCVGPAAAEVVNGLADGGVALLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND +F + L+ NGD Y+NDAFS +HRAHAS  GL+ LLP+Y G +MQ+EL  L++ 
Sbjct: 122 GEEKNDAEFAKALAANGDVYVNDAFSAAHRAHASTEGLAKLLPAYPGVSMQRELEALDAA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               KKP++ IVGGSKVSTK+ LL NLV K+D+L IGGGMAN+FL AQG  VG SLC++D
Sbjct: 182 LGNPKKPVIGIVGGSKVSTKLDLLNNLVAKLDRLAIGGGMANTFLFAQGHDVGGSLCEKD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + CE+++P DVVVA+++  G+ T V S   V  D +ILD G ++ +
Sbjct: 242 LADTAREIMEKAKAAGCELLLPVDVVVAKKVAPGVETAVRSLSEVQADDLILDAGPESAK 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   + Q+ T++WNGPLGVFE+ PFD ATV  A + A L K  +I+++AGGGDT+ AL 
Sbjct: 302 RLLAAMDQSLTLIWNGPLGVFEVPPFDEATVSAAKHAASLAKSGKIVAVAGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG+S +FT+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 362 HAGVSADFTFVSTAGGAFLEWMEGKTLPGVAAL 394


>gi|121602281|ref|YP_988478.1| phosphoglycerate kinase [Bartonella bacilliformis KC583]
 gi|166985733|sp|A1UR75|PGK_BARBK RecName: Full=Phosphoglycerate kinase
 gi|120614458|gb|ABM45059.1| phosphoglycerate kinase [Bartonella bacilliformis KC583]
          Length = 400

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 274/394 (69%), Gaps = 1/394 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           + RT+N+  ++ G R L+RVD+NVP   GKV D TR+ER   TI  L ++ AK+++ SH 
Sbjct: 2   KFRTINE-ANVSGKRVLVRVDFNVPMSQGKVCDNTRLERHKETICALQKRGAKIILLSHC 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
            RP+ K   + SL  V    E+I+ + I FV +CIG+ +  ++ +L EG I+L EN+RFY
Sbjct: 61  SRPRGKIVPELSLRPVAKALETIMGQQIFFVEECIGAPVQTAVEALQEGQILLLENLRFY 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EEE N+ DF   L++ GD Y+NDAFSVSHRAHAS+  ++H LPSY G A+Q+EL  LE 
Sbjct: 121 KEEEDNNADFAEALAQQGDLYVNDAFSVSHRAHASVEAITHYLPSYAGMALQRELQALEK 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                KKP+ AIVGG+KVS+K+ +L +LV KVD LVIGGGMAN+FL+AQG  VG+SLC+ 
Sbjct: 181 GLDNPKKPVTAIVGGAKVSSKLFVLNHLVTKVDYLVIGGGMANNFLMAQGHNVGKSLCEP 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              D V  +  +A+ S C +++P D VV  + +TG P      +++P + +ILD+G  ++
Sbjct: 241 MLMDMVKDVIEKARESHCTLVLPVDAVVGLQCETGTPHHHCMIEAIPDEGMILDIGEHSI 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             I  VI  + T++WNGPLGVFE+ PFD  T+ VA Y A  +++   +SIAGGGDT+ AL
Sbjct: 301 ARINTVIDASATLVWNGPLGVFEVSPFDHGTIAVARYAAARSQKGHCVSIAGGGDTVFAL 360

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG++++FTY+STAGGAFLEW+EGK LPG++AL
Sbjct: 361 NHAGVADDFTYLSTAGGAFLEWMEGKTLPGVLAL 394


>gi|99080925|ref|YP_613079.1| phosphoglycerate kinase [Ruegeria sp. TM1040]
 gi|123252432|sp|Q1GHP9|PGK_SILST RecName: Full=Phosphoglycerate kinase
 gi|99037205|gb|ABF63817.1| phosphoglycerate kinase [Ruegeria sp. TM1040]
          Length = 396

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/392 (50%), Positives = 264/392 (67%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D++G   L RVD NVP  DGKV D TRI R+VPTI +L+ K AK V+ +H GR
Sbjct: 4   KTLDDM-DLQGKSVLTRVDINVPMEDGKVTDDTRIRRLVPTISDLLSKGAKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   + SL  +V   E+     ++FV DC G     ++ +L+ G I+L EN RFY  
Sbjct: 63  PKGKVVPEMSLQPLVPALEAAFGAPVMFVADCRGPAAKGAVDALAPGQILLLENTRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND D  + ++  GD Y NDAFS +HRAHAS   L+ LLP+  GR M+ EL  LE   
Sbjct: 123 EEQNDADLAKEMAALGDIYCNDAFSAAHRAHASTEALARLLPACAGRLMEAELKALEGSL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +  ++P+ A+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+ D 
Sbjct: 183 ATPERPVTAVVGGAKVSTKLDLLGNLVAKVDTLVIGGGMANTFLAAQGIDVGKSLCEHDM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +     I   A+ + C I++P DVVVARE K G   + V A + P D++ILD G  +V  
Sbjct: 243 TGTAKDIMARAEAAGCTILLPSDVVVAREFKAGADNETVPADACPADAMILDAGPASVAA 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I  V A+++T++WNGPLG FEI PFD AT   A   A+LTK  ++IS+AGGGDT+ AL  
Sbjct: 303 ISTVFAESKTLIWNGPLGAFEIAPFDIATNTAAQKAAELTKAGQLISVAGGGDTVAALNQ 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG +  F+Y+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 AGAAEAFSYISTAGGAFLEWMEGKVLPGVAAL 394


>gi|126728747|ref|ZP_01744562.1| phosphoglycerate kinase [Sagittula stellata E-37]
 gi|126710677|gb|EBA09728.1| phosphoglycerate kinase [Sagittula stellata E-37]
          Length = 405

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 272/392 (69%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L RVD NVP  DGKV D TRI+R+  TI +++ +  K V+ +H GR
Sbjct: 4   KTLDDM-DLDGKRVLTRVDINVPVEDGKVTDTTRIDRICATIQDILARGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   D SL  ++   E +L   ++F  DC+G      I +L E  + L EN RF+  
Sbjct: 63  PKGERRDDMSLQMLIPAMEQVLGVEVVFAADCVGPVAQAVIDTLGENQVALLENTRFHKG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+    ++  GD Y NDAFS +HRAHAS  G++HLLPS  GR MQ EL  LES  
Sbjct: 123 EEKNDPELAAQMAELGDVYCNDAFSAAHRAHASTEGVAHLLPSCAGRLMQGELQALESAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P++A+VGG+KVSTK+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG+SLC+ D 
Sbjct: 183 STPERPVLAVVGGAKVSTKLDLLSNLVEKVDMLVIGGGMANTFLAAQGIDVGKSLCEHDM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +     IA +A  + CE+++PRDVVVARE K G  ++VV  +  P D++ILD G  +V +
Sbjct: 243 TGTAKAIAEKAVETGCELLLPRDVVVAREFKEGAESEVVKTEECPADAMILDAGPDSVAH 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           IKQ I +A T++WNGPLG FEI PFD AT   A + A  ++  +++S+AGGGDT+ AL  
Sbjct: 303 IKQAIDRANTLIWNGPLGAFEIAPFDAATNAAARHAAARSEVGQLVSVAGGGDTVAALNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++++F+Y+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 AGVASDFSYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|1730525|sp|P50314|PGK_XANFL RecName: Full=Phosphoglycerate kinase
 gi|475713|gb|AAA62185.1| phosphoglycerate kinase [Xanthobacter flavus]
          Length = 397

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 267/396 (67%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   RT++D  D+   R L+RVD NVP   G+V D TR++ ++PTI ++  K  K V+ +
Sbjct: 1   MIAFRTLDDAVDLADKRVLVRVDLNVPMESGRVTDATRLKAILPTIRDITGKGGKAVLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + D+  SL  V    E  L + + F +DCIG     +++ L+ G +I+ EN R
Sbjct: 61  HLGRPKGR-DESQSLAPVAKALEGELGRKVAFASDCIGDEAKSAVSRLASGEVIVLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+N PDF+  L+  GD Y+NDAFS +HRAHAS  GL+  LP+Y GR+M+ E+  L
Sbjct: 120 FHAGEEKNAPDFIEALASLGDIYVNDAFSTAHRAHASTEGLARKLPAYAGRSMESEIEAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P++A+VGGSKVS+K+ LL NLVKKVD LVIGGGMAN+FL A G  VG+SLC
Sbjct: 180 TKALEAPQRPVLAVVGGSKVSSKLELLGNLVKKVDILVIGGGMANTFLAALGKKVGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++    I  +A+ + CEI++P D VVA E K     +V S   V  D ++LD G +
Sbjct: 240 EHDLANTARDILKKAEAAGCEIVLPVDAVVATEFKANAAHRVTSVDDVKDDEMMLDAGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  +KQ +  A+TV+WNGP G FE+ PFD ATV VA YV  LT + R++S+AGGGDT+ 
Sbjct: 300 TVGIVKQKLDGAKTVVWNGPFGAFEMTPFDAATVAVARYVGDLTHKGRLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG +  F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 360 ALNHAGTAERFSYVSTAGGAFLEWLEGKALPGVEAL 395


>gi|154247005|ref|YP_001417963.1| phosphoglycerate kinase [Xanthobacter autotrophicus Py2]
 gi|259530840|sp|A7IJW3|PGK_XANP2 RecName: Full=Phosphoglycerate kinase
 gi|154161090|gb|ABS68306.1| Phosphoglycerate kinase [Xanthobacter autotrophicus Py2]
          Length = 396

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 269/396 (67%), Gaps = 2/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D  D+   R L+RVD NVP   G+V D TR++ ++PTI  + +K  K V+ +
Sbjct: 1   MTAFRTLDDA-DLADKRVLVRVDLNVPMESGRVTDETRLKAILPTIRTITDKGGKAVLLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ + D+  SL  V    E  L + + F +DC+G   S +I+ L+ G +I+ EN R
Sbjct: 60  HFGRPKGR-DESQSLAPVAKALEGQLGRKVAFASDCVGEEASSAISRLAAGEVIVLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+N PDFV  L+  GD Y+NDAFS +HRAHAS  GL+  LP+Y GR+M+ EL+ L
Sbjct: 119 FHAGEEKNAPDFVEALASLGDIYVNDAFSAAHRAHASTEGLARKLPAYAGRSMESELAAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++A+VGGSKVS+K+ LL NLVKKVD LVI GGMAN+FL A G  VG+SLC
Sbjct: 179 TKALEAPVRPVLAVVGGSKVSSKLELLGNLVKKVDILVIAGGMANTFLAALGKKVGKSLC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +D   +I  +AK + CEI++P D VVA+E K     +VVS   V  D +ILD G +
Sbjct: 239 EHDLADTAREILEKAKAAGCEIVLPVDAVVAKEFKANAANRVVSVDEVGDDEMILDAGPE 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  + Q +  A+TV+WNGP G FE+ PFD ATV VA  V K T+   ++S+AGGGDT+ 
Sbjct: 299 TVAVVAQKLDGAKTVVWNGPFGAFEMTPFDAATVAVARDVGKRTRAGTLLSVAGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++ +F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 359 ALNHAGVAGDFSYVSTAGGAFLEWLEGKALPGVEAL 394


>gi|114705100|ref|ZP_01438008.1| phosphoglycerate kinase [Fulvimarina pelagi HTCC2506]
 gi|114539885|gb|EAU43005.1| phosphoglycerate kinase [Fulvimarina pelagi HTCC2506]
          Length = 398

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/394 (48%), Positives = 275/394 (69%), Gaps = 1/394 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           + RT++D  D+ G R L+RVD+N+P  DGKV D TRI+R +PTI EL +K A+V++ +H 
Sbjct: 4   QFRTIDD-ADVTGKRVLVRVDFNLPMKDGKVTDATRIDRALPTIAELADKGARVILLAHF 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K + + SL  +  +    L K + F +DCIG   +  I  L +G ++L EN RF+
Sbjct: 63  GRPKGKPNPEMSLKPIAPVLSDRLGKPVGFADDCIGPVAAGIIEMLKDGDVVLLENTRFH 122

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           + EE N+ +F   L+  GD Y+NDAFS +HRAH S  G++H LPSY GR MQ E+  L++
Sbjct: 123 AGEEANEAEFAESLASLGDIYVNDAFSAAHRAHGSTEGIAHHLPSYAGRTMQAEIEALQA 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                +KP+VAIVGGSKVSTKI +L NL+ +VD LVIGGGMAN+FL A+G+ +G+SLC+ 
Sbjct: 183 GLEAPEKPVVAIVGGSKVSTKIDVLTNLLDRVDYLVIGGGMANTFLAAKGVDIGKSLCEH 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D +D    +   A+   CEI++P D VVAR +++G PT+ V  +  P D +ILD G  ++
Sbjct: 243 DLADTARSVMSRAEEKGCEILLPTDAVVARHLRSGAPTETVPVEETPEDMMILDAGPLSL 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + +   +  A+T++WNGPLG FE+EPFD ATV  A + A+LT+  +++SIAGGGDT+ AL
Sbjct: 303 KAVVARLDLAKTLVWNGPLGAFEVEPFDEATVGAARHAAELTRAGKLVSIAGGGDTVAAL 362

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             AG+S++F+Y+STAGGAFLEW+EGK LPG+  L
Sbjct: 363 NQAGVSDDFSYISTAGGAFLEWMEGKALPGVEVL 396


>gi|163796403|ref|ZP_02190363.1| Phosphoglycerate kinase [alpha proteobacterium BAL199]
 gi|159178253|gb|EDP62797.1| Phosphoglycerate kinase [alpha proteobacterium BAL199]
          Length = 397

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 271/396 (68%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++ + ++ GLR L+R+D NVP  DG+V D TRIER  PT+ EL EK AKVV+ S
Sbjct: 1   MAAFRTLDQV-EVAGLRVLVRLDLNVPMKDGRVTDATRIERAAPTVKELAEKGAKVVVVS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  +     + + + + F +DCIG + + ++  L++GG+ L EN+R
Sbjct: 60  HYGRPKGKPDPTMSLKPLADPLAAAVGRPVAFADDCIGPSATATVGDLADGGVALLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE NDP+F   L+   D Y+NDAFS +HRAHASI G++ L P+Y GR MQ EL  L
Sbjct: 120 FHAGEEANDPEFAAALANLCDLYVNDAFSAAHRAHASIDGVARLRPAYAGRLMQTELDAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P+ A+VGG+KVSTK+ LL NLV++VD L IGGGMAN+FL AQG+ VG SL 
Sbjct: 180 GRALESPTRPVAAVVGGAKVSTKLDLLGNLVERVDVLAIGGGMANTFLFAQGIEVGASLA 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +RD +D    I  +A+   C++++  DVV+A ++  G+ T VV   +VP  ++ILDVG  
Sbjct: 240 ERDLADTAWAILQKAEAKGCDVLLAIDVVIADKLAPGVVTTVVGVDAVPSGAMILDVGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  + + +A  RT++WNGPLG FE  PFD  T  +A   A+LT + R++++AGGGDT+ 
Sbjct: 300 TVAAMSERLAACRTLVWNGPLGAFETAPFDAGTNALAKAAAELTDQGRLLTVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ALAHAG+   F+YVSTAGGAFLEWLEGKDLPG+  L
Sbjct: 360 ALAHAGVLERFSYVSTAGGAFLEWLEGKDLPGVAVL 395


>gi|85373870|ref|YP_457932.1| phosphoglycerate kinase [Erythrobacter litoralis HTCC2594]
 gi|84786953|gb|ABC63135.1| phosphoglycerate kinase [Erythrobacter litoralis HTCC2594]
          Length = 399

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 271/398 (68%), Gaps = 1/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G   L+RVD N+P  DG  +DVTR+E V PTILEL EK AKV++ +
Sbjct: 1   MPTFKTLDDLGDITGKVALVRVDLNLPMKDGSASDVTRVEAVKPTILELSEKGAKVLLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP  K     S   VV   E +L K ++F+ +  G  + QSI  L  G I + +N R
Sbjct: 61  HFGRPGGKRSSVLSTSMVVGDVEGVLGKELMFIPEVSGPVVEQSIGILRNGDIGVLDNTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E  NDPDF + ++ +GDFY+NDAFS +HRAHA+  G++H LPSY GRAM++EL  L
Sbjct: 121 FWPGETDNDPDFAKAIAAHGDFYVNDAFSAAHRAHATTEGITHFLPSYAGRAMERELKAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +S     + P+ A+VGG+KVSTK+ +L NLV +V  L+IGGGMAN+FL A+G+ VG+SLC
Sbjct: 181 DSALGNPEAPVAAVVGGAKVSTKLDVLKNLVGRVQHLIIGGGMANTFLAARGVDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGF 299
           + D +D    I  EA  + C + +P DVVVA+E     P+ +  +   V  D +ILDVG 
Sbjct: 241 EHDLTDTASAIMDEADHAGCTVHLPYDVVVAKEFAANPPSVRTCNVHEVAADEMILDVGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +  E +  V+   RT++WNGPLG FEIEPFD ATV +A   A LT++  ++S+AGGGDT+
Sbjct: 301 QATEALGDVLKTCRTLVWNGPLGAFEIEPFDAATVALAKTAAALTQDGSLVSVAGGGDTV 360

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            ALAHAG++ + TYVSTAGGAFLEW+EGK+LPG+ ALS
Sbjct: 361 AALAHAGVTEDVTYVSTAGGAFLEWMEGKELPGVKALS 398


>gi|23015650|ref|ZP_00055420.1| COG0126: 3-phosphoglycerate kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 405

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/393 (50%), Positives = 265/393 (67%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++   D++G R L+R D NVP  DGKV D TRI+R   T+ EL  K AKV++ +H G
Sbjct: 2   FRTIDSF-DVKGKRVLVRADLNVPAKDGKVTDTTRIDRSAATLKELAGKGAKVIVLTHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +  K      V  +A ++  + +L+ +DCIG  + Q IA + +G I L ENVRFY 
Sbjct: 61  RPKGRDAKYSQKLLVEPLARAV-GQPVLWADDCIGVEVEQMIAKMKDGEIALLENVRFYE 119

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE ND  F +ML+  GD Y+NDAFS +HRAHAS  G++HLLP   GR MQ EL  L   
Sbjct: 120 NEEENDIGFAKMLAGLGDIYVNDAFSTAHRAHASTEGVAHLLPCAAGRLMQAELEALGKA 179

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP+ AIVGG+KVSTK+ LL NLV +VD L+IGGGMAN+FL AQG  VG+SLC++D
Sbjct: 180 LEHPEKPVAAIVGGAKVSTKLDLLGNLVARVDYLIIGGGMANTFLFAQGKQVGKSLCEKD 239

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + C I++P D VVA E       QVVS  +VP D +ILD G  + E
Sbjct: 240 LADTAREILEKAKAAHCHIVLPVDAVVAGEFAENAANQVVSVDAVPADKMILDAGPASAE 299

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   +   +T++WNGPLG FEI PFD+AT  VA + A+ T + +++++ GGGDT++ALA
Sbjct: 300 AIIDRLGGCKTLVWNGPLGAFEIAPFDKATNAVAQWAAERTVQGKLLTVGGGGDTVSALA 359

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG+ ++F+Y+STAGGAFLEWLEGK LPG+ AL
Sbjct: 360 KAGVEDKFSYISTAGGAFLEWLEGKVLPGVAAL 392


>gi|197106653|ref|YP_002132030.1| phosphoglycerate kinase [Phenylobacterium zucineum HLK1]
 gi|196480073|gb|ACG79601.1| phosphoglycerate kinase [Phenylobacterium zucineum HLK1]
          Length = 400

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/397 (47%), Positives = 278/397 (70%), Gaps = 4/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D  D++G R L+RVD+NVP  DG+V+D TR+   +PTI +L +  AKVV+ +H  
Sbjct: 3   FRTLDDA-DLQGRRALVRVDFNVPMQDGRVSDDTRLRAALPTIDKLRKGGAKVVLLAHFD 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  VV     ++   + F +DC+G   ++++A+L +G ++L ENVRF++
Sbjct: 62  RPKGKRVPEMSLKPVVEPLAKLVGAPVAFADDCVGGDAAKAVAALKDGDVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+F R L+ NGD Y+NDAFS +HRAHAS  GL+ LLP+Y G  M++EL  L++ 
Sbjct: 122 GEEKNDPEFARALAANGDLYVNDAFSAAHRAHASTEGLARLLPAYAGEQMRRELEALDAA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P++ IVGG+KVSTK+ LL NLV K+D L IGGGMAN+F  AQG  +G SLC+++
Sbjct: 182 LGNPQRPVLGIVGGAKVSTKLDLLNNLVGKLDYLAIGGGMANTFRYAQGFEIGGSLCEKE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT---QVVSAQSVPLDSIILDVGFK 300
            +D   +I  +A+   C++I+P D VVA+++  G+PT   Q+     V  D  I DVG  
Sbjct: 242 MADTAREIIAKAQAGGCKLILPSDAVVAKDLAPGVPTRTVQLAKDGGVAADEKIFDVGPD 301

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+  + + +A+ RT++WNGPLGVFE++PFD+ATVE A   A L K  +++++AGGGDT+ 
Sbjct: 302 TLAELLKAMAECRTLIWNGPLGVFEVQPFDKATVEAARQAASLAKAGKLVAVAGGGDTVA 361

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL  A  + +FT+VSTAGGAFLEW+EGK+LPG+ AL+
Sbjct: 362 ALNAAHAAGDFTFVSTAGGAFLEWMEGKELPGVAALA 398


>gi|115526713|ref|YP_783624.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisA53]
 gi|115520660|gb|ABJ08644.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisA53]
          Length = 398

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/393 (48%), Positives = 267/393 (67%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D  D++  R LLRVD NVP   G V D TR+ER++PTI+E+ +K  KV++ +HLG
Sbjct: 5   FKTLDD-ADLKSKRVLLRVDLNVPMDKGVVTDDTRLERILPTIVEIADKGGKVILLAHLG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+    K+ SL  V +    +L + + F  DCIG   S +IA++ +G I+  EN RF+ 
Sbjct: 64  RPKGVDPKE-SLKPVAAALAVVLKRPVGFAADCIGEVASSAIAAMQDGDILCLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP FV  L++ GD ++NDAFS +HRAHA+  GL H LP+Y GR MQ E+  L   
Sbjct: 123 GEEKNDPAFVDELAKLGDLWVNDAFSAAHRAHATTEGLGHKLPAYAGRTMQAEIDALNKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG+GVG+SLC++D
Sbjct: 183 LEAPTRPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGIGVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C II+P D  VA       P+Q     ++P D +ILDVG  ++E
Sbjct: 243 LAATALRILTKAEAANCAIILPVDATVAFHFAANAPSQAYGLDAIPADGMILDVGPLSIE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   I  A T++WNGP+G FE+ PFD+ TV  A++ A  TK  ++IS+AGGGDT+ AL 
Sbjct: 303 RINAAIDDAATLVWNGPVGAFELTPFDKGTVSAANHAAARTKAGKLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 363 QAGVADQFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|114768957|ref|ZP_01446583.1| phosphoglycerate kinase [alpha proteobacterium HTCC2255]
 gi|114549874|gb|EAU52755.1| phosphoglycerate kinase [alpha proteobacterium HTCC2255]
          Length = 396

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/394 (47%), Positives = 274/394 (69%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           LRT++D  +++    L+RVD NVP  +G+V D TR+ R VPTILE++EK  K ++ SH G
Sbjct: 3   LRTLDDF-NLKNKNILIRVDMNVPIHNGQVTDSTRLSRAVPTILEVLEKGGKPILLSHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP    D   S  + V+   + L K + F + CIG T   ++ +L EG ++L EN RF+ 
Sbjct: 62  RPTRGFDLTMSTQQAVTALSNRLKKRVHFASSCIGETAQLAVNTLPEGDVLLLENTRFHQ 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+F   L++ GD +++D FS +HRAHAS+  L+ ++PS  GR M++E+S LE+ 
Sbjct: 122 GEKKNDPEFAAELAKLGDIFVSDTFSTAHRAHASVEALARIMPSCAGRLMEEEISRLENV 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            S  KKP++A+VGG+KVS+K+ LL NL+  +DK+VIGGGMAN+FL A+G  +G+SLC+ +
Sbjct: 182 LSSPKKPVMAVVGGAKVSSKLLLLENLISPMDKIVIGGGMANTFLAAKGYNIGQSLCEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    I   AK+  CEII+P D+VVA+E       + + A + P DS+ILD G +T++
Sbjct: 242 MQDTARSIMENAKKMNCEIILPIDIVVAKEFAANTNCETLPADACPADSMILDAGSQTIK 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I + +   +TV+WNGPLG FE+ PF++AT   A YVA+LT+  +I+S+AGGGDT++AL 
Sbjct: 302 LIHEHLKHTKTVIWNGPLGAFEVPPFNKATDAAAKYVAELTQSGKILSVAGGGDTVSALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            +G +++FTY+STAGGAFLEWLEGK LPG+  L+
Sbjct: 362 GSGSADKFTYISTAGGAFLEWLEGKTLPGVAVLT 395


>gi|295688104|ref|YP_003591797.1| phosphoglycerate kinase [Caulobacter segnis ATCC 21756]
 gi|295430007|gb|ADG09179.1| Phosphoglycerate kinase [Caulobacter segnis ATCC 21756]
          Length = 396

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/393 (48%), Positives = 269/393 (68%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT+ D  D+ G R L+RVD+N+P   GK++D TR+   +PTI  L ++ AKVV+ +H  
Sbjct: 3   FRTL-DTADLAGKRALVRVDFNLPVDGGKISDDTRLRAALPTIAYLSKQGAKVVLLAHFD 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V      +L + + F +DC+G   ++ +  L  GG+ L ENVRF++
Sbjct: 62  RPKGKVVPEMSLAFVAEPLSKLLEQPVAFASDCVGPAAAEVVNGLENGGVALLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+F + L+ NGD Y+NDAFS +HRAHAS  GL+ LLP+Y G +MQ+EL  L++ 
Sbjct: 122 GEEKNDPEFAKALAANGDVYVNDAFSAAHRAHASTEGLARLLPAYPGLSMQRELEALDAA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + KKP++ IVGGSKVSTK+ LL NLV K+D L IGGGMAN+FL A  + VG SLC+ D
Sbjct: 182 LGKPKKPVIGIVGGSKVSTKLDLLRNLVTKLDYLAIGGGMANTFLYAAKIDVGASLCETD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   QI   A  + C+I++P DVVVA E+K G+ + V +   V  +  ILD G +TV 
Sbjct: 242 MADTARQIIDLAGGAGCKILLPTDVVVAHEVKPGVASSVRNVYEVQPEDRILDAGPETVA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   I Q  T++WNGPLGVFE+ PFD+ATV  A +V++  K  +++++AGGGDT+ AL 
Sbjct: 302 TLNATIDQCETLIWNGPLGVFEVPPFDKATVSAAKHVSERAKSGKLVAVAGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++ + T+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 362 HAGVAADMTFVSTAGGAFLEWMEGKTLPGVAAL 394


>gi|259419139|ref|ZP_05743056.1| phosphoglycerate kinase [Silicibacter sp. TrichCH4B]
 gi|259345361|gb|EEW57215.1| phosphoglycerate kinase [Silicibacter sp. TrichCH4B]
          Length = 396

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 261/392 (66%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ ++ G   L RVD NVP  DGKV D TRI R+VPTI +L+ K AK V+ +H GR
Sbjct: 4   KTLDDM-ELEGKTVLTRVDINVPMEDGKVTDDTRIRRLVPTISDLLAKGAKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL  +V   E+     ++FV DC G     +IA+L  G I+L EN RF++ 
Sbjct: 63  PKGQVVPEMSLQPLVPALEAAFGAPVMFVADCRGPAAEGAIAALQPGQILLLENTRFHAG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND D    +++ GD Y NDAFS +HRAHAS   L+ LLPS  GR M  EL  LE   
Sbjct: 123 EEKNDADLAGEMAKLGDIYCNDAFSAAHRAHASTEALARLLPSCAGRLMAAELKALEGSL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +  ++P+ A+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+ D 
Sbjct: 183 ATPERPVTAVVGGAKVSTKLDLLGNLVAKVDTLVIGGGMANTFLAAQGIDVGKSLCEHDM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +     I   A+ + C I++P DVVVARE K G   + V A + P D++ILD G  +V  
Sbjct: 243 TGTAKDIMARAEAAGCTILLPSDVVVAREFKAGAENETVPAYACPSDAMILDAGPASVAA 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I  V A ++T++WNGPLG FEI PFD AT   A   A  TK   +IS+AGGGDT+ AL  
Sbjct: 303 IATVFADSKTLIWNGPLGAFEIAPFDIATNTAAQKAADCTKAGTLISVAGGGDTVAALNQ 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++ +F+Y+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 AGVAEDFSYISTAGGAFLEWMEGKVLPGVAAL 394


>gi|149186662|ref|ZP_01864973.1| phosphoglycerate kinase [Erythrobacter sp. SD-21]
 gi|148829570|gb|EDL48010.1| phosphoglycerate kinase [Erythrobacter sp. SD-21]
          Length = 398

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 273/397 (68%), Gaps = 1/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS  RT++DL D+ G   L+RVD N+P  DG   DVTR+E V PTILEL +K AKV++ +
Sbjct: 1   MSSFRTLDDLGDVTGKVALVRVDLNLPMKDGSATDVTRVEAVKPTILELADKGAKVLLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +     S   V    E +L K I+F+ + +G  + QSI  L  G I L +NVR
Sbjct: 61  HFGRPKGQRHSTMSTSFVQGDVEKVLGKEIMFIPEVMGPVVEQSIGILRNGDIGLLDNVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE NDP+F R ++ +GDFY+NDAFS +HRAHAS  GL+H LP+Y GRAM+ EL  L
Sbjct: 121 FWPGEEANDPEFARGIAAHGDFYVNDAFSAAHRAHASTEGLAHHLPAYAGRAMEAELKAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ++     ++P+ A+VGG+KVSTK+ +L NLV KV  L+IGGGMAN+FL A+G+ VG+SLC
Sbjct: 181 DAALGNPEQPVAAVVGGAKVSTKLDVLENLVGKVQHLIIGGGMANTFLAARGVDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGF 299
           + D  D  ++I  +A  + C + +P DVVVA+E      + +V +   V  + +ILDVG 
Sbjct: 241 EHDLKDTANRIMDQADHAGCTVHLPYDVVVAKEFAANPHSLRVCNVHEVAEEEMILDVGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           + VE +  V+   RT++WNGP+G FE EPFD ATV +A   A LT+   + S+AGGGDT+
Sbjct: 301 QAVEALGDVLKTCRTLVWNGPMGAFETEPFDAATVALAKTAAALTEGGSLTSVAGGGDTV 360

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            ALAHAG+ ++FT+VSTAGGAFLEW+EGKDLPG+ AL
Sbjct: 361 AALAHAGVKDDFTFVSTAGGAFLEWMEGKDLPGVAAL 397


>gi|315498665|ref|YP_004087469.1| phosphoglycerate kinase [Asticcacaulis excentricus CB 48]
 gi|315416677|gb|ADU13318.1| Phosphoglycerate kinase [Asticcacaulis excentricus CB 48]
          Length = 397

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/394 (48%), Positives = 266/394 (67%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ D+ G   L+RVD+NVP  DG++ D TR++  +PTI +L +  AKV + +H  
Sbjct: 3   FKTLDDISDLHGKTALVRVDFNVPVEDGRITDDTRLKVALPTIEKLQKLGAKVALLAHFD 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V     ++L   + F +DC+G+  +  +  L  GG+ L ENVRF++
Sbjct: 63  RPKGKVVPEMSLRFVAPALSALLGTTVAFADDCVGADAADVLKLLPAGGVALLENVRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDPDF   L+  GD Y+NDAFS +HRAHAS  G++ LLP+Y G +M++EL  L + 
Sbjct: 123 GEEKNDPDFAAQLAALGDIYVNDAFSAAHRAHASTEGVAKLLPAYAGESMRRELDALNAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P + IVGGSKVSTK+ LL NLV K+D L IGGGMAN+FL AQG  VG SLC++D
Sbjct: 183 LGTPVRPTIGIVGGSKVSTKLDLLKNLVGKLDALAIGGGMANTFLYAQGHEVGGSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTV 302
             D   +I  EA+   C I++P DVVVA+E K   P ++V     +  D  I D G KTV
Sbjct: 243 LKDTALEILKEAEVKGCRILLPLDVVVAQEFKAHAPNRIVDLGAELSGDDKIFDAGPKTV 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             +K VI  ++T++WNGPLGVFE+ PFD ATVE A + A+ T+  ++I++AGGGDT+ AL
Sbjct: 303 AQLKDVIDNSKTLIWNGPLGVFELPPFDTATVEAAKFAAEQTQSGKLIAVAGGGDTVAAL 362

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG+  + T+VSTAGGAFLEW+EGKDLPG+ AL
Sbjct: 363 NHAGVVQDMTFVSTAGGAFLEWMEGKDLPGVSAL 396


>gi|144898603|emb|CAM75467.1| phosphoglycerate kinase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 406

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/393 (50%), Positives = 270/393 (68%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT+ D  D++G R L+R D NVP  DGKV D TRI+R   T+ EL E+ AKV++ +H G
Sbjct: 2   FRTI-DAFDVKGKRVLVRADLNVPSKDGKVTDSTRIDRSAATLKELAERGAKVIVLTHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + DK      +  +A+++  + + + +DCIG     +IA L+ G I L ENVRF+ 
Sbjct: 61  RPKGREDKYSQKLLLEPLAKAV-GQAVAWADDCIGPDAEAAIAKLNNGDIALLENVRFHP 119

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L++ GD Y+NDAFS +HRAHAS  GL+HLLP+  GR MQ EL  L   
Sbjct: 120 EEEKNDPAFAQALAKLGDLYVNDAFSTAHRAHASTEGLAHLLPAAAGRLMQVELEALAKA 179

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP+ A+VGG+KVSTK+ LL NLV +VD L+IGGGMAN+FL AQG  VG+SLC++D
Sbjct: 180 LGTPEKPVAAVVGGAKVSTKLDLLGNLVSRVDYLIIGGGMANTFLFAQGKAVGKSLCEKD 239

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + C I++P D VVA E       +VVS  +VP D +ILD G  ++E
Sbjct: 240 MADTAREILEKAKAAKCHIVLPVDAVVAAEFAENAANKVVSVDAVPDDMMILDAGPASIE 299

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   +   +T++WNGPLG FEI PFD+AT  VA   A+ TK+ +++++AGGGDT+ ALA
Sbjct: 300 AIIDRLGGCKTLVWNGPLGAFEINPFDKATNAVAQAAAERTKQGKLLTVAGGGDTVAALA 359

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG+  +F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 360 KAGVDEDFSYVSTAGGAFLEWLEGKTLPGVAAL 392


>gi|329114752|ref|ZP_08243509.1| Phosphoglycerate kinase [Acetobacter pomorum DM001]
 gi|326695883|gb|EGE47567.1| Phosphoglycerate kinase [Acetobacter pomorum DM001]
          Length = 407

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/389 (49%), Positives = 263/389 (67%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  D +G R LLRVD NVP  DGKV D TRIERVVPTI EL EK  +V++ SH  RP+ K
Sbjct: 10  DTLDPKGKRILLRVDLNVPMKDGKVTDETRIERVVPTIRELAEKGGRVILLSHFDRPKGK 69

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
              D SL  + +   + L + + F +DCIG     +  S+ +G I+L EN RF   EE+N
Sbjct: 70  VVPDMSLQPIATALATALGRPVSFAHDCIGPDAEAAARSMQDGDILLLENTRFQPGEEKN 129

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           D      L+  GD Y+NDAFS +HRAHAS  G++  LPSY GR MQ EL  L +     +
Sbjct: 130 DAGLSAALASLGDVYVNDAFSAAHRAHASTAGVAAHLPSYGGRLMQAELEALYAALENPE 189

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ AIVGG+K+STK+ LL N++ KVD L IGG MAN+FL A+G+ VG+SL ++D  D  
Sbjct: 190 RPVGAIVGGAKISTKLQLLENMLAKVDMLAIGGAMANTFLAAKGLQVGKSLIEKDMLDTA 249

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             I  +A+   C++I+P DVV++ +   G PTQVV A ++P   + LDVG +TV+ ++  
Sbjct: 250 RTIMEQAQAKKCDLILPVDVVISEDFIAGAPTQVVPATAIPDGWMALDVGPETVKLLQSK 309

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +A  +T++WNGPLGVFE+ PFD  T  VA   A+LT+E ++ ++AGGGDT++AL HAG+ 
Sbjct: 310 LAGLKTLVWNGPLGVFELPPFDEGTNAVAQAAAQLTQEGKLKTVAGGGDTVSALRHAGVL 369

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ +YVSTAGGAFLEWLEGK LPG+ A+S
Sbjct: 370 HKMSYVSTAGGAFLEWLEGKILPGLTAIS 398


>gi|90426241|ref|YP_534611.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisB18]
 gi|90108255|gb|ABD90292.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisB18]
          Length = 398

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/391 (49%), Positives = 261/391 (66%), Gaps = 2/391 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T++D  D++G R LLRVD NVP   GKV D TR++R+ PTILE+ +K  KV++ +H GRP
Sbjct: 7   TLDD-ADLKGKRVLLRVDINVPVDAGKVTDTTRLDRIAPTILEIADKGGKVILLAHFGRP 65

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           +    K+ SL  + +    +L + + F  DCIG   + +IA L +G I+  EN RF+  E
Sbjct: 66  KGPDPKE-SLRPIAAALAEVLKRPVAFAEDCIGEVAASAIAKLQDGDILCLENTRFHKGE 124

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
           E+NDP FV  L++ GD ++NDAFS +HRAHAS  G+ H LP+Y GR MQ E+  L     
Sbjct: 125 EKNDPAFVDELAKLGDLWVNDAFSAAHRAHASTEGIGHKLPAYAGRTMQLEIDALNKALE 184

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             K+P++AIVGG+KVS+KI LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC++D +
Sbjct: 185 APKRPVIAIVGGAKVSSKIDLLENLVTKVDALVIGGGMANTFLHAQGINVGKSLCEKDLA 244

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
               +I  +A+ + C II+P D  VA       P       S+P D +ILDVG ++V  I
Sbjct: 245 PTALRIIAKAEAANCAIILPVDATVAYHFAPNAPAFAYGLDSIPADGMILDVGPRSVARI 304

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
              I  A T++WNGP+G FE+ PFD  TV  A + A  TK  +++S+AGGGDT+ AL  A
Sbjct: 305 NAAIDDASTLVWNGPVGAFELHPFDAGTVAAAQHAAARTKAHKLVSVAGGGDTVAALNQA 364

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           G++ +FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 365 GVAGDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|217978430|ref|YP_002362577.1| phosphoglycerate kinase [Methylocella silvestris BL2]
 gi|217503806|gb|ACK51215.1| Phosphoglycerate kinase [Methylocella silvestris BL2]
          Length = 407

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 259/385 (67%)

Query: 15  GLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCS 74
           G R L+RVD NVP  +G++ D+TRI+RV+  I E+ +K AKV+I SHLGRP++  + + S
Sbjct: 20  GKRVLVRVDLNVPMENGRITDLTRIDRVLSNIREISQKGAKVIILSHLGRPKNGPEAETS 79

Query: 75  LFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVR 134
           L  V    E  L + + F +DC+G     S+A+L  G I+L EN RF++ E +NDPDFV 
Sbjct: 80  LKSVAVALEHELQQMVYFASDCVGPVAKSSVAALRNGDILLLENTRFHAGETKNDPDFVN 139

Query: 135 MLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAI 194
            L+  GD Y+NDAFS SHRAHAS  G++H LP+Y GR MQ+EL ML    +  ++P+ AI
Sbjct: 140 QLAELGDLYVNDAFSTSHRAHASTEGIAHKLPAYAGRTMQRELEMLTGMLAHPERPVAAI 199

Query: 195 VGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWE 254
           VGG+KVSTK+ LL NL+++V+ L IGGGMAN+FL A G  VG+SLC+   ++   +I  +
Sbjct: 200 VGGAKVSTKLELLGNLMRRVEFLFIGGGMANTFLAASGKSVGKSLCETQLAETARKIMAD 259

Query: 255 AKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQART 314
           A  + C++I+P D +VA   +     + V   SV  D +ILD+G +T+  +  V+A ART
Sbjct: 260 ADEANCQLILPVDAIVATRFEPNASCRAVDIDSVGDDDMILDIGPRTISKLVGVLAAART 319

Query: 315 VMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYV 374
           V+WNGP+G FE  PF   TV +A   A LTK   + +IAGGGDTI AL  A   N+FTYV
Sbjct: 320 VVWNGPVGAFETPPFQAGTVALAKVCAVLTKTHSLDTIAGGGDTIAALNQANAFNDFTYV 379

Query: 375 STAGGAFLEWLEGKDLPGIVALSGH 399
           STAGGAFLEWLEGK LPG+ AL G 
Sbjct: 380 STAGGAFLEWLEGKLLPGVEALRGQ 404


>gi|258541141|ref|YP_003186574.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632219|dbj|BAH98194.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635276|dbj|BAI01245.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638331|dbj|BAI04293.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641385|dbj|BAI07340.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644440|dbj|BAI10388.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-26]
 gi|256647495|dbj|BAI13436.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-32]
 gi|256650548|dbj|BAI16482.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653539|dbj|BAI19466.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-12]
          Length = 407

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/389 (49%), Positives = 262/389 (67%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  D +G R LLRVD NVP  DGKV D TRIERVVPTI EL EK  +V++ SH  RP+ K
Sbjct: 10  DTLDPKGKRILLRVDLNVPMKDGKVTDETRIERVVPTIRELAEKGGRVILLSHFDRPKGK 69

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
              D SL  + +   + L + + F +DCIG     +  S+ +G I+L EN RF   EE+N
Sbjct: 70  VVPDMSLQPIATALATALGRPVSFAHDCIGPDAEAAARSMQDGDILLLENTRFQPGEEKN 129

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           D      L+  GD Y+NDAFS +HRAHAS  G++  LPSY GR MQ EL  L +     +
Sbjct: 130 DAGLSAALASLGDVYVNDAFSAAHRAHASTAGVAAHLPSYGGRLMQAELEALYAALENPE 189

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ AIVGG+K+STK+ LL N++ KVD L IGG MAN+FL A+G+ VG+SL ++D  D  
Sbjct: 190 RPVGAIVGGAKISTKLQLLENMLAKVDMLAIGGAMANTFLAAKGLQVGKSLIEKDMLDTA 249

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             I  +AK   C++I+P DVV++ +   G PTQVV   ++P   + LDVG +TV+ ++  
Sbjct: 250 RTIMEQAKAKNCDLILPVDVVISEDFIAGAPTQVVPVTAIPDGWMALDVGPETVKLLQSK 309

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +A  +T++WNGPLGVFE+ PFD  T  VA   A+LT+E ++ ++AGGGDT++AL HAG+ 
Sbjct: 310 LAGLKTLVWNGPLGVFELPPFDEGTNAVAQAAAQLTQEGKLKTVAGGGDTVSALRHAGVL 369

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ +YVSTAGGAFLEWLEGK LPG+ A+S
Sbjct: 370 HKMSYVSTAGGAFLEWLEGKVLPGLTAIS 398


>gi|296535329|ref|ZP_06897533.1| phosphoglycerate kinase [Roseomonas cervicalis ATCC 49957]
 gi|296264344|gb|EFH10765.1| phosphoglycerate kinase [Roseomonas cervicalis ATCC 49957]
          Length = 398

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 267/396 (67%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+R RT++ L D  G R LLR D NVP  DG+++D TRIER+ PTI EL +K  +VV+ S
Sbjct: 1   MARFRTLDQL-DPAGKRVLLRADLNVPVRDGQISDRTRIERLAPTIRELADKGGRVVVLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H  RP+ K   + SL  +     + L K + F +DCIG+    ++A+L +G I++ EN R
Sbjct: 60  HFDRPKGKRVPEMSLKPMAEALSATLGKPVAFADDCIGAVAEAAVAALKDGDILVLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDP  V  L++ GD ++NDAFS +HRAHAS  G++H LPSY GR MQ EL  L
Sbjct: 120 YHAGEEKNDPAMVDALAKLGDVFVNDAFSAAHRAHASTEGVAHKLPSYAGRLMQAELEAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ++      +PLVAIVGG+KVSTK+ LL NL KKV+ LVIGG MAN+FL AQG  +G+SL 
Sbjct: 180 DAALGNPARPLVAIVGGAKVSTKLDLLGNLSKKVNVLVIGGAMANTFLAAQGKFMGKSLQ 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +      +I  EAK + CE+++P D+VVA       P++ VS  +VP   + LDVG +
Sbjct: 240 EAEMHGTALRILDEAKAAGCEVLLPEDLVVAEAFAANAPSRTVSVDNVPEGMMALDVGPQ 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  ++  + +A T++WNGP G FEI PFD ATV+VA   A LT    + +I GGGDT++
Sbjct: 300 TVAAVESRLKRASTLVWNGPFGAFEIPPFDTATVQVAQTAAGLTTSAGLKTIGGGGDTVS 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+++  TYVS+AGGAFLEWLEGK LPG+  L
Sbjct: 360 ALRHAGVADRMTYVSSAGGAFLEWLEGKTLPGVAVL 395


>gi|90418726|ref|ZP_01226637.1| phosphoglycerate kinase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336806|gb|EAS50511.1| phosphoglycerate kinase [Aurantimonas manganoxydans SI85-9A1]
          Length = 402

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/396 (50%), Positives = 278/396 (70%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T++D  D+ G R LLRVD NVP  DG+V D TRIER++PTI E+ +K  +V++ +
Sbjct: 6   MTQFKTLDD-ADVTGKRVLLRVDLNVPIKDGEVGDRTRIERILPTIREIADKGGRVILLA 64

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ + + + SL  +  +   +L   + F +DCIG   +  +A+L +G ++L EN R
Sbjct: 65  HFGRPKGQPNPEMSLEPLAPVLSQMLGTPVGFADDCIGPVAAGIVAALKDGNVVLLENTR 124

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+ND +F   L+  GD ++NDAFS +HRAHAS  GL+  LPSY GR MQ EL  L
Sbjct: 125 FHAGEEKNDEEFASQLASLGDIFVNDAFSAAHRAHASTEGLARHLPSYAGRTMQAELEAL 184

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E      ++P+VA+VGG+KVSTKI LL NLV +VD LVIGGGMAN+FL AQG+ VG+SLC
Sbjct: 185 EKGLGNPERPVVAVVGGAKVSTKIDLLSNLVTRVDALVIGGGMANTFLAAQGIDVGKSLC 244

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +D    I   AK + CEI++P D VVA E K G   + V+  +VP D++ILD G K
Sbjct: 245 EHDLADTARAILDAAKTAGCEIVLPVDAVVAGEFKAGAANETVAVGAVPADAMILDAGPK 304

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV+ +   + +A+T++WNGPLG FEIEPFD AT+  A + A+ TK   ++S+AGGGDT+ 
Sbjct: 305 TVDLVSGWLDKAKTLVWNGPLGAFEIEPFDAATMAAARHAARRTKAGDLVSVAGGGDTVA 364

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  AG++++FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 365 ALNQAGVADDFTYVSTAGGAFLEWMEGKPLPGVEVL 400


>gi|84503372|ref|ZP_01001441.1| phosphoglycerate kinase [Oceanicola batsensis HTCC2597]
 gi|84388282|gb|EAQ01233.1| phosphoglycerate kinase [Oceanicola batsensis HTCC2597]
          Length = 394

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/397 (50%), Positives = 275/397 (69%), Gaps = 9/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++DL ++ G R L+RVD NVP   G+V D TRIER+VPT+ +++ +  K V+ +H GR
Sbjct: 4   KTLDDL-ELDGKRVLVRVDINVPVEAGRVTDATRIERIVPTVRDILSRGGKPVLIAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGS---TLSQSIASLSEGGIILAENVRF 121
           P+ +   D SL +V+ + E  L + + F+    G    T  Q+ A      +IL EN+RF
Sbjct: 63  PKGRVVLDMSLRQVLPVLEEKLGERVAFIETLEGGESPTEEQAGAR-----VILLENIRF 117

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE NDP F + L+  GD Y NDAFS +HRAHAS  G++H LPS  GR MQ EL  LE
Sbjct: 118 HPGEEANDPAFAKRLAGLGDVYCNDAFSAAHRAHASTEGVAHHLPSCAGRLMQAELRALE 177

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +   E ++P++A+VGG+KVSTK+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG+SLC+
Sbjct: 178 AALGEPERPVLAVVGGAKVSTKLDLLGNLVEKVDMLVIGGGMANTFLAAQGLDVGQSLCE 237

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            + +     IA +A  + CE+++PRDVVVARE K G  +QVV A+  P D++ILD G  +
Sbjct: 238 HEMAGTARTIAEKAAATGCELLLPRDVVVAREFKEGAESQVVKAEDCPADAMILDAGPDS 297

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V ++ Q + +A+T++WNGPLG FEI PFD AT   A   A+LT+  R+ S+AGGGDT+ A
Sbjct: 298 VAHVGQALDRAKTLIWNGPLGAFEIPPFDAATNAAAARAAELTRAGRLTSVAGGGDTVAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG +  FTYVSTAGGAFLEW+EGK+LPG+ ALSG
Sbjct: 358 LNGAGAAEAFTYVSTAGGAFLEWMEGKELPGVAALSG 394


>gi|182680367|ref|YP_001834513.1| phosphoglycerate kinase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636250|gb|ACB97024.1| Phosphoglycerate kinase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 409

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 271/397 (68%), Gaps = 1/397 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           S   T++D+  + G R L+RVD NVP  +G + D TRI+R++P I E+ +K  KV++ SH
Sbjct: 8   SPFPTLDDVV-VTGKRVLVRVDLNVPMDNGIITDATRIDRILPNIKEISQKGGKVILLSH 66

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP++  +   SL  V    E  L + + F +DC+G     + ++L EG I+L EN RF
Sbjct: 67  LGRPKNGPEAKTSLKPVAVELERHLGRYVAFASDCVGDVAKSAASALKEGDILLLENTRF 126

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + +E +NDP FV  L+  GD Y+NDAFS +HRAHA+  GL+H LP+Y GR MQ EL ML 
Sbjct: 127 HPQETKNDPAFVDALAELGDIYVNDAFSTAHRAHATTEGLAHKLPAYAGRTMQLELDMLT 186

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           S  +  ++PL AIVGG+KVSTK+ LL NL+++V+ L IGGGMAN+FL A G  +G+SLC+
Sbjct: 187 SMLAHPERPLAAIVGGAKVSTKLELLGNLMRRVEYLFIGGGMANTFLAASGKPIGKSLCE 246

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D +D   +I  +A+ + C++++P D +VA +++  IPT+ +   ++  + +ILD+G ++
Sbjct: 247 MDLADVARKIMADAEAAHCQLVLPVDAIVAPKLEANIPTRAIDIDAITENEMILDIGPRS 306

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +  I  ++  ART++WNGP+G FE+ PF   T+ +A   A+LTK   + +IAGGGDTI A
Sbjct: 307 ISKIVTLLGSARTLVWNGPVGAFEVPPFHVGTMAIAKVAAQLTKVSALETIAGGGDTIAA 366

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG  ++FTYVSTAGGAFLEWLEGK LPG+ AL G
Sbjct: 367 LNQAGAYDDFTYVSTAGGAFLEWLEGKLLPGVEALRG 403


>gi|312114866|ref|YP_004012462.1| phosphoglycerate kinase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219995|gb|ADP71363.1| Phosphoglycerate kinase [Rhodomicrobium vannielii ATCC 17100]
          Length = 402

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 257/385 (66%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+   R L+R D NVP  DG+++D TRIER++PT   L  + AK+VI SHLGRP  K   
Sbjct: 16  DVAEKRVLIRTDLNVPMADGQISDATRIERLLPTFRVLASRGAKIVILSHLGRPDGKPVA 75

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
             SL  V     ++L   + F +DC+G      + +L  G I + ENVRF+ EEE NDP 
Sbjct: 76  KYSLKPVADKLAAMLGATVAFADDCVGPAAEAVVKALEPGQIAMLENVRFHKEEEENDPA 135

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F   L++ GD Y+NDAFSVSHRAHAS   ++HLLP+Y G ++  E+   +    + ++P+
Sbjct: 136 FAAELAKLGDIYVNDAFSVSHRAHASTEAVAHLLPAYAGPSLLAEIGAFKVALEKPERPV 195

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AIVGGSKVSTKI +L NL +K+D L IGGGMAN+FL A G+ VG+SLC+ +  D V +I
Sbjct: 196 AAIVGGSKVSTKIAVLGNLAQKMDYLFIGGGMANTFLYADGVAVGKSLCEPNAIDTVKEI 255

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A+ + C+I++P D VVARE K    T+VV    VP D++ILD+G ++V     +I  
Sbjct: 256 RAKAEAAGCKIVLPVDAVVAREFKANAETEVVPVGEVPADAMILDIGPRSVAEFTGLIEG 315

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
            +T++WNGP+G FEI PF   T  +A   A LT+  +I++IAGGGDT+ AL  A ++++F
Sbjct: 316 CKTLLWNGPVGAFEIPPFGEGTFALAREAAALTQAGKIVTIAGGGDTVAALNAASVTDKF 375

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           TYVSTAGGAFLEWLEG+ LPG+ AL
Sbjct: 376 TYVSTAGGAFLEWLEGRTLPGVAAL 400


>gi|330993227|ref|ZP_08317163.1| Phosphoglycerate kinase [Gluconacetobacter sp. SXCC-1]
 gi|329759629|gb|EGG76137.1| Phosphoglycerate kinase [Gluconacetobacter sp. SXCC-1]
          Length = 407

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/395 (46%), Positives = 265/395 (67%), Gaps = 1/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +  +T++ L D  G + LLR D NVP  + ++ D TRI R++PTI EL +K A+V++ SH
Sbjct: 4   ASFKTLDSL-DATGKKVLLRADLNVPVRNRQITDATRIIRLLPTIQELAQKGARVIVVSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
             RP+ +   + SL  +       L + + FV+DCIG    Q++ ++ +G +++ EN RF
Sbjct: 63  FDRPKGQRVPEMSLGPIADALGDALGRPVTFVDDCIGPKAQQAVDAMQDGDVVVLENTRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D+Y+NDAFS +HRAHAS  G++ LLPS+ GR M+ EL+ L 
Sbjct: 123 YPGEEQNDPELAKGFAALADYYVNDAFSAAHRAHASTEGVARLLPSFAGRLMETELNALN 182

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  +P+ AIVGG+K+STK+ L+ NL++KVD L+IGG MAN+FL AQG+ VGRSL +
Sbjct: 183 IALENPARPVGAIVGGAKISTKLDLIGNLLEKVDMLIIGGAMANTFLAAQGVNVGRSLQE 242

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D    I  +A+   CEI++P D V A + +  +PT+ V+  ++P D+++LDVG +T
Sbjct: 243 ADMHDTARAIMAKAREKGCEIVLPVDAVTATDFQANVPTRTVAISAIPADAMVLDVGPET 302

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  I Q I   +T++WNGPLG FEI PFD AT  VA  VA+LT    + SIAGGGDT++A
Sbjct: 303 VMLINQKITTLKTLVWNGPLGAFEIPPFDTATNAVAKEVARLTDAGVLKSIAGGGDTVSA 362

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG+    +Y+S+AGGAFLEWLEGK LPGI+AL
Sbjct: 363 LRHAGVEKHISYISSAGGAFLEWLEGKTLPGIMAL 397


>gi|103486804|ref|YP_616365.1| phosphoglycerate kinase [Sphingopyxis alaskensis RB2256]
 gi|122985070|sp|Q1GTJ0|PGK_SPHAL RecName: Full=Phosphoglycerate kinase
 gi|98976881|gb|ABF53032.1| phosphoglycerate kinase [Sphingopyxis alaskensis RB2256]
          Length = 398

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/396 (48%), Positives = 265/396 (66%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++D+ D+ G R L+RVD NVP IDG V+D TRI+  +PTI EL +K A V++ +
Sbjct: 1   MTAFKTLDDIGDVTGKRVLVRVDLNVPMIDGAVSDATRIQAAMPTIRELSDKGAIVLLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+   +   SL  V+   E +L  +++F+ + +G      +A L+ G + + EN R
Sbjct: 61  HFGRPKGAKNPTQSLSLVMGGVEDVLGHSVMFIPEAVGEGAKAGVAVLAPGDVAVLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE+NDP F   L+  GD Y+NDAFS +HRAH S  G++  LP+Y GRAM+ EL  L
Sbjct: 121 FYPGEEQNDPAFADALAEIGDLYVNDAFSAAHRAHGSTEGIARRLPAYAGRAMEAELKAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ++      +P+ A+VGG+KVS+KI +L NLV KVD L+IGGGMAN+FL A+G+ VGRSLC
Sbjct: 181 DAALGNPVQPVAAVVGGAKVSSKIDVLRNLVGKVDHLIIGGGMANTFLAARGVDVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +  D  + I   A  + C I +P DVVVA+E     PT+ V+   V  D +ILDVG  
Sbjct: 241 EHELVDTANAIFDAADAAGCTIHLPYDVVVAKEFAPNPPTRTVNVHEVAADEMILDVGPA 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
            +E +  V+   RT++WNGPLG FE  PFD ATV +A   A LT+E  + S+AGGGDT+ 
Sbjct: 301 AIEALADVLKNCRTLVWNGPLGAFETPPFDTATVALARTAAALTREGSLTSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++ +FT+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 361 ALNHAGVAGDFTFVSTAGGAFLEWMEGKPLPGVDAL 396


>gi|296114907|ref|ZP_06833555.1| phosphoglycerate kinase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978613|gb|EFG85343.1| phosphoglycerate kinase [Gluconacetobacter hansenii ATCC 23769]
          Length = 407

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/393 (47%), Positives = 265/393 (67%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++ L+   G + LLR D NVP   G++ D TR+ R++PTI EL +K A+V++ SH  
Sbjct: 6   FKTLDQLQPA-GKKVLLRADLNVPVNGGQITDATRLLRLLPTIQELAQKGARVIVVSHFD 64

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  +       L + + F +DCIG     ++ ++ +G +++ EN RF++
Sbjct: 65  RPKGKRVPEMSLAPIADALGDALGRPVTFADDCIGPVAQAAVDAMQDGDVVVLENTRFHA 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE NDPD  + L+   DFY+NDAFS +HRAHAS  G++  LPS+ GR M+ EL+ L   
Sbjct: 125 GEEANDPDLAKSLASLADFYVNDAFSAAHRAHASTEGVARHLPSFAGRLMETELNALNIA 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+ AI+GG+K+STK+ L+ NL++KV  L+IGG MAN+FL AQG+ VGRSL + +
Sbjct: 185 LENPERPVGAIIGGAKISTKLDLIGNLLEKVQVLIIGGAMANTFLAAQGVKVGRSLQEGE 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    I  +AK   CE+I+P D V A E K  +PT+VV   ++P D++ILDVG +TV 
Sbjct: 245 MHDTARAILAKAKEKGCEVILPVDAVTATEFKANVPTRVVGIDAIPDDAMILDVGPQTVR 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   IA  +T++WNGPLG FEI PFD  T  VA  V +LT+E R+ SIAGGGDT++AL 
Sbjct: 305 DLCAKIAMLKTLVWNGPLGAFEIAPFDAGTNAVAQEVGRLTQEGRLKSIAGGGDTVSALR 364

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++ + +Y+STAGGAFLEWLEGK LPGI+AL
Sbjct: 365 HAGVTKDISYISTAGGAFLEWLEGKTLPGIMAL 397


>gi|163736623|ref|ZP_02144042.1| Phosphoglycerate kinase [Phaeobacter gallaeciensis BS107]
 gi|161390493|gb|EDQ14843.1| Phosphoglycerate kinase [Phaeobacter gallaeciensis BS107]
          Length = 396

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/390 (48%), Positives = 261/390 (66%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  D+ G R L+RVD NVP  DG+V D TRI+RV PTI +++      ++ +H GRP+ K
Sbjct: 7   DTMDLAGKRVLVRVDINVPVEDGRVTDDTRIQRVAPTIKDILAAGGTPILLAHFGRPKGK 66

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
              + SL  +V   E+     + F  DC G     ++  L  GG++L EN RF++ EE+N
Sbjct: 67  VVAEMSLRPLVPALEAAFGAPVTFAADCRGPAAEAAVQGLPAGGVLLLENTRFHAGEEKN 126

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           D D    +++ GD Y NDAFS +HRAHAS   L+ LLP+  GR MQ EL+ LE+   + +
Sbjct: 127 DTDLAAEMAKLGDIYCNDAFSAAHRAHASTEALARLLPACAGRLMQAELTALETALGQPQ 186

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ A+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+ D +D  
Sbjct: 187 RPVTAVVGGAKVSTKLELLGNLVGKVDNLVIGGGMANTFLAAQGIDVGKSLCEHDMADTA 246

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
            +I  +A+   C+II+P DVVVARE K G   + V+A + P D++ILD G +TV  +   
Sbjct: 247 REILSKAEDQGCKIILPVDVVVAREFKAGADNETVAADACPADAMILDAGPQTVAAVADT 306

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           ++ ++T++WNGP+G FEI PFD AT   A   A LTK   ++S+AGGGDT+ AL  AG +
Sbjct: 307 LSTSKTLIWNGPMGAFEIAPFDAATNAAAQQAASLTKSGALVSVAGGGDTVAALNQAGAA 366

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 367 ADFTYISTAGGAFLEWMEGKTLPGVAALEG 396


>gi|163742729|ref|ZP_02150114.1| phosphoglycerate kinase [Phaeobacter gallaeciensis 2.10]
 gi|161383984|gb|EDQ08368.1| phosphoglycerate kinase [Phaeobacter gallaeciensis 2.10]
          Length = 398

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/390 (48%), Positives = 260/390 (66%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  D+ G R L+RVD NVP  DG+V D TRI+RV PTI +++      ++ +H GRP+ K
Sbjct: 9   DTMDLAGKRVLVRVDINVPVEDGRVTDDTRIQRVAPTIKDILAAGGTPILLAHFGRPKGK 68

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
              + SL  +V   E+     + F  DC G     ++  L  GG++L EN RF++ EE+N
Sbjct: 69  VVAEMSLRPLVPALEAAFGAPVTFAADCRGPAAEAAVQGLPAGGVLLLENTRFHAGEEKN 128

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           D D    +++ GD Y NDAFS +HRAHAS   L+ LLP+  GR MQ EL+ LE+   + +
Sbjct: 129 DADLAAEMAKLGDIYCNDAFSAAHRAHASTEALARLLPACAGRLMQAELTALEAALGQPQ 188

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ A+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+ D +D  
Sbjct: 189 RPVTAVVGGAKVSTKLELLGNLVGKVDNLVIGGGMANTFLAAQGIDVGKSLCEHDMADTA 248

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
            +I  +A+   C+II+P DVVVARE K G   + V+A + P D++ILD G +TV  +   
Sbjct: 249 REILSKAETQGCKIILPIDVVVAREFKAGADNETVAADACPADAMILDAGPQTVAAVADT 308

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +  ++T++WNGP+G FEI PFD AT   A   A LTK   ++S+AGGGDT+ AL  AG +
Sbjct: 309 LFASKTLIWNGPMGAFEIAPFDAATNAAAQQAASLTKSGALVSVAGGGDTVAALNQAGAA 368

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 369 ADFTYISTAGGAFLEWMEGKTLPGVAALEG 398


>gi|260426169|ref|ZP_05780148.1| phosphoglycerate kinase [Citreicella sp. SE45]
 gi|260420661|gb|EEX13912.1| phosphoglycerate kinase [Citreicella sp. SE45]
          Length = 392

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/395 (49%), Positives = 273/395 (69%), Gaps = 10/395 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L RVD NVP  +G+V D TRIERV PT+ +++ +  K V+ +H GR
Sbjct: 4   KTLDDM-DLNGKRVLTRVDINVPVENGEVTDATRIERVGPTVQDILSRGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQS---IASLSEGGIILAENVRF 121
           P+ K   + SL  +V   E+     + F      +TL ++   I +   G ++L EN RF
Sbjct: 63  PKGKVVPEMSLKMLVPALEAAFGTKVHF------TTLDEAEAVIDACDPGQVVLLENTRF 116

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
              EE+NDP   +  +  GD Y NDAFS +HRAHAS  GL+HLLPS  GR MQ EL  L+
Sbjct: 117 EPGEEKNDPALAKTYAALGDVYCNDAFSAAHRAHASTEGLAHLLPSCAGRLMQAELEALD 176

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +   + K+P++A+VGG+KVSTK+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG+SLC+
Sbjct: 177 AALGQPKRPVLAVVGGAKVSTKLELLGNLVEKVDILVIGGGMANTFLAAQGVDVGKSLCE 236

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            + +    +IA +A  + CEI++PRDVVVARE +   P++VV A+S P D++ILD G ++
Sbjct: 237 HEMTCTAKEIAEKAATTGCEILLPRDVVVAREFRENAPSEVVPAESCPPDAMILDAGPES 296

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V +++Q I +A T++WNGPLG FEI PFD+AT   A + AK T   +++S+AGGGDT+ A
Sbjct: 297 VAHVEQAIDRAETLIWNGPLGAFEIAPFDKATNAAAAHAAKATANGKLVSVAGGGDTVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L  AG S +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 357 LNKAGASEDFTYISTAGGAFLEWMEGKVLPGVAAL 391


>gi|254475898|ref|ZP_05089284.1| phosphoglycerate kinase [Ruegeria sp. R11]
 gi|214030141|gb|EEB70976.1| phosphoglycerate kinase [Ruegeria sp. R11]
          Length = 396

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 268/390 (68%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  D+ G R L+RVD NVP  DG+V D TRIERV PTI +++    K ++ +H GRP+ K
Sbjct: 7   DTMDLTGKRVLVRVDINVPVEDGRVTDATRIERVAPTIKDILAAGGKPILLAHFGRPKGK 66

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
             +D SL  +V   E+     + FV DC G     ++A+L++G ++L EN RF+  EE+N
Sbjct: 67  VVEDMSLRPLVPALETAFGAPVTFVADCRGPAAEAAVAALADGAVLLLENTRFHPGEEKN 126

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           D D    +++ GD Y NDAFS +HRAHAS   L+ LLP+  GR MQ EL+ LES   + +
Sbjct: 127 DADLAAEMAQLGDIYCNDAFSAAHRAHASTEALARLLPACAGRLMQAELTALESALGQPE 186

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ A+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL A+G+ VG+SLC+ D +D  
Sbjct: 187 RPVTAVVGGAKVSTKLELLGNLVGKVDNLVIGGGMANTFLAARGIDVGKSLCEHDMADTA 246

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
            +I  +A+ + C+I++P DVVVARE K G   + V+A + P D++ILD G +TV  +   
Sbjct: 247 REILAKAEETGCKILLPVDVVVAREFKAGAENETVAADACPADAMILDAGPETVAAVADT 306

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +A ++T++WNGP+G FEI PFD AT   A   A LTK  +++S+AGGGDT+ AL  AG +
Sbjct: 307 LANSKTLIWNGPMGAFEIAPFDAATNAAAQQAASLTKSGQLVSVAGGGDTVAALNQAGAA 366

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 367 ADFTYISTAGGAFLEWMEGKTLPGVAALEG 396


>gi|260433374|ref|ZP_05787345.1| phosphoglycerate kinase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417202|gb|EEX10461.1| phosphoglycerate kinase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 435

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/392 (47%), Positives = 265/392 (67%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D++G R L+RVD NVP +DG V D TRI+R+VPT+ +++ K  K ++ +H GR
Sbjct: 43  KTLDDM-DLKGKRVLVRVDINVPVVDGAVTDDTRIQRIVPTVRDILAKGGKPILLAHFGR 101

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +  +  SL ++V   ES     + F  DC+G     ++A+  EG ++L EN RF+  
Sbjct: 102 PGGERRQTLSLKQLVPALESAFGTKVRFGEDCVGYEAEMAVANQGEGEVVLLENTRFHDG 161

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +N       +++ GD Y NDAFS +HRAHAS   L+ LLPS  GR MQ ELS LE+  
Sbjct: 162 ETKNSAKLAEGMAKLGDIYCNDAFSAAHRAHASTEALARLLPSCAGRLMQAELSALETAL 221

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              ++P+ A+VGG+KVSTK+ LL NL++KVD L+IGGGMAN+FL+A+G  VG+SL +   
Sbjct: 222 GNPQRPVTAVVGGAKVSTKLDLLGNLIEKVDNLIIGGGMANTFLLAKGYDVGKSLAEHAM 281

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +D   QI  +A+ + C II+P DVVVA + +   P +VV A   P D++ILD G +TV  
Sbjct: 282 TDTAAQIMAKAEETGCRIILPSDVVVAEKFEAHAPHKVVPADQCPADAMILDAGPETVAT 341

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I +    ++T++WNGPLG FEIEPFD AT   A   A+LT+  +++S+AGGGDT+ AL  
Sbjct: 342 ICKTFEDSKTLIWNGPLGAFEIEPFDAATNAAALKAAELTRAGKLVSVAGGGDTVAALNA 401

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 402 SGAAQDFTYISTAGGAFLEWMEGKTLPGVAAL 433


>gi|158422126|ref|YP_001523418.1| phosphoglycerate kinase [Azorhizobium caulinodans ORS 571]
 gi|259530691|sp|A8IM75|PGK_AZOC5 RecName: Full=Phosphoglycerate kinase
 gi|158329015|dbj|BAF86500.1| phosphoglycerate kinase [Azorhizobium caulinodans ORS 571]
          Length = 396

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/396 (48%), Positives = 264/396 (66%), Gaps = 2/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   RT+++  D+ G R L+RVD NVP  +G+V D TRI+ ++PTI  + EK  K ++ S
Sbjct: 1   MPTFRTLDE-ADLAGKRVLVRVDLNVPMDEGRVTDDTRIQAILPTIRAITEKGGKAILLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ + D   SL  V +     L   + F  DCIGS    ++++L+ G +++ EN R
Sbjct: 60  HFGRPKGR-DASQSLAPVAAAVGERLGAPVAFAGDCIGSDAEAAVSTLAPGAVLVLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+N  DFV+ L+  GD Y+NDAFS +HRAHAS  GL+H LP++ GR+MQKEL  L
Sbjct: 119 FHAGEEKNAADFVQQLAALGDIYVNDAFSAAHRAHASTEGLAHKLPAFAGRSMQKELEAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P++A+VGG+KVS+K+ LL NL  KVD LVIGGGMAN+FL A+G+ VG+SLC
Sbjct: 179 AKALEAPQRPVLAVVGGAKVSSKLELLGNLTAKVDILVIGGGMANTFLAAKGVKVGKSLC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +D   QI   A    CEI++P D VV +        +VV    V  D +ILD G  
Sbjct: 239 EHDLADTARQIIATAASHGCEIVLPVDAVVTKTFAAHADHRVVPVDQVAEDEMILDAGPA 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  +++ +  A+TV+WNGP G FE+ PFD ATV VA  VA+ TK   ++S+AGGGDT+ 
Sbjct: 299 TVALVREKLKGAKTVVWNGPFGAFELPPFDAATVAVAKAVAEATKAGALLSVAGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG + +F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 359 ALNHAGAAGDFSYVSTAGGAFLEWLEGKQLPGVEAL 394


>gi|114799328|ref|YP_761855.1| phosphoglycerate kinase [Hyphomonas neptunium ATCC 15444]
 gi|114739502|gb|ABI77627.1| phosphoglycerate kinase [Hyphomonas neptunium ATCC 15444]
          Length = 398

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/396 (45%), Positives = 256/396 (64%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   + + D  ++ G   L+RVD+NVP  +G V D TR+   V T+  L    AKV + +
Sbjct: 1   MPSFKRIPDAGNLTGKVALVRVDFNVPMENGLVTDDTRLRAAVDTVQSLRTAGAKVALLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL  +      +L  N+ FV DC G  +  +IA L   G+IL EN R
Sbjct: 61  HFGRPKGERVAEMSLAPIAGAFAKVLGANVSFVADCKGDHVKSAIADLLPAGVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE+ D +  + ++  GD Y+NDAFS +HR H S   L+ LLP+Y G  M+ EL  L
Sbjct: 121 FYKGEEKGDMELAKEIAALGDLYVNDAFSAAHRRHVSTAVLADLLPAYAGVTMEAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      ++P++AIVGG+KVS+KI LL NLV KVD L IGGGMAN+FL A G+ VG+SLC
Sbjct: 181 DKALGAPERPVMAIVGGAKVSSKIDLLKNLVSKVDMLAIGGGMANTFLAADGVNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +  V +I   AK + CEI++P+DVVVA+E K     +      +  D ++LD G  
Sbjct: 241 EHDLAPTVREIQAAAKAAGCEILLPKDVVVAKEFKANAENRTCGLNEIGADEMVLDAGAA 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+ Y+ + + +A+TV+WNGPLG FE+ PFD ATV+VA   AKL K   ++++AGGGDT+ 
Sbjct: 301 TITYLSEALGRAKTVIWNGPLGAFEMTPFDTATVKVAETAAKLAKSGALVAVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++ +FT++STAGGAFLEW+EGK+LPG+ AL
Sbjct: 361 ALNHAGVAQDFTFISTAGGAFLEWMEGKELPGVEAL 396


>gi|298293026|ref|YP_003694965.1| phosphoglycerate kinase [Starkeya novella DSM 506]
 gi|296929537|gb|ADH90346.1| Phosphoglycerate kinase [Starkeya novella DSM 506]
          Length = 399

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 262/395 (66%), Gaps = 2/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           S  RT++D  D+ G R L+RVD NVP   GKV D TRI  V+PTI E+ +K  KV++ +H
Sbjct: 5   SAFRTLDDA-DVAGKRVLVRVDLNVPVEAGKVTDDTRIRAVLPTISEIADKGGKVILLAH 63

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ + D   SL  +     S L K + F    IG     ++A L  G ++L EN RF
Sbjct: 64  FGRPKGE-DPALSLAPIAGEVASRLGKPVAFAPATIGPVAEAAVAKLQPGDVLLLENTRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
              EE+N+PDFV  L+  GD Y+NDAF+ +HRAHAS  GL+H LP+Y GR MQ+E+  L 
Sbjct: 123 DKREEKNEPDFVAALAGLGDIYVNDAFATAHRAHASTEGLAHRLPAYAGRCMQEEIEALA 182

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + ++P++A+VGG+KVS+K+ LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC+
Sbjct: 183 KALEKPERPVMAVVGGAKVSSKLELLGNLVAKVDILVIGGGMANTFLAAQGKAVGKSLCE 242

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D +D   +I  +AK + CEI++P D + A E K     +V S   +  D ++LD G  +
Sbjct: 243 HDLADTAREILEKAKAAGCEIVLPVDALAATEFKAHAAHRVASVDDIKADEMMLDAGPAS 302

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ +   +  A+TV+WNGP G FE+ PFD ATV VA   A+LT   +++S+AGGGDT+ A
Sbjct: 303 IDNVIARLKTAKTVVWNGPFGAFELPPFDTATVAVAKAAAELTDAGKLLSVAGGGDTVAA 362

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG++  FTYVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 363 LNHAGVAARFTYVSTAGGAFLEWLEGKALPGVEAL 397


>gi|83859959|ref|ZP_00953479.1| phosphoglycerate kinase [Oceanicaulis alexandrii HTCC2633]
 gi|83852318|gb|EAP90172.1| phosphoglycerate kinase [Oceanicaulis alexandrii HTCC2633]
          Length = 395

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 255/385 (66%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           DI G R L+RVD+NVP  +G V+D TR+   +PTI  L E  AKV++ +H GRP+ + + 
Sbjct: 9   DIAGKRVLVRVDFNVPMQNGSVSDDTRLRAALPTIEHLREAGAKVILMAHFGRPKGQRNP 68

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  V +    ++   + FV+DC+GS    +I+ +  G ++L EN RF+  EE+NDP 
Sbjct: 69  EMSLAPVATPLAELIGHPVKFVSDCVGSDPKGAISLMKAGDVLLLENTRFHEGEEKNDPA 128

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F   L+   D Y+NDAFS +HRAHAS  G++ LLP+Y G A+Q+E+  + +      +P+
Sbjct: 129 FAAQLAELADVYVNDAFSAAHRAHASTEGVARLLPAYAGLALQREIDHVTAALENPNRPV 188

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           +A+VGG+KVSTKI LL NLVKKVD+L +GG MAN+FL A+G  VG SL +RD  D    I
Sbjct: 189 LAVVGGAKVSTKIELLKNLVKKVDRLFVGGAMANTFLAARGHDVGGSLYERDLIDTAKAI 248

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              A  + C+I++P D VVA+E K     +V     +    +ILD G +TV+ +   IA 
Sbjct: 249 EDAAGEAQCQILLPTDAVVAKEFKAHADRRVAEVDDIQATEMILDCGPETVDQLADAIAA 308

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           +RT++WNGPLG FE  PFD ATVE A Y A   KE  + ++AGGGDT+ AL  AG+S++F
Sbjct: 309 SRTLVWNGPLGAFETPPFDTATVEAARYAASRCKEHGLTAVAGGGDTVAALNQAGVSDDF 368

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T+VSTAGGAFLEWLEGK LPG+ AL
Sbjct: 369 TFVSTAGGAFLEWLEGKALPGVEAL 393


>gi|162148086|ref|YP_001602547.1| phosphoglycerate kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542700|ref|YP_002274929.1| phosphoglycerate kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786663|emb|CAP56246.1| Phosphoglycerate kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530377|gb|ACI50314.1| Phosphoglycerate kinase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 407

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/393 (46%), Positives = 264/393 (67%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++ L+  +G + LLR D NVP  DGK+ D+TRIER+ PTI EL +K A+V++ SH  
Sbjct: 6   FKTLDALQP-KGRKVLLRADLNVPVRDGKITDLTRIERLAPTIRELADKGARVIVVSHFD 64

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  + +   + L + + F +DCIG    ++++ L +G +++ EN RF++
Sbjct: 65  RPKGQRVPEMSLAPIAAALGTTLGRPVQFADDCIGPVAEEAVSKLQDGDVLVLENTRFHA 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDPD  + L+   D Y+NDAFS +HRAHAS  G++  LPS+ GR M+ EL+ L   
Sbjct: 125 GEEKNDPDLSKALAALADDYVNDAFSAAHRAHASTEGVARFLPSFAGRLMEAELNALNVA 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P+ AIVGG+K+STK+ L+ NL+ KVD L+IGG MAN+FL A G+ VG+SL + D
Sbjct: 185 LENPVRPVGAIVGGAKISTKLDLIGNLLDKVDVLIIGGAMANTFLAANGVRVGKSLQEAD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    I  +A+   CEI++P D V A E +   PT+ V    +P D+++LD G +TV 
Sbjct: 245 MHDTARAIMAKAEERGCEIVLPVDAVTATEFRADPPTRTVPIDEIPADAMMLDAGPETVT 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + Q I   +T++WNGPLG FE+ PFD AT  VA  VA+ T+  ++ S+AGGGDT++AL 
Sbjct: 305 LLIQKIVGLKTLVWNGPLGAFELHPFDTATNLVAAEVARRTQAGQLTSVAGGGDTVSALR 364

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG+++E +Y STAGGAFLEWLEGK LPGI AL
Sbjct: 365 HAGVADEMSYTSTAGGAFLEWLEGKVLPGIQAL 397


>gi|294011297|ref|YP_003544757.1| phosphoglycerate kinase [Sphingobium japonicum UT26S]
 gi|292674627|dbj|BAI96145.1| phosphoglycerate kinase [Sphingobium japonicum UT26S]
          Length = 400

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/394 (47%), Positives = 267/394 (67%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ DI G   L+R D NVP  DG V D TR+   +PT+LEL ++ AKV+I +H G
Sbjct: 5   FKTLDDMGDITGKVVLVREDLNVPMQDGSVTDDTRLRAAMPTVLELADRGAKVLILAHFG 64

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL K+     ++L +++ F+ DC G   +  I  +  G I + EN RF++
Sbjct: 65  RPKGQKNPEYSLSKITRPLTAVLGRDVQFIPDCQGEAATDGIKVMRNGDIAILENTRFHA 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP     ++  GD Y+NDAFS +HRAH S  GL+H LP++ GR+M+KEL  L++ 
Sbjct: 125 GEEKNDPALAEAMAAIGDLYVNDAFSAAHRAHVSTEGLAHKLPAFAGRSMEKELDALQAA 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             E  KP+ A+VGG+KVSTK+ +L NLV KVD L+IGGGMAN+FL A+G+ VG+SLC++D
Sbjct: 185 LGEPVKPVAAVVGGAKVSTKLDVLNNLVAKVDHLIIGGGMANTFLFARGVDVGKSLCEKD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGFKTV 302
            +     I  +A+ + C I +P DVVVA+E     P+ +  +   V  D +ILDVG   V
Sbjct: 245 LAATAEAIFDKAEAAGCTIHLPYDVVVAKEFAANPPSLRTCNVHEVAEDEMILDVGPAAV 304

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E +   I   RT++WNGPLG FEI PFD+ATV +A   A LTKE  + S+AGGGDT+ AL
Sbjct: 305 EALGDAIKNCRTLVWNGPLGAFEIAPFDKATVALAKTAAALTKEGGLTSVAGGGDTVAAL 364

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG++ +F++VSTAGGAFLEW+EGK+LPG+ AL
Sbjct: 365 NHAGVAGDFSFVSTAGGAFLEWMEGKELPGVKAL 398


>gi|221638903|ref|YP_002525165.1| phosphoglycerate kinase [Rhodobacter sphaeroides KD131]
 gi|254782215|sp|B9KQT7|PGK_RHOSK RecName: Full=Phosphoglycerate kinase
 gi|221159684|gb|ACM00664.1| Phosphoglycerate kinase [Rhodobacter sphaeroides KD131]
          Length = 397

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 281/394 (71%), Gaps = 2/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G   L+RVD NVP  +G+V D TRIE++VPT+ ++++K  K V+ +H GR
Sbjct: 4   KTLDDM-DLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVV-SIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+ K  ++ SL  V+ ++ +++    + F  DC+G    Q++A++ EG ++L EN RF++
Sbjct: 63  PKGKVVEEMSLRLVLPALQKALPGTKVSFAADCVGPEPEQAVAAMLEGEVLLLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+    +++ G  Y+NDAFS +HRAHAS  GL+ LLPS  GR M+ EL  LE+ 
Sbjct: 123 GEEKNDPELAAAMAKLGQVYVNDAFSAAHRAHASTEGLARLLPSAAGRLMEAELKALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA+VGG+KVSTK+ LL NLV +VD LVIGGGMAN+FLVAQG+ VG+SL +RD
Sbjct: 183 LGHPERPVVAVVGGAKVSTKLDLLGNLVGRVDHLVIGGGMANTFLVAQGIEVGKSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + C I +P DVVVARE K G   + V   + P D++ILD G KTV 
Sbjct: 243 MADTAREILSKAKAAGCTIHLPLDVVVAREFKAGAANETVETSACPADAMILDAGPKTVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V A A+T++WNGPLG FEIEPFD AT   A  VA+LTK  ++IS+AGGGDT+ AL 
Sbjct: 303 ALSEVFASAKTLIWNGPLGAFEIEPFDAATNAAALQVAQLTKAGQLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG +  F+Y+STAGGAFLEW+EGK+LPG+ AL+
Sbjct: 363 KAGAAEGFSYISTAGGAFLEWMEGKELPGVAALT 396


>gi|319409341|emb|CBI82985.1| phosphoglycerate kinase [Bartonella schoenbuchensis R1]
          Length = 397

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/393 (46%), Positives = 272/393 (69%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT+++  D+ G   L+RVD+NVP + GKV D TR++R   T++EL ++ AK+++ SH G
Sbjct: 3   FRTIDE-ADVAGKCVLVRVDFNVPMLQGKVCDETRLKRHKETLVELQKRGAKIILISHCG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      I+ + + F++ C G  +  ++ +L EG I+L EN+RF+ 
Sbjct: 62  RPKGQKVPELSLRPVAQALSKIMGQEVSFLDKCFGLEVRSAVQALKEGEILLLENLRFHQ 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           +EE ND  F   L+ + D Y+NDAFSVSHRAHAS  G++H LPSY G ++Q+EL  LE  
Sbjct: 122 DEEDNDDAFAEALACSADIYVNDAFSVSHRAHASTEGITHFLPSYAGCSLQRELHALEQG 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             +   PL A+VGG+KVS+K+ +L +LV+KV+ LVIGGGMANSFL AQG  +G+SL +  
Sbjct: 182 LGDPTYPLAAVVGGAKVSSKLFVLNHLVQKVNALVIGGGMANSFLAAQGYAIGKSLYEHT 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             + V +I  +A    CE+++P DVVV    +   P +    + +  + +ILD+G +++ 
Sbjct: 242 LMETVEEIIEKAHEYDCELVLPVDVVVGLRCEKNTPHRQCDLEDISDNEMILDIGPRSIA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I ++I  A TV+WNGPLGVFE+ PFD+ T+ VA +VAK T++ +++SIAGGGDT+ AL 
Sbjct: 302 QINEMIDTAATVVWNGPLGVFEVSPFDQGTIAVARHVAKCTQQGKLVSIAGGGDTVFALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTY+STAGGAFLEW+EGK LPG++AL
Sbjct: 362 HAGVADDFTYLSTAGGAFLEWMEGKSLPGVLAL 394


>gi|126461920|ref|YP_001043034.1| phosphoglycerate kinase [Rhodobacter sphaeroides ATCC 17029]
 gi|166987803|sp|A3PIU6|PGK_RHOS1 RecName: Full=Phosphoglycerate kinase
 gi|126103584|gb|ABN76262.1| phosphoglycerate kinase [Rhodobacter sphaeroides ATCC 17029]
          Length = 397

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 280/394 (71%), Gaps = 2/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G   L+RVD NVP  +G+V D TRIE++VPT+ ++++K  K V+ +H GR
Sbjct: 4   KTLDDM-DLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVV-SIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+ K   + SL  V+ ++ +++    + F  DC+G    Q++A++ EG ++L EN RF++
Sbjct: 63  PKGKVVDEMSLRLVLPALQKALPGTKVSFAADCVGPEPEQAVAAMLEGEVLLLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+    +++ G  Y+NDAFS +HRAHAS  GL+ LLPS  GR M+ EL  LE+ 
Sbjct: 123 GEEKNDPELAAAMAKLGQVYVNDAFSAAHRAHASTEGLARLLPSAAGRLMEAELKALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA+VGG+KVSTK+ LL NLV +VD LVIGGGMAN+FLVAQG+ VG+SL +RD
Sbjct: 183 LGHPERPVVAVVGGAKVSTKLDLLGNLVGRVDHLVIGGGMANTFLVAQGIEVGKSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + C I +P DVVVARE K G   + V   + P D++ILD G KTV 
Sbjct: 243 MADTAREILSKAKAAGCTIHLPLDVVVAREFKAGAANETVETSACPADAMILDAGPKTVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V A A+T++WNGPLG FEIEPFD AT   A  VA+LTK  ++IS+AGGGDT+ AL 
Sbjct: 303 ALSEVFASAKTLIWNGPLGAFEIEPFDAATNAAALQVAQLTKAGQLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG +  F+Y+STAGGAFLEW+EGK+LPG+ AL+
Sbjct: 363 KAGAAEGFSYISTAGGAFLEWMEGKELPGVAALT 396


>gi|326387799|ref|ZP_08209405.1| phosphoglycerate kinase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207845|gb|EGD58656.1| phosphoglycerate kinase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 398

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/395 (48%), Positives = 266/395 (67%), Gaps = 1/395 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ D+ G   L+R D NVP  DGKV D TR+    PT+ EL +K AKV++ +H G
Sbjct: 3   FKTLDDIADVTGKAVLVREDLNVPMADGKVTDDTRLRATAPTLTELADKGAKVLVLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +     SL  VV    + L + + FV DC G+    ++A+L+ G I + EN RF+ 
Sbjct: 63  RPKGERSDANSLIHVVPALSAALGRPVGFVADCAGAEAEAAVAALAPGSITVLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+ V  +++ GD Y+NDAFS +HRAHAS  GL+ +LP+Y GRAMQ EL  LE  
Sbjct: 123 GEEKNDPELVAAIAKLGDLYVNDAFSAAHRAHASTEGLAKVLPAYAGRAMQAELEALEKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P+ A+VGG+KVSTK+ +L +LV KVD L+IGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 183 LGNPEHPVAAVVGGAKVSTKLDVLKHLVDKVDHLIIGGGMANTFLAARGVDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGFKTV 302
             +    I   A  + C + +P D  VA+E     P+ ++ +   V  D +ILDVG + V
Sbjct: 243 LKETAEAILDAADVAGCTVHLPYDAAVAKEFAANPPSLRITNVHEVAADEMILDVGPQAV 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E +  V+   RT++WNGPLG FEIEPFD ATV +A   A L+KE  +IS+AGGGDT+ AL
Sbjct: 303 EALADVLKTCRTLVWNGPLGAFEIEPFDAATVALARSAAALSKEGALISVAGGGDTVAAL 362

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            HAG++ +F+YVSTAGGAFLEW+EGK+LPG+ ALS
Sbjct: 363 NHAGVAADFSYVSTAGGAFLEWMEGKELPGVAALS 397


>gi|77463045|ref|YP_352549.1| phosphoglycerate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|123592258|sp|Q3J3I6|PGK_RHOS4 RecName: Full=Phosphoglycerate kinase
 gi|77387463|gb|ABA78648.1| phosphoglycerate kinase [Rhodobacter sphaeroides 2.4.1]
          Length = 397

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/394 (50%), Positives = 278/394 (70%), Gaps = 2/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G   L+RVD NVP  +G+V D TRIE++VPT+ ++++K  K V+ +H GR
Sbjct: 4   KTLDDM-DLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILH-KNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+ K   + SL  V+   ++ L    + F  DC+G    Q++A++ EG ++L EN RF++
Sbjct: 63  PKGKVVDEMSLRLVLPALQNALPGTKVSFAADCVGPEPEQAVAAMLEGEVLLLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+    +++ G  Y+NDAFS +HRAHAS  GL+ LLPS  GR M+ EL  LE+ 
Sbjct: 123 GEEKNDPELAAAMAKLGQVYVNDAFSAAHRAHASTEGLARLLPSAAGRLMEAELKALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA+VGG+KVSTK+ LL NLV +VD LVIGGGMAN+FLVAQG+ VG+SL +RD
Sbjct: 183 LGHPERPVVAVVGGAKVSTKLDLLGNLVGRVDHLVIGGGMANTFLVAQGIEVGKSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + C I +P DVVVARE K G   + V   + P D++ILD G KTV 
Sbjct: 243 MADTAREILSKAKAAGCTIHLPLDVVVAREFKAGAANETVETAACPADAMILDAGPKTVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V A A+T++WNGPLG FEIEPFD AT   A  VA+LTK  ++IS+AGGGDT+ AL 
Sbjct: 303 ALSEVFASAKTLIWNGPLGAFEIEPFDAATNAAALQVAQLTKAGQLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG +  F+Y+STAGGAFLEW+EGK+LPG+ AL+
Sbjct: 363 KAGAAEGFSYISTAGGAFLEWMEGKELPGVAALT 396


>gi|332557921|ref|ZP_08412243.1| phosphoglycerate kinase [Rhodobacter sphaeroides WS8N]
 gi|332275633|gb|EGJ20948.1| phosphoglycerate kinase [Rhodobacter sphaeroides WS8N]
          Length = 397

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 280/394 (71%), Gaps = 2/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G   L+RVD NVP  +G+V D TRIE++VPT+ ++++K  K V+ +H GR
Sbjct: 4   KTLDDM-DLAGKVVLVRVDVNVPMENGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVV-SIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+ K   + SL  V+ ++ +++    + F  DC+G    Q++A++ EG ++L EN RF++
Sbjct: 63  PKGKVVDEMSLRLVLPALQKALPGTKVSFAADCVGREPEQAVAAMLEGEVLLLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+    +++ G  Y+NDAFS +HRAHAS  GL+ LLPS  GR M+ EL  LE+ 
Sbjct: 123 GEEKNDPELAAAMAKLGQVYVNDAFSAAHRAHASTEGLARLLPSAAGRLMEAELKALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA+VGG+KVSTK+ LL NLV +VD LVIGGGMAN+FLVAQG+ VG+SL +RD
Sbjct: 183 LGHPERPVVAVVGGAKVSTKLDLLGNLVGRVDHLVIGGGMANTFLVAQGIEVGKSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +AK + C I +P DVVVARE K G   + V   + P D++ILD G KTV 
Sbjct: 243 MADTAREILSKAKAAGCTIHLPLDVVVAREFKAGAANETVETAACPADAMILDAGPKTVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V A A+T++WNGPLG FEIEPFD AT   A  VA+LTK  ++IS+AGGGDT+ AL 
Sbjct: 303 ALSEVFASAKTLIWNGPLGAFEIEPFDAATNAAALQVAQLTKAGQLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG +  F+Y+STAGGAFLEW+EGK+LPG+ AL+
Sbjct: 363 KAGAAEGFSYISTAGGAFLEWMEGKELPGVAALT 396


>gi|148555518|ref|YP_001263100.1| phosphoglycerate kinase [Sphingomonas wittichii RW1]
 gi|166987815|sp|A5V9J6|PGK_SPHWW RecName: Full=Phosphoglycerate kinase
 gi|148500708|gb|ABQ68962.1| phosphoglycerate kinase [Sphingomonas wittichii RW1]
          Length = 397

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/393 (47%), Positives = 261/393 (66%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+RG R L+R D NVP     V D TR+    PT+ EL +K A V++ +H G
Sbjct: 3   FRTLDDIGDVRGKRVLVREDLNVPMEGAAVTDDTRLRSAAPTVAELADKGAIVLVLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  V +   S+L + + FV DC G     ++A L  G I L EN RF+ 
Sbjct: 63  RPKGERNPEMSLALVTAAFRSVLGREVRFVGDCCGEEAEAAVAQLQPGDIALLENTRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP   + +++ GD Y+NDAFS +HRAHAS  GL+ LLP++ GR+MQ EL  LE  
Sbjct: 123 GEEKNDPALAQAMAKLGDLYVNDAFSAAHRAHASTEGLARLLPAFAGRSMQAELEALEKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + + P+ A+VGG+KVSTK+ +L +LV +VD L+IGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 183 LGKPEHPVAAVVGGAKVSTKLDVLKHLVARVDHLIIGGGMANTFLAARGVDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    I   A  + C + +P DVVVA+E K   PT+ V+   V  D +ILDVG   VE
Sbjct: 243 LKDTALAILDAADAADCIVHLPYDVVVAKEFKPNPPTRTVNVHEVAADEMILDVGPAAVE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   +   RT++WNGPLG FE  PFD ATV +A   A LTK   ++S+AGGGDT+ AL 
Sbjct: 303 ALGDALKTCRTLVWNGPLGAFETPPFDTATVALARTAAALTKGGSLVSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++ +F++VSTAGGAFLEW+EG++LPG+ AL
Sbjct: 363 HAGVAGDFSFVSTAGGAFLEWMEGRELPGVKAL 395


>gi|167644732|ref|YP_001682395.1| phosphoglycerate kinase [Caulobacter sp. K31]
 gi|254782195|sp|B0SUL9|PGK_CAUSK RecName: Full=Phosphoglycerate kinase
 gi|167347162|gb|ABZ69897.1| Phosphoglycerate kinase [Caulobacter sp. K31]
          Length = 396

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/393 (49%), Positives = 259/393 (65%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT+ D  D+ G R L+RVD+NVP   GK+ D TR+   +PTI  L  K AKVV+ +H  
Sbjct: 3   FRTL-DTADLAGKRALVRVDFNVPVDGGKITDDTRLRAALPTIRYLSSKGAKVVLLAHFD 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V      +L + + F  DC+G      + +L  GG+ L ENVRF++
Sbjct: 62  RPKGKVVPEMSLAFVAEPLSKLLEQPVAFAADCVGPQARAVVDALENGGVALFENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+ND DF   L+ NGD Y+NDAFS +HRAHAS   L+ +LPSY G AMQ+EL  L++ 
Sbjct: 122 GEEKNDADFAAQLAENGDLYVNDAFSAAHRAHASTEALARILPSYPGLAMQRELDALDAA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               KKP++ IVGGSKVSTK+ LL NLV K+D L IGGGMAN+FL A  + VG SLC+ D
Sbjct: 182 LGNPKKPVLGIVGGSKVSTKLDLLRNLVTKLDYLAIGGGMANTFLHAAKIDVGASLCEAD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   QI   A  + C++++P DVVVA E+K G+     +   V  +  ILD G  TV 
Sbjct: 242 MADTALQIIDLAAAAGCKLLLPTDVVVAHEVKPGVAAYTRNVYEVQPEDRILDAGPDTVA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   +  ++T++WNGPLGVFE+ PFD ATV  A + AKL K  +I+++AGGGDT+ AL 
Sbjct: 302 TLLAAMDASQTLIWNGPLGVFEVPPFDEATVSAAKHAAKLAKSGKIVAVAGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG+S +FT+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 362 HAGVSGDFTFVSTAGGAFLEWMEGKTLPGVSAL 394


>gi|83591561|ref|YP_425313.1| phosphoglycerate kinase [Rhodospirillum rubrum ATCC 11170]
 gi|83574475|gb|ABC21026.1| phosphoglycerate kinase [Rhodospirillum rubrum ATCC 11170]
          Length = 397

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 265/397 (66%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL D+ G R L+R D NVP  DG V D TRI+R   TIL L  + A VV+ S
Sbjct: 1   MASFKTIDDL-DVNGKRVLVRADLNVPIRDGVVTDTTRIDRSAETILALASRGACVVVCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVS-IAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           H GRP+ K   + SL  +V  ++ ++    + F  DC+G      +  L+ G + L EN+
Sbjct: 60  HFGRPKGKRVPEMSLRPIVEPLSRALGGVPVAFAEDCVGPAAELVVNGLAPGEVALLENL 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP F + L+   D Y+NDAFS +HRAHAS   ++ L+P+  GR MQ EL  
Sbjct: 120 RFHDEEEKNDPAFAQKLADLCDLYVNDAFSSAHRAHASTEYIARLVPAAAGRLMQAELEA 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P+ AIVGG+KVSTK+ LL NLV KVD ++IGGGMAN+FL AQG+ +G SL
Sbjct: 180 LGKALDNPERPVAAIVGGAKVSTKLELLGNLVSKVDMIIIGGGMANTFLFAQGIEIGASL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D +D    I  +A  + CEI++P D VVA   K G    VV+  +VP D +ILDVG 
Sbjct: 240 CEKDMADTARAILEKAAAAKCEIVLPIDAVVASAFKEGAENHVVAIDAVPADKMILDVGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T + +   + + +T++WNGP G FEI+PFD AT  VA   A+ T E R++++AGGGDT+
Sbjct: 300 QTAQAVIAKLGECKTLVWNGPFGAFEIKPFDAATNTVAQAAAQATAEGRLLTVAGGGDTV 359

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +ALA+AG+ ++F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 360 SALANAGVEDKFSYVSTAGGAFLEWLEGKTLPGVAAL 396


>gi|329849751|ref|ZP_08264597.1| phosphoglycerate kinase [Asticcacaulis biprosthecum C19]
 gi|328841662|gb|EGF91232.1| phosphoglycerate kinase [Asticcacaulis biprosthecum C19]
          Length = 398

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/395 (47%), Positives = 267/395 (67%), Gaps = 3/395 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
             T++D+ D+ G   L+RVD+NVP  +G++ D TR+   +PTI +L  K AKV + +H  
Sbjct: 3   FNTLDDVSDLTGKTALVRVDFNVPMENGRITDDTRLRVAIPTIEKLRSKGAKVALLAHFD 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  +      +L   + F +DC+G   S  +  L  G + L ENVRF++
Sbjct: 63  RPKGKVVPEMSLRPIAGPLSELLGITVGFASDCVGPAASDLLKLLPAGSVALLENVRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+F + L+  GD Y+NDAFS +HRAHAS  G++ LLP+Y G +M++EL  LE+ 
Sbjct: 123 GEEKNDPEFAQALADIGDIYVNDAFSAAHRAHASTEGVARLLPAYAGESMRRELDALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P + IVGGSKVSTK+ LL NLV K+D L IGGGMAN+FL AQG+ VG SLC++D
Sbjct: 183 LGNPQRPTLGIVGGSKVSTKLDLLKNLVGKLDALAIGGGMANTFLFAQGVDVGGSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP--TQVVSAQSVPLDSIILDVGFKT 301
             +   +I  EA+   C I++P DVVVA+E K   P  TQ + A  +  +  I D G KT
Sbjct: 243 LKETALEILTEAEAKGCRILLPVDVVVAQEFKAHAPSRTQDIDA-PLSAEDKIFDAGPKT 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  + +V+AQ++T++WNGPLGVFE+ PFD ATV  A + A  TK  +++++AGGGDT+ A
Sbjct: 302 VAQLNEVMAQSKTLIWNGPLGVFELPPFDAATVAAAKFAAAQTKSGKLVAVAGGGDTVAA 361

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG++++ T+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 362 LNHAGVADDMTFVSTAGGAFLEWMEGKVLPGVAAL 396


>gi|307293278|ref|ZP_07573124.1| Phosphoglycerate kinase [Sphingobium chlorophenolicum L-1]
 gi|306881344|gb|EFN12560.1| Phosphoglycerate kinase [Sphingobium chlorophenolicum L-1]
          Length = 400

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/394 (47%), Positives = 266/394 (67%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ DI G   L+R D NVP  DG V D TR+   +PT+LEL ++ AKV+I +H G
Sbjct: 5   FKTLDDMGDITGKVVLVREDLNVPMQDGSVTDDTRLRAAMPTVLELADRGAKVLILAHFG 64

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL K+     ++L + + F+ DC G   +  I  +  G I + EN RF++
Sbjct: 65  RPKGQKNPEYSLSKITRPLTAVLGREVQFIPDCQGEAATDGIKVMRNGDIAILENTRFHA 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP     ++  GD Y+NDAFS +HRAH S  GL+H LP++ GR+M+KEL  L++ 
Sbjct: 125 GEEKNDPALADAMAAIGDLYVNDAFSAAHRAHVSTEGLAHKLPAFAGRSMEKELDALQAA 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             E  KP+ A+VGG+KVSTK+ +L NLV KVD L+IGGGMAN+FL A+G+ +G+SLC++D
Sbjct: 185 LGEPVKPVAAVVGGAKVSTKLDVLNNLVAKVDHLIIGGGMANTFLFARGVDIGKSLCEKD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGFKTV 302
            +     I  +A+ + C I +P DVVV++E     P+ +  +   V  D +ILDVG   V
Sbjct: 245 LAATAEAIFDKAEAAGCTIHLPYDVVVSKEFAANPPSLRTCNVHEVAADEMILDVGPAAV 304

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E +   I   RT++WNGPLG FE+ PFD+ATV +A   A LTKE  + S+AGGGDT+ AL
Sbjct: 305 EALGDAIKNCRTLVWNGPLGAFEMAPFDKATVALAKTAAALTKEGGLTSVAGGGDTVAAL 364

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG++ +F++VSTAGGAFLEW+EGK+LPG+ AL
Sbjct: 365 NHAGVAGDFSFVSTAGGAFLEWMEGKELPGVKAL 398


>gi|304320121|ref|YP_003853764.1| phosphoglycerate kinase [Parvularcula bermudensis HTCC2503]
 gi|303299024|gb|ADM08623.1| phosphoglycerate kinase [Parvularcula bermudensis HTCC2503]
          Length = 403

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/396 (46%), Positives = 269/396 (67%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL D+ G R L+RVD+NVP    +V+D TR+ER VPT+ ELV++KA+V++ S
Sbjct: 1   MAAFKTLDDL-DVGGKRVLVRVDFNVPMDGDRVSDTTRLERAVPTVRELVDRKARVILLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  V      +L + + FV +  G    +++A L++G ++L EN R
Sbjct: 60  HFGRPKGARVPEMSLRPVADAFAGVLGRPVSFVEESRGEIAERAVAGLADGDVLLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F + EE+N  D+   L++ GDFY+NDAFS +HRAHAS  G++  LPS  GR+MQ+EL  L
Sbjct: 120 FEAGEEKNAADYADDLAKLGDFYVNDAFSAAHRAHASTEGIAQRLPSAAGRSMQRELDYL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  K+P++A+VGG+KVSTK+ +L NL++K DKLV+GGGMAN+FL+A+GM +G+SL 
Sbjct: 180 ALALAAPKRPVMAVVGGAKVSTKLDVLENLIEKADKLVVGGGMANTFLLAKGMDIGKSLA 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +     IA +A    C +++P+DVVVA+E      T+V +   V  D +ILDVG +
Sbjct: 240 EPDLAATARSIADKAAAQGCALLLPKDVVVAKEFAPNPDTRVCAPDDVAADEMILDVGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+     +    T++WNGPLG FE  PF  ATVE+A + AKL+    + SIAGGGDT+ 
Sbjct: 300 SVDQYAAELEGCATLLWNGPLGAFETPPFHTATVELAKFGAKLSVAGALTSIAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  A  + +FTYVSTAGGAFLE++EGK LPG+ AL
Sbjct: 360 ALNVAQAAEDFTYVSTAGGAFLEFIEGKTLPGVAAL 395


>gi|146277144|ref|YP_001167303.1| phosphoglycerate kinase [Rhodobacter sphaeroides ATCC 17025]
 gi|166987804|sp|A4WRI4|PGK_RHOS5 RecName: Full=Phosphoglycerate kinase
 gi|145555385|gb|ABP69998.1| phosphoglycerate kinase [Rhodobacter sphaeroides ATCC 17025]
          Length = 397

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/394 (49%), Positives = 281/394 (71%), Gaps = 2/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G   L+RVD NVP   G+V D TRIE++VPT+ ++++K  K V+ +H GR
Sbjct: 4   KTLDDM-DLAGKVVLVRVDVNVPMEKGEVTDATRIEKIVPTVEDILKKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVV-SIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+ K   + SL  V+ ++ +++    + F  DC+G    +++A++ EG ++L EN RF++
Sbjct: 63  PKGKVVDEMSLRLVLPALQKALPGTKVSFAPDCVGEEAEKAVAAMLEGEVLLLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+    +++ GD Y+NDAFS +HRAH+S  G++ LLPS  GR M+ EL  L++ 
Sbjct: 123 GEEKNDPELAAAMAKLGDVYVNDAFSAAHRAHSSTEGIARLLPSAAGRLMEAELKALDAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + ++P+VA+VGG+KVSTK+ LL NLV +VD LVIGGGMAN+FLVAQG  VG+SL +RD
Sbjct: 183 LGQPERPVVAVVGGAKVSTKLDLLGNLVGRVDHLVIGGGMANTFLVAQGTEVGKSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            ++   +I  +AK + C I +P DVVVARE K G   + V A + P D++ILD G KTV 
Sbjct: 243 MAETAREIVAKAKAAGCTIHLPLDVVVAREFKAGAANETVEAGACPADAMILDAGPKTVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V A ART++WNGPLG FEIEPFD AT   A  VA+LTK  ++IS+AGGGDT+ AL 
Sbjct: 303 ALSEVFASARTLIWNGPLGAFEIEPFDAATNAAALQVAQLTKAGQLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG +  F+Y+STAGGAFLEW+EGK+LPG+ AL+
Sbjct: 363 KAGAAEGFSYISTAGGAFLEWMEGKELPGVAALN 396


>gi|94496495|ref|ZP_01303072.1| Phosphoglycerate kinase [Sphingomonas sp. SKA58]
 gi|94424241|gb|EAT09265.1| Phosphoglycerate kinase [Sphingomonas sp. SKA58]
          Length = 400

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/396 (47%), Positives = 266/396 (67%), Gaps = 1/396 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ DI G   L+R D NVP  DG V D TR+   +PT+LEL ++ AKV+I +H G
Sbjct: 5   FKTLDDMGDITGKVVLVREDLNVPMQDGSVTDDTRLRAAMPTVLELADRGAKVLILAHFG 64

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL K+      +L + + F+ DC G      I  +  G I + EN RFY+
Sbjct: 65  RPKGQKNPEFSLSKITRPLTQVLGREVQFIPDCQGEAAVDGIKMMRNGDIAILENTRFYA 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP  V  ++  GD Y+NDAFS +HRAHAS  GL+  +P++ GR+M++EL  L++ 
Sbjct: 125 GEEKNDPALVDAIAAIGDLYVNDAFSAAHRAHASTEGLARKMPAFAGRSMERELDALQAA 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             E  KP+ A+VGG+KVSTK+ +L NLV KVD L+IGGGMAN+FL A+G+ +G+SLC+++
Sbjct: 185 LGEPVKPVAAVVGGAKVSTKLDVLNNLVAKVDHLIIGGGMANTFLYARGVDIGKSLCEKE 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGFKTV 302
            SD V  I   A+ + C I +P DVVVA+E      + +  +   V  D +ILDVG   V
Sbjct: 245 LSDTVDTIFDRAEAAGCTIHLPYDVVVAKEFAAHPASLRTCNVHEVAEDEMILDVGPAAV 304

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E +   +   RT++WNGPLG FEI PFD ATV +A   A LTKE ++ S+AGGGDT+ AL
Sbjct: 305 EALGDALKNCRTLVWNGPLGAFEIAPFDAATVALAKTAAALTKEGQLTSVAGGGDTVAAL 364

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            HAG++ +F++VSTAGGAFLEW+EGKDLPG+ AL G
Sbjct: 365 NHAGVAADFSFVSTAGGAFLEWMEGKDLPGVKALMG 400


>gi|254467310|ref|ZP_05080721.1| phosphoglycerate kinase [Rhodobacterales bacterium Y4I]
 gi|206688218|gb|EDZ48700.1| phosphoglycerate kinase [Rhodobacterales bacterium Y4I]
          Length = 396

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 268/392 (68%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP +DG V D TRI R+ PT+ +++    K ++ +H GR
Sbjct: 4   KTLDDM-DLNGKRVLVRVDINVPIVDGVVTDSTRIRRIAPTVRDILAAGGKPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +  ++ SL ++V   E      +LF  DC+G+    +  +L  G ++L EN RF++ 
Sbjct: 63  PGGERRENLSLNQLVPTLERAFETRVLFAADCVGAGAEAAADALQPGEVLLLENTRFHAA 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +NDPD    ++R G+ Y NDAFS +HRAH+S   ++ LLP+  GR MQ EL  LES  
Sbjct: 123 ETKNDPDLAAGMARLGEVYCNDAFSAAHRAHSSTEAIARLLPACAGRLMQAELEALESAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
            + K+P+ A+VGG+KVSTK+ LL NL++KVD LVIGGGMAN+FLVA+G+ VG SL +R  
Sbjct: 183 GKPKRPVTAVVGGAKVSTKLELLGNLIEKVDHLVIGGGMANTFLVAKGLPVGISLAERIM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +I  +A+ + CEII+P D+VVA++ +   P +++ A   P D +ILD G +++  
Sbjct: 243 KDTAAEILAKAEAAGCEIILPTDIVVAKKFEAHAPHEILPADQCPEDGMILDAGPESLAR 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I +V ++++T++WNGPLG FE+EPFD AT   A   A +T+  ++IS+AGGGDT+ AL  
Sbjct: 303 IIEVFSKSKTLIWNGPLGAFELEPFDAATNAAALKAAAMTRSGQLISVAGGGDTVAALNA 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 SGAAGDFTYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|148260225|ref|YP_001234352.1| phosphoglycerate kinase [Acidiphilium cryptum JF-5]
 gi|326403411|ref|YP_004283492.1| phosphoglycerate kinase [Acidiphilium multivorum AIU301]
 gi|146401906|gb|ABQ30433.1| phosphoglycerate kinase [Acidiphilium cryptum JF-5]
 gi|325050272|dbj|BAJ80610.1| phosphoglycerate kinase [Acidiphilium multivorum AIU301]
          Length = 397

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/397 (48%), Positives = 265/397 (66%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  R ++ + D+RG R L+R D NVP  DG++ D+TRIER+ PTI+EL  K AKV++ S
Sbjct: 1   MADWRPLDGV-DVRGKRVLVRADLNVPLRDGRITDLTRIERLSPTIVELAGKGAKVIVLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H  RP+ K   D SL  V +   ++L +   F  DCIG     ++A+++EG I++ EN R
Sbjct: 60  HFDRPKGKVVPDMSLRPVAAALGAVLRRPTAFAADCIGPEAEAAVAAMAEGDILVLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE NDP   + ++ NGD ++NDAFS +HRAHA+  GL+HLLP+Y GR MQ EL+ L
Sbjct: 120 FHPGEESNDPALAKAIAANGDIFVNDAFSAAHRAHATTEGLAHLLPAYAGRLMQAELAAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E+  S  K+P+ AIVGGSKVSTK+ LL NL+ KVD LVIGG MAN+FL AQG  +G+SL 
Sbjct: 180 EAALSHPKRPVGAIVGGSKVSTKLDLLTNLITKVDLLVIGGAMANTFLAAQGAELGKSLQ 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +    D    I   A    C I++P D VV+       PT+ V A +VP +++ LDVG  
Sbjct: 240 EPALHDTARAIVESAATHGCRILLPSDFVVSETFAPNPPTETVPANAVPANAMALDVGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E I   + + +T++WNGPLG FE  PFD +T+ +A  VA+ T    +IS+AGGGDT+ 
Sbjct: 300 TTETIIAAVKELKTLIWNGPLGAFETPPFDTSTMRLAIAVAEATAG-GLISVAGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL  AG+++  TYVS+AGGAFLEW+EGK LPG+ AL+
Sbjct: 359 ALRLAGVTDRLTYVSSAGGAFLEWMEGKTLPGVAALA 395


>gi|310815653|ref|YP_003963617.1| phosphoglycerate kinase [Ketogulonicigenium vulgare Y25]
 gi|308754388|gb|ADO42317.1| phosphoglycerate kinase [Ketogulonicigenium vulgare Y25]
          Length = 395

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 263/385 (68%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G + LLRVD NVP    +V D TRI+R+VPT+  +       ++ +H  RP+ K   
Sbjct: 10  DLAGKKVLLRVDINVPMEGERVLDTTRIDRIVPTVKAIQAAGGSAILLAHFDRPKGKVVP 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL +V     + L +++ F +DCIG+    ++A+L +GG++L EN RF++ EE NDP 
Sbjct: 70  EMSLSRVRPALSAALGEDVAFASDCIGAPAEAAVAALPKGGVLLLENTRFHAGEEANDPA 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F   L++ GD Y NDAFS +HRAHAS  GL+ LLP+  G  M +ELS LE+  +  ++P+
Sbjct: 130 FAADLAKLGDIYCNDAFSAAHRAHASTEGLARLLPACAGLLMAEELSALEAALTTPERPV 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAIVGG+KVS+K+ LL NL+ KVD LVIGGGMAN+FL A G  VG+SLC+ D +     I
Sbjct: 190 VAIVGGAKVSSKLDLLSNLITKVDYLVIGGGMANTFLAANGADVGKSLCEHDLAPTARAI 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A+ + C II+P DVVVARE K     ++V+A + P D++ILD G  TV+ + +V A+
Sbjct: 250 TEKAEGAGCTIILPVDVVVAREFKANAAHEIVAADACPPDAMILDAGPATVDALAEVFAK 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
            +T++WNGPLG FE+ PFD AT   A   A L++   ++++AGGGDT+ AL HAG++ +F
Sbjct: 310 CKTLVWNGPLGAFELTPFDAATNAAAQAAAALSRAGALVTVAGGGDTVGALNHAGVAGDF 369

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           TY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 370 TYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|126725370|ref|ZP_01741212.1| phosphoglycerate kinase [Rhodobacterales bacterium HTCC2150]
 gi|126704574|gb|EBA03665.1| phosphoglycerate kinase [Rhodobacterales bacterium HTCC2150]
          Length = 413

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/392 (49%), Positives = 267/392 (68%), Gaps = 5/392 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+   R L RVD NVP  DG+V D TRI+R++PT+ ++  K  KV++ +H  R
Sbjct: 26  KTLDDM-DLANKRVLCRVDINVPMADGQVTDTTRIDRIIPTVKDIQAKGGKVILLAHFDR 84

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   + SL +VV   E+   +++ F     G+    +IA+++   I+LAEN+RF   
Sbjct: 85  PKGKVVPEMSLAQVVPALEAAFGQSVTFCAKDYGT----AIAAMASDDILLAENLRFNPG 140

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP FV  L+  GD Y+NDAFS +HRAHAS TGL+H LP+  GR M  EL  LE+  
Sbjct: 141 EEANDPAFVARLASMGDVYVNDAFSAAHRAHASTTGLAHALPACAGRLMAMELGALEAAL 200

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  K+P+VA+VGG+KVSTK+ LL NLVKKVD LVIGGGMAN+FL+A    +G+SL +RD 
Sbjct: 201 SVPKRPVVAVVGGAKVSTKLELLSNLVKKVDHLVIGGGMANTFLIATSAEIGKSLAERDL 260

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +D   +I   AK + C I +P D+VVARE K G   Q ++  + P D++ILD G  TV  
Sbjct: 261 ADTAREITASAKAAGCTIHLPLDIVVAREFKAGAENQTLATDACPDDAMILDAGPATVAA 320

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           ++ + A   T++WNGPLG FEIEPFD AT   A   A L++  ++IS+AGGGDT+ AL  
Sbjct: 321 LRDLFATCETLIWNGPLGAFEIEPFDFATNGAAKAAADLSRAGKLISVAGGGDTVAALNQ 380

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG +++FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 381 AGAADDFTYISTAGGAFLEWMEGKTLPGVAAL 412


>gi|56697098|ref|YP_167461.1| phosphoglycerate kinase [Ruegeria pomeroyi DSS-3]
 gi|81676227|sp|Q5LR94|PGK_SILPO RecName: Full=Phosphoglycerate kinase
 gi|56678835|gb|AAV95501.1| phosphoglycerate kinase [Ruegeria pomeroyi DSS-3]
          Length = 398

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/392 (46%), Positives = 266/392 (67%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP +DG V D TRI R++PTI +++    + ++ +H GR
Sbjct: 4   KTLDDM-DLTGKRVLVRVDINVPIVDGVVTDSTRIRRLMPTIRDILAAGGRPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +  K+ SL ++V   E      +LF +DC+G    ++  +L  G ++L EN RF++ 
Sbjct: 63  PGGERRKNLSLGQLVPTLERAFETKVLFADDCVGPAAEEAAEALQPGQVLLLENTRFHAS 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +NDPD    ++R GD Y NDAFS +HRAH+S   ++ LLPS  GR MQ EL  LE   
Sbjct: 123 ETKNDPDLAAGMARLGDIYCNDAFSAAHRAHSSTEAIARLLPSCAGRLMQAELEALEKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
            + ++P+ A+VGG+KVSTK+ LL NL++KVD LVIGGGMAN+FLVA+G+ VG+SL +R  
Sbjct: 183 GKPERPVTAVVGGAKVSTKLELLGNLIEKVDYLVIGGGMANTFLVAKGLPVGKSLAERIM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +I  +A+ + C I++P DVVVA + ++  P Q++     P + +ILD G  ++  
Sbjct: 243 KDTAAEILAKAEAAGCTIVLPSDVVVAEKFESHAPHQILPNDRCPDEGMILDAGPDSLAA 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           IK +  ++RT++WNGPLG FE+EPFD AT   A   A LT+  ++IS+AGGGDT+ AL  
Sbjct: 303 IKAIFEKSRTLIWNGPLGAFELEPFDAATNAAALKAAALTRAGKLISVAGGGDTVAALNA 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 SGAAGDFTYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|254418920|ref|ZP_05032644.1| phosphoglycerate kinase [Brevundimonas sp. BAL3]
 gi|196185097|gb|EDX80073.1| phosphoglycerate kinase [Brevundimonas sp. BAL3]
          Length = 398

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/394 (48%), Positives = 269/394 (68%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D +D+ G   L+RVD+NVP  DGKV D TR+   +PTI  L +  AKV + +H  
Sbjct: 3   FRTLDDAKDLAGKTALVRVDFNVPMEDGKVTDDTRLRVALPTIQRLRDAGAKVALLAHFD 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +     SL  VV   E++L   + F +DCIG     +I  L  GG++L ENVRF++
Sbjct: 63  RPKGQRVPSMSLKPVVDDLENLLGAPVRFADDCIGPDAVDAIRDLDAGGVVLLENVRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE NDP F + L+  GD Y+NDAFS +HRAHAS  G++H LP+Y G +M++EL  L++ 
Sbjct: 123 AEEANDPVFAQKLADLGDLYVNDAFSAAHRAHASTEGIAHHLPAYAGESMRRELDALDAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP++ IVGG+KVSTK+ LL NLV K+D+L IGGGMAN+FL AQG+ +G SL +RD
Sbjct: 183 LGNPQKPVLGIVGGAKVSTKLDLLKNLVGKLDRLAIGGGMANTFLFAQGIDIGGSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQ-VVSAQSVPLDSIILDVGFKTV 302
            +D   +I  EA+   C++++P D VVA E+K G  ++ V++  ++  D  ILD G  TV
Sbjct: 243 MADTAREIMAEAEAKGCKLLLPVDFVVATEVKPGAASRPVIAGAALSADDKILDAGPATV 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             +   +  ++T++WNGPLGVFE+ PFD ATV VA + A L K   ++++ GGGDT++AL
Sbjct: 303 ARLLDALTASKTLIWNGPLGVFEVPPFDAATVTVARHAAALAKAGVLVAVGGGGDTVSAL 362

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG+S++ T+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 363 NHAGVSDDMTFVSTAGGAFLEWMEGKPLPGVEAL 396


>gi|114571140|ref|YP_757820.1| phosphoglycerate kinase [Maricaulis maris MCS10]
 gi|122315206|sp|Q0ALG1|PGK_MARMM RecName: Full=Phosphoglycerate kinase
 gi|114341602|gb|ABI66882.1| phosphoglycerate kinase [Maricaulis maris MCS10]
          Length = 403

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/398 (47%), Positives = 257/398 (64%), Gaps = 1/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+ +R + D  D+ G R L+RVD+NVP  DG+V D TR+E  +PTI  L E  AKVV+ +
Sbjct: 1   MTEIRRIQD-ADVAGKRVLVRVDFNVPMKDGQVTDATRLEAALPTIEYLTEAGAKVVLLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  V      +L   + F     G     +   L  G ++L EN R
Sbjct: 60  HFGRPKGAVVPEMSLEAVCQPLADLLGDAVYFSTVTSGEDAVAATMDLEAGEVLLIENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F + EE NDP F   L+  GD Y+NDAFS +HRAHAS  G++H LPSY G A+Q+E+  L
Sbjct: 120 FAAGEETNDPGFAAALAELGDLYVNDAFSAAHRAHASTEGITHHLPSYAGLALQREIDHL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +     K+P++A+VGG+KVSTKI LL NLVKKVD L +GGGMAN+ L AQG+ VG SLC
Sbjct: 180 VAALESPKRPVIALVGGAKVSTKIDLLQNLVKKVDTLFVGGGMANTLLHAQGIKVGSSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I   A+ S C++++P DVV+A+E K    T++ +   V  + +ILD G  
Sbjct: 240 ETDLVDTARAIFAAAEESGCKLMLPTDVVLAKEFKPNPETRLAAVTDVEDNEMILDCGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  + Q I ++ T++WNGPLG FE  PFD ATVE A Y A+   E  +I++AGGGDT++
Sbjct: 300 TVVALGQAIDRSATLIWNGPLGAFETPPFDAATVEAAKYAARAAVEGELIAVAGGGDTVS 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AL  AG+S +FT++STAGGAFLEW+EGK LPGI A+ G
Sbjct: 360 ALNQAGVSGDFTFISTAGGAFLEWMEGKTLPGIAAVMG 397


>gi|254462124|ref|ZP_05075540.1| phosphoglycerate kinase [Rhodobacterales bacterium HTCC2083]
 gi|206678713|gb|EDZ43200.1| phosphoglycerate kinase [Rhodobacteraceae bacterium HTCC2083]
          Length = 396

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/392 (50%), Positives = 271/392 (69%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T  D  D+ G R L RVD NVP  +G V D TRIER+VPT+ +++      ++ +H GRP
Sbjct: 4   TTLDQMDLAGKRVLTRVDINVPMENGVVTDATRIERLVPTVRDILAAGGLPILLAHFGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  +V   E+    +++F  DCIG+  + +  +L  G +++ EN R+++EE
Sbjct: 64  KGQRVPEMSLQPLVPALETAFGCDVMFSADCIGAGANAAACALQAGQVLVLENTRYHAEE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
             NDP F   +++ GD Y NDAFS +HRAHAS  GL+HLLPS  GR MQ ELS LE   S
Sbjct: 124 PANDPTFAAEIAKLGDIYCNDAFSAAHRAHASTEGLAHLLPSCAGRLMQAELSALEGALS 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             K+P+VA+VGG+KVS+K+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG+SL + D +
Sbjct: 184 APKRPVVAVVGGAKVSSKLELLGNLVEKVDHLVIGGGMANTFLAAQGIDVGKSLAEHDMT 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
           +   +I  +AK + CEI++P D+VVARE K G  ++ +   + P D++ILD G KTV  I
Sbjct: 244 NTALEILGKAKSARCEIVLPSDIVVAREFKAGADSETLPVNACPSDAMILDAGPKTVARI 303

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
             ++  A+T++WNGPLG FEI+PFD AT   A Y A L+K+ ++IS+AGGGDT+ AL  A
Sbjct: 304 STILDGAKTLIWNGPLGAFEIDPFDMATNAAATYAADLSKQGKLISVAGGGDTVAALNQA 363

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           G + +FTY+STAGGAFLEW+EGK LPG+ ALS
Sbjct: 364 GAAEKFTYISTAGGAFLEWMEGKTLPGVAALS 395


>gi|83950360|ref|ZP_00959093.1| phosphoglycerate kinase [Roseovarius nubinhibens ISM]
 gi|83838259|gb|EAP77555.1| phosphoglycerate kinase [Roseovarius nubinhibens ISM]
          Length = 394

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/394 (50%), Positives = 265/394 (67%), Gaps = 3/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L RVD NVP  +GKV D TRIER+ PT+  ++ +    V+ +H GR
Sbjct: 4   KTLDDM-DLAGKRVLTRVDINVPVENGKVTDATRIERIAPTVEHILSQGGIPVLIAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   D SL  V+   E+ L   + FV    G+      A  +E  ++L EN+RFY  
Sbjct: 63  PKGKVVLDMSLRIVLPALEAALGHKVGFVETLEGAENLTGEARAAE--VLLLENIRFYPG 120

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP+F   L+  GD Y NDAFS +HRAHAS  G++  LPS  GR MQ EL  LE+  
Sbjct: 121 EEANDPEFAARLAGLGDIYCNDAFSAAHRAHASTAGVAEHLPSCAGRLMQAELQALEAAL 180

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              ++P+VA+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG SLC+ D 
Sbjct: 181 GAPERPVVAVVGGAKVSTKLDLLGNLVDKVDHLVIGGGMANTFLAAQGLNVGASLCEHDM 240

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +D   QI  +A  + CEI++P DVVVARE   G   +VV A + P D++ILD G ++V  
Sbjct: 241 ADTARQIMVKAGAAGCEILLPADVVVAREFAAGAENEVVPAHACPEDAMILDAGPQSVAR 300

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           +  V+A+A+T++WNGPLG FEI PFD AT   A   A+L++E  +IS+AGGGDT+ AL  
Sbjct: 301 VAAVLAKAKTLIWNGPLGAFEIAPFDTATNAAAQEAARLSREAGLISVAGGGDTVAALNQ 360

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AG + +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 361 AGAAEDFTYISTAGGAFLEWMEGKTLPGVAALGG 394


>gi|89069556|ref|ZP_01156900.1| phosphoglycerate kinase [Oceanicola granulosus HTCC2516]
 gi|89044891|gb|EAR50981.1| phosphoglycerate kinase [Oceanicola granulosus HTCC2516]
          Length = 391

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/392 (49%), Positives = 276/392 (70%), Gaps = 5/392 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           ++++D+ D+ G R L RVD NVP  DG+V D TRIER+VPT+ ++++K    ++ +H GR
Sbjct: 4   KSLDDM-DLAGKRVLTRVDINVPMEDGRVTDATRIERIVPTVRDILDKGGLPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL  VV   E  L +++ FV    G    +++A   +G ++L ENVRF   
Sbjct: 63  PKGQVVPEMSLRHVVPALEEALGRSVTFVEGGYG----EAVAGAGDGDVLLFENVRFNPG 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND  F   L+  GD Y NDAFS +HRAHA+   L+HLLP+  GR M  EL  LE+  
Sbjct: 119 EEKNDEGFAERLASVGDVYCNDAFSAAHRAHATTEALAHLLPACAGRLMAAELRALEAAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
            + ++P+VA+VGG+KVSTK+ LL NLV +VD LVIGGGMAN+FL AQG+ VG+SLC+ D 
Sbjct: 179 GDPERPVVAVVGGAKVSTKLDLLGNLVTRVDTLVIGGGMANTFLAAQGLDVGKSLCEHDL 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +D   +IA +A  + CEI++PRDVVVARE K G  ++VV A+ VP D++ILD G  +V +
Sbjct: 239 ADTAREIAAKAAEAGCEILLPRDVVVAREFKAGAESEVVKAEDVPADAMILDAGPDSVAH 298

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           +  V  ++RT++WNGPLG FEIEPFD A+   A   A+LT+  ++ S+AGGGDT++AL  
Sbjct: 299 VGMVFERSRTLVWNGPLGAFEIEPFDAASNAAARKAAELTRAGKLTSVAGGGDTVSALNQ 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++++F+Y+STAGGAFLEW+EGK LPG+ AL
Sbjct: 359 AGVADDFSYISTAGGAFLEWMEGKTLPGVAAL 390


>gi|84687407|ref|ZP_01015285.1| phosphoglycerate kinase [Maritimibacter alkaliphilus HTCC2654]
 gi|84664565|gb|EAQ11051.1| phosphoglycerate kinase [Rhodobacterales bacterium HTCC2654]
          Length = 397

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 268/395 (67%), Gaps = 2/395 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T++D+ D+ G   L+RVD NVP  D G V D TRIER+VPT+ ++++K  K V+ +H G
Sbjct: 4   KTLDDM-DLDGKTVLVRVDINVPLDDQGNVTDATRIERIVPTVKDILDKGGKPVLMAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  +V    +     + F ++CIG     +++ L  G ++L EN RF+ 
Sbjct: 63  RPKGKVVPEMSLKPLVPALAAAFDAPVKFADNCIGGPAKIAVSKLEPGEVLLLENTRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EE  N+  F   L+  G+ Y+NDAFS SHRAHAS  G++ ++ +  GR M+ EL  LE+ 
Sbjct: 123 EETDNEASFAAALAALGEVYVNDAFSASHRAHASTEGVARIMTNCAGRLMEAELKALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            S   +P+VA+VGG+KVSTK+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG+SLC+ D
Sbjct: 183 LSNPVRPVVAVVGGAKVSTKLELLGNLVEKVDNLVIGGGMANTFLAAQGIDVGKSLCEHD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   +I  +A  + C+II+P DVVVARE K G   + V+A + P D++ILD G  TV+
Sbjct: 243 MADTAREIMEKADDAGCKIILPTDVVVAREFKAGAENETVAADACPSDAMILDAGPDTVD 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I +    A T++WNGPLG FEIEPFD AT   A     L+KE R+ S+AGGGDT+ AL 
Sbjct: 303 TIAKAFENASTLIWNGPLGAFEIEPFDAATNAAAQKAGALSKEGRLTSVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            AG++++FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 363 KAGVADDFTYISTAGGAFLEWMEGKTLPGVAALEG 397


>gi|86138771|ref|ZP_01057343.1| phosphoglycerate kinase [Roseobacter sp. MED193]
 gi|85824418|gb|EAQ44621.1| phosphoglycerate kinase [Roseobacter sp. MED193]
          Length = 396

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/392 (45%), Positives = 263/392 (67%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D++G R L+RVD NVP +DG V D TRI R+ PT+ +++    + ++ +H GR
Sbjct: 4   KTLDDM-DLKGKRVLVRVDINVPLVDGVVTDSTRIRRIAPTVRDILAAGGRPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +  ++ SL ++V   E      + F  DC+G    ++ ++L  G ++L EN RF++ 
Sbjct: 63  PGGERRENLSLNQLVPTLERAFETPVRFAADCVGEGAKEAASALQPGEVLLLENTRFHAA 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +NDP     ++  GD Y NDAFS +HRAH+S   L+ LLP+  GR MQ EL  LES  
Sbjct: 123 ETKNDPVLAAGMAELGDVYCNDAFSAAHRAHSSTEALARLLPACAGRLMQAELQALESAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              K+P+ A+VGG+KVSTK+ LL NLV+KVD L+IGGGMAN+FLVA+G+ VG SL +R  
Sbjct: 183 GAPKRPVTAVVGGAKVSTKLELLGNLVEKVDYLIIGGGMANTFLVAKGLSVGVSLAERLM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +I  +A+ + C+II+P DVVV  + ++  P QV+     P +S+ILD G ++V+ 
Sbjct: 243 KDTAAKIMAKAESTGCKIILPSDVVVTEKFESHAPHQVLPTDQCPDNSMILDAGPESVKV 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I ++  Q++T++WNGPLG FE EPFD AT   A   A L +  ++I++AGGGDT+ AL  
Sbjct: 303 INEIFEQSKTLIWNGPLGAFEFEPFDAATNAAALKAAALARAGQLIAVAGGGDTVAALNA 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 SGAAGDFTYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|87199982|ref|YP_497239.1| phosphoglycerate kinase [Novosphingobium aromaticivorans DSM 12444]
 gi|123489293|sp|Q2G6W8|PGK_NOVAD RecName: Full=Phosphoglycerate kinase
 gi|87135663|gb|ABD26405.1| phosphoglycerate kinase [Novosphingobium aromaticivorans DSM 12444]
          Length = 395

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/396 (45%), Positives = 266/396 (67%), Gaps = 4/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ D+ G   L+R D NVP  DG V D TR+   + T+ EL +K AKV++ +H G
Sbjct: 3   FKTLDDIGDLTGKTVLVREDLNVPMQDGAVTDDTRLRATIATLNELSDKGAKVLVLAHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +  ++ SL K+ +    +L + + +++     +   ++A+L+ G I + EN RF+ 
Sbjct: 63  RPKGQPSEEFSLKKLAAPLAHVLGRPVSYID---WESDKAAVAALTPGAIAVLENTRFFD 119

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP  +   +  GD Y+NDAFS +HRAHAS  GL+H+LP+Y GRAM+ EL  L+  
Sbjct: 120 GEEKNDPAVIERFASLGDIYVNDAFSAAHRAHASTEGLAHVLPAYAGRAMEAELKALQKA 179

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             E ++P+ A+VGG+KVSTK+ +L +LV KVD L+IGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 180 LGEPERPVAAVVGGAKVSTKLDVLKHLVSKVDHLIIGGGMANTFLAARGVNVGKSLCEHD 239

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGFKTV 302
            +    +I   A +S C + +P DVVV++E     P+ +  +   V  D +ILDVG   V
Sbjct: 240 LTGTAEEILDNADKSGCTVHLPYDVVVSKEFTANPPSLRTCNVHEVAADEMILDVGPAAV 299

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E +  V+   +T++WNGP+G FE EPFD ATV +A   A LTKE  ++S+AGGGDT+ AL
Sbjct: 300 EALADVLKTCKTLVWNGPMGAFETEPFDAATVALARTAAALTKEGSLVSVAGGGDTVAAL 359

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            HAG+  +F+Y+STAGGAFLEW+EGK+LPG+ AL G
Sbjct: 360 NHAGVVGDFSYISTAGGAFLEWMEGKELPGVAALEG 395


>gi|260576741|ref|ZP_05844726.1| Phosphoglycerate kinase [Rhodobacter sp. SW2]
 gi|259020993|gb|EEW24304.1| Phosphoglycerate kinase [Rhodobacter sp. SW2]
          Length = 397

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/394 (48%), Positives = 271/394 (68%), Gaps = 2/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+  + G   LLRVD NVP  +G V D TRIE++VPT+ +++ +  K V+ +H GR
Sbjct: 4   KTLDDVA-LAGKVVLLRVDVNVPMENGVVTDATRIEKIVPTVEDILARGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILH-KNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+ K   + SL  ++   ++ +  + + F  +  G   + ++ ++  G +++ EN RF++
Sbjct: 63  PKGKPVAEMSLGLIIPAMQAAMPGRKVKFCAESTGPVAAAAVKAMVAGEVLVLENTRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+  +  +  GD Y+NDAFS +HRAHAS  G++HLLPS  GR M+ EL  LE+ 
Sbjct: 123 GEEKNDPELAKAFAALGDVYVNDAFSAAHRAHASTEGIAHLLPSAAGRLMEAELRALEAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P+VA+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FLVAQG+ VG+SL +RD
Sbjct: 183 LGNPKRPVVAVVGGAKVSTKLDLLGNLVTKVDHLVIGGGMANTFLVAQGIEVGKSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +AK + C I +P DVVVA E K G   +VV  +  P D++ILD G  TV 
Sbjct: 243 MAPTALEIVAKAKAAGCTIHLPIDVVVAWEFKAGAANKVVDVKDCPADAMILDAGPATVA 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            + +V A A+T++WNGP+G FEIEPFD AT   A  VA LTK   +IS+AGGGDT+ AL 
Sbjct: 303 ALAKVFASAKTLIWNGPMGAFEIEPFDAATNAAALQVAALTKAGGLISVAGGGDTVAALN 362

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG +++FT++STAGGAFLEW+EGK+LPG+ AL+
Sbjct: 363 KAGAADDFTFISTAGGAFLEWMEGKELPGVAALN 396


>gi|126735928|ref|ZP_01751672.1| phosphoglycerate kinase [Roseobacter sp. CCS2]
 gi|126714485|gb|EBA11352.1| phosphoglycerate kinase [Roseobacter sp. CCS2]
          Length = 392

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 268/393 (68%), Gaps = 5/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D  G R L+RVD NVP  DG V D TRIER++PT+ ++ EK  KV++ +H GR
Sbjct: 4   KTLDDM-DFAGKRALVRVDINVPVEDGVVTDTTRIERIIPTVDDIQEKGGKVILMAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL  +      +L   + +VN    S    ++A +    ++L EN+RF   
Sbjct: 63  PKGQVVPEMSLEHIAPAVADVLGLPVTWVN----SDYGDAVAKMEGDEVLLLENLRFNPG 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND  F + L+  GD Y+NDAFS +HRAHAS   ++ LLP+  GR M +ELS L+   
Sbjct: 119 EEKNDAGFAKRLASLGDIYVNDAFSAAHRAHASTEAIARLLPACAGRLMAEELSALDKAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              K+P+VA+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+ D 
Sbjct: 179 GTPKRPVVAVVGGAKVSTKLDLLGNLVGKVDHLVIGGGMANTFLAAQGINVGKSLCEHDL 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           ++   +I  +AK + CEII+PRD+VVAR  K G  ++ ++  + P D++ILD G  TV+Y
Sbjct: 239 AETAREILGKAKAAGCEIILPRDIVVARAFKAGADSETLAPDACPADAMILDAGPATVDY 298

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I  V+  A T++WNGPLG FEI PFD AT   A   A L+   ++IS+AGGGDT+ AL  
Sbjct: 299 ISGVLDNAETLVWNGPLGAFEIAPFDAATNAAAAKAAALSTAGKLISVAGGGDTVAALNQ 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AG +++FTY+STAGGAFLEW+EGK+LPG+ ALS
Sbjct: 359 AGAADDFTYISTAGGAFLEWMEGKELPGVAALS 391


>gi|332185684|ref|ZP_08387431.1| phosphoglycerate kinase family protein [Sphingomonas sp. S17]
 gi|332014042|gb|EGI56100.1| phosphoglycerate kinase family protein [Sphingomonas sp. S17]
          Length = 399

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/393 (46%), Positives = 262/393 (66%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            +T++D+ D+ G R L+R D NVP  DG+V D TR+   + T+ EL +K A V+I +H G
Sbjct: 5   FKTLDDMGDVSGKRVLVREDLNVPMADGRVTDDTRLRATIATVTELADKGAIVLILAHFG 64

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  +      +L + + F++D  G     ++A+L+ G I + EN RF++
Sbjct: 65  RPKGQRNPEFSLAMLTQPYSDVLGRRVRFIDDVAGEAAEAAVATLNPGDIAILENTRFHA 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+    +++ GDFY+NDAFS +HRAH S  GL+  LP++ GRAM+ EL  LE  
Sbjct: 125 GEEKNDPELAVAIAKLGDFYVNDAFSAAHRAHVSTEGLARQLPAFAGRAMEAELDALEKA 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P+ A+VGG+KVSTK+ +L +LV KVD L+IGGGMAN+FL A+G+ VG+SLC+ D
Sbjct: 185 LGNPEHPVAAVVGGAKVSTKLAVLKHLVGKVDHLIIGGGMANTFLAARGVDVGKSLCEHD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +     I   A ++ C + +P DVVVA+E K    T+ V+   V  D +ILD+G   VE
Sbjct: 245 LTGTAEDILDAADKAGCTVHLPYDVVVAKEFKPNPDTRTVNVHEVAADEMILDLGPNAVE 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +  V+   RT++WNGPLG FE  PFD ATV +A   A LT++  ++S+AGGGDT+ AL 
Sbjct: 305 ALGDVLKNCRTLVWNGPLGAFETPPFDMATVALAKTAAALTQDGSLVSVAGGGDTVAALN 364

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG+  +FT+VSTAGGAFLEW+EG+DLPG+ AL
Sbjct: 365 QAGVGTQFTFVSTAGGAFLEWMEGQDLPGVAAL 397


>gi|114765961|ref|ZP_01444975.1| phosphoglycerate kinase [Pelagibaca bermudensis HTCC2601]
 gi|114541775|gb|EAU44813.1| phosphoglycerate kinase [Roseovarius sp. HTCC2601]
          Length = 392

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/395 (48%), Positives = 270/395 (68%), Gaps = 10/395 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ ++ G R L RVD NVP  +G+V D TRIERV  T+ +++ +    V+ +H GR
Sbjct: 4   KTLDDM-ELDGKRVLTRVDINVPVENGEVTDATRIERVCATVQDILARGGTPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQS---IASLSEGGIILAENVRF 121
           P+ K   + SL  ++   E+     + F      +TL ++   I +  +G ++L EN RF
Sbjct: 63  PKGKVVPEMSLKMLLPALEAAFGTKVHF------ATLDEAEGVIEACDKGHVVLLENTRF 116

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
              EE+NDP+  +  ++ GD Y NDAFS +HRAHAS   L+HLLP+  GR MQ EL  LE
Sbjct: 117 EPGEEKNDPELAKTYAKLGDVYCNDAFSAAHRAHASTEALAHLLPACAGRLMQAELEALE 176

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +     K+P++A+VGG+KVSTK+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG+SLC+
Sbjct: 177 AALGTPKRPVLAVVGGAKVSTKLELLGNLVEKVDILVIGGGMANTFLAAQGLDVGKSLCE 236

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D +    +IA +A  + CEI++PRDVVVARE +   P++VV A+  P D++ILD G  +
Sbjct: 237 HDMTGTAKEIAEKAASTGCEILLPRDVVVAREFRENAPSEVVKAEECPADAMILDAGPDS 296

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V +++Q I +A T++WNGPLG FEI PFD AT   A + AK T   +++S+AGGGDT+ A
Sbjct: 297 VAHVEQAIDRAETLIWNGPLGAFEIAPFDTATNAAAAHAAKATASGKLVSVAGGGDTVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L  AG S++FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 357 LNKAGASDDFTYISTAGGAFLEWMEGKVLPGVAAL 391


>gi|294677245|ref|YP_003577860.1| phosphoglycerate kinase [Rhodobacter capsulatus SB 1003]
 gi|294476065|gb|ADE85453.1| phosphoglycerate kinase [Rhodobacter capsulatus SB 1003]
          Length = 396

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/392 (47%), Positives = 267/392 (68%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++++ D+ G   L+RVD NVP  +G V D TRIE++ PT+ +++ K  K V+ +H GR
Sbjct: 4   KTLDEM-DLAGKVVLVRVDINVPVENGVVTDATRIEKIAPTVKDILAKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   + SL  +V      L   + F  DCIG+    ++A+L+ G ++L EN RF++ 
Sbjct: 63  PKGKPVPEMSLRPLVPELAKALGVPVKFAEDCIGAPAKTAVAALAAGEVLLLENTRFHAG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+    ++  G+ Y+NDAFS +HRAH+S  G++H+LP+  GR M  EL  LE+  
Sbjct: 123 EEKNDPELSAAMAALGEVYVNDAFSAAHRAHSSTEGVAHILPAVAGRLMAAELKALEAAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
               +P+ A+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FLVAQG+ VG+SL +R+ 
Sbjct: 183 GNPVRPVCAVVGGAKVSTKLDLLGNLVTKVDHLVIGGGMANTFLVAQGIDVGKSLAEREM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           ++   +I  +A  + C I +P DVVVARE K G   +VV     P D++ILD G K+VE 
Sbjct: 243 AETAREILEKAAAAGCAIHLPADVVVAREFKAGAENEVVGNADCPADAMILDAGPKSVEE 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I +V   ++T++WNGPLG FEI PFD AT   A   A LTK  +++S+AGGGDT+ AL  
Sbjct: 303 IAKVFEASKTLIWNGPLGAFEIAPFDAATNAAAQKAADLTKAGKLVSVAGGGDTVAALNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG + +F+Y+STAGGAFLEW+EGK+LPG+ AL
Sbjct: 363 AGAAEDFSYISTAGGAFLEWMEGKELPGVAAL 394


>gi|84517284|ref|ZP_01004638.1| phosphoglycerate kinase [Loktanella vestfoldensis SKA53]
 gi|84508764|gb|EAQ05227.1| phosphoglycerate kinase [Loktanella vestfoldensis SKA53]
          Length = 422

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/392 (47%), Positives = 269/392 (68%), Gaps = 5/392 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D  G R L+RVD NVP  +G V D +RIER++PT+ ++  +  KV++ +H  R
Sbjct: 35  KTLDDM-DFAGKRALVRVDINVPVENGVVTDTSRIERIIPTVDDIHAQGGKVILLAHFDR 93

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL  +      +L   + FV+    S  ++++  + +  ++L EN+RF+  
Sbjct: 94  PKGRVVPEMSLEHIAGTVADVLGLTVTFVS----SNYAEAVDEMEDEEVLLLENLRFHPG 149

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE ND  F   L+  GD Y+NDAFS +HRAHAS   ++HLLPS  GR M++EL  L++  
Sbjct: 150 EENNDAAFAARLASLGDIYVNDAFSAAHRAHASTEAIAHLLPSCAGRLMEEELGALDAAL 209

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
               +P+VA+VGG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+ D 
Sbjct: 210 GNPARPVVAVVGGAKVSTKLDLLGNLVGKVDHLVIGGGMANTFLAAQGINVGKSLCEHDL 269

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +D    I  +A+ + CEII+PRD+VVAR+ K G  ++  +  + P D++ILD G  TV Y
Sbjct: 270 ADTARAILAKAQATGCEIILPRDIVVARDFKAGAASETCAPDACPDDAMILDAGPATVAY 329

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I  V+ +A+T++WNGPLG FEI PFD AT   A + A LT+  ++IS+AGGGDT++AL  
Sbjct: 330 INAVLDRAKTLVWNGPLGAFEIAPFDAATNAAARHAAGLTQAGKLISVAGGGDTVSALNQ 389

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++++FTY+S AGGAFLEW+EGK LPG+ AL
Sbjct: 390 AGVADDFTYISGAGGAFLEWMEGKTLPGVAAL 421


>gi|302382394|ref|YP_003818217.1| phosphoglycerate kinase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193022|gb|ADL00594.1| Phosphoglycerate kinase [Brevundimonas subvibrioides ATCC 15264]
          Length = 398

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 267/394 (67%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D   + G   L+RVD+NVP   GKV D TR+   +PTI +L +  AKV + +H  
Sbjct: 3   FRTLDDAGSLAGQTALVRVDFNVPMEGGKVTDDTRLRVALPTINKLRDLGAKVALLAHFD 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K     SL  VV   E +L   + F  DCIG     +IA L  GG++L ENVRF++
Sbjct: 63  RPKGKVVPSMSLQPVVDDLEHLLGAPVRFATDCIGDEAKSAIADLDAGGVVLLENVRFHA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE NDP F + L+  GD Y+NDAFS +HRAHAS  GL+ LLP+Y G +M++EL  L++ 
Sbjct: 123 GEEANDPAFAQQLADLGDLYVNDAFSAAHRAHASTEGLARLLPAYAGESMRRELEALDAA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               KKP++ IVGG+KVSTK+ LL NLV K+D+L IGGGMAN+FL AQG+ +G SL +RD
Sbjct: 183 LGNPKKPVIGIVGGAKVSTKLDLLKNLVGKLDRLAIGGGMANTFLFAQGVDIGGSLAERD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQV-VSAQSVPLDSIILDVGFKTV 302
            +D   +I  EAK   CE+++P D VVA E+K G  ++V ++  ++  D  ILD G  TV
Sbjct: 243 MADTALEIIAEAKTKGCEMLLPVDFVVATEVKPGAASRVFMAGDALSADDKILDAGPATV 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             + + +  ++T++WNGPLGVFE+ PFD ATV VAH+ A L K   ++++ GGGDT++AL
Sbjct: 303 ARLVEALTASKTLIWNGPLGVFEVPPFDTATVAVAHHAAALAKAGVLVAVGGGGDTVSAL 362

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG+ ++ T+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 363 NHAGVVDDMTFVSTAGGAFLEWMEGKPLPGVEAL 396


>gi|254295321|ref|YP_003061344.1| phosphoglycerate kinase [Hirschia baltica ATCC 49814]
 gi|254043852|gb|ACT60647.1| Phosphoglycerate kinase [Hirschia baltica ATCC 49814]
          Length = 400

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/398 (46%), Positives = 264/398 (66%), Gaps = 2/398 (0%)

Query: 1   MSRLRTMNDL-RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVI 58
           MS  RT++ +  ++ G   L+RVD+NVP  D G+V D TR+   +PTI  L++K AKV +
Sbjct: 1   MSNFRTIDTIANELDGKTALVRVDFNVPMNDAGEVTDDTRLRAAMPTIKFLIDKGAKVAL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ K   + SL  VV   E++L K+I F   C+G    Q+I    +G +IL EN
Sbjct: 61  LAHFGRPKGKVVPEMSLGPVVPAIEAVLGKSITFATACVGPVAQQAIDLAGKGDVILLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF + EE+ND      +S+ GD ++NDAFS +HRAH +  G++  LP+Y GR+M+ EL 
Sbjct: 121 TRFEAGEEKNDTSLAEEMSKLGDIFVNDAFSAAHRAHVTTEGITKFLPAYAGRSMEAELK 180

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L++      +P+VA+VGG+KVS+KI LL NLV KVD L IGGGMAN+FL A G+ VG+S
Sbjct: 181 SLDAALGTPVRPVVAVVGGAKVSSKIDLLKNLVSKVDTLAIGGGMANTFLFADGINVGKS 240

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           LC+ + +  V +I   A++S C+I++P DVV A+E K   P+++  A  V  D +ILD G
Sbjct: 241 LCESELTGTVAEIKAAAEKSGCKILLPTDVVCAKEFKAFAPSRICDANDVADDEMILDAG 300

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
                 +   +++++TV+WNGPLG FE+EPFD ATV  A     L K  +I ++AGGGDT
Sbjct: 301 PIAAAALVDEMSKSKTVVWNGPLGAFELEPFDEATVAAAKGAGDLAKSGKITAVAGGGDT 360

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + AL HAG + +FT++STAGGAFLEW+EGK LPG+ AL
Sbjct: 361 VAALNHAGAAEDFTFISTAGGAFLEWMEGKILPGVEAL 398


>gi|163746652|ref|ZP_02154009.1| phosphoglycerate kinase [Oceanibulbus indolifex HEL-45]
 gi|161379766|gb|EDQ04178.1| phosphoglycerate kinase [Oceanibulbus indolifex HEL-45]
          Length = 392

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/397 (47%), Positives = 262/397 (65%), Gaps = 11/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           ++++D+ ++ G R LLRVD NVP  DG+V D TRIER+VPT+ +++ +  KV + +H GR
Sbjct: 4   KSLDDI-ELDGKRVLLRVDINVPVEDGRVTDATRIERIVPTVNDILSRGGKVTLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++ SL +V+   E  L +++ FV        S   A+ ++G + L EN+RFY  
Sbjct: 63  PKGKVVEEMSLRQVLPALEKALGRDVAFVP-------SLDAAAAAQGDLQLMENIRFYPG 115

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE ND  F R L+  GD Y NDAFS +HRAHAS   L+ LLP+  GR MQ ELS LE+  
Sbjct: 116 EEANDEGFARQLADLGDIYCNDAFSAAHRAHASTEALARLLPACAGRLMQAELSALEAAL 175

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           ++ ++P+ A+VGG+KVSTKI LL NLV ++D LVIGGGMAN+FL A G  +G+SL + D+
Sbjct: 176 AKPERPVGAVVGGAKVSTKIALLENLVNRLDVLVIGGGMANTFLAALGADLGKSLEEPDY 235

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS---AQSVPLDSIILDVGFKT 301
            D    I  +A ++ C +I+P D +VARE   G   +VV       +  D ++LD G  T
Sbjct: 236 YDTAKDIMAQADKAGCRVILPVDGLVAREFAKGAAHEVVQLGPDAKLADDQMVLDAGPDT 295

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  IK   A  RT++WNGP+G FEI PFD ATV  A   A  T+E  + S+AGGGDT+ A
Sbjct: 296 VALIKAAFAGLRTLIWNGPMGAFEIPPFDTATVAAARAAAAKTREGTLTSVAGGGDTVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG++++FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 356 LNQAGVADDFTYISTAGGAFLEWMEGKTLPGVAALGG 392


>gi|167628777|ref|YP_001679276.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
 gi|167591517|gb|ABZ83265.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
          Length = 395

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 181/395 (45%), Positives = 267/395 (67%), Gaps = 8/395 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+RG   L+RVD+NVP  + G + D TRI   +PTI  L+++ AKV++ SH G
Sbjct: 4   QTVRDI-DVRGKGVLVRVDFNVPVNEAGVITDDTRIRAALPTIQYLIQEGAKVILASHFG 62

Query: 64  RPQSKSDKDCSLFKV-VSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           RP+ K +    L  V + +AE +L + +  ++DCIG     ++ ++  G ++L ENVRFY
Sbjct: 63  RPKGKVNDKYRLTAVGIRLAE-LLGRPVKKLDDCIGPETEAAVRAMEAGDVVLLENVRFY 121

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EEE+NDP F R L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M KE+S++  
Sbjct: 122 LEEEQNDPAFARKLAALADVYVNDAFGTAHRAHASTAGVAAYLPAVAGFLMDKEISIMGK 181

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             +  ++P VAI+GG+KV+ KI ++ NL+ KVD L+IGGGMAN+F  A G  VGRSLC++
Sbjct: 182 ALASPERPFVAIMGGAKVADKIAVIDNLLTKVDTLIIGGGMANTFFYALGREVGRSLCEK 241

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D +D   Q+  +AK S    ++P DVVVA  +  G+PT VV A ++P D   LD+G +++
Sbjct: 242 DKADTARQLLNKAKASGVRFLLPVDVVVAETLAAGVPTAVVPADAIPADKAALDIGPESI 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              +Q +A+ARTV+WNGP+G FEI PFDR T+ VA  +AK+      +SI GGGD++ A+
Sbjct: 302 ALFEQALAKARTVLWNGPMGAFEIAPFDRGTLGVAKAMAKVQG----LSIIGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             AG++++ T+VST GGA LE+LEG++LPG+ ALS
Sbjct: 358 EKAGLADQMTHVSTGGGASLEFLEGRELPGVAALS 392


>gi|110680205|ref|YP_683212.1| phosphoglycerate kinase [Roseobacter denitrificans OCh 114]
 gi|123172301|sp|Q164R7|PGK_ROSDO RecName: Full=Phosphoglycerate kinase
 gi|109456321|gb|ABG32526.1| phosphoglycerate kinase [Roseobacter denitrificans OCh 114]
          Length = 395

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 188/397 (47%), Positives = 262/397 (65%), Gaps = 8/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R LLRVD NVP  +G+V D TRI+R++PT+ +++ K    ++ +H GR
Sbjct: 4   KTLDDM-DVAGKRVLLRVDINVPVEEGQVTDRTRIDRIIPTLQDILAKGGTPIMLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   + SL   +   E+ L + + F+ +     LS     L EG ++L EN RF   
Sbjct: 63  PKGKVVPEMSLRVTLPALEAALGRKVTFIEEPNAERLSD----LPEGIVVLLENTRFAVG 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP+  R L+  GD + NDAFS +HRAHAS TG++HLLPS  GR MQ ELS LE+  
Sbjct: 119 EEANDPEMARFLATLGDVFCNDAFSAAHRAHASTTGVAHLLPSCAGRLMQAELSALEAAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P+ A+VGG+KVSTKI LL NLV ++D LVIGGGMAN+FL AQG  +G SL + D+
Sbjct: 179 STPQRPVGAVVGGAKVSTKIALLENLVARLDVLVIGGGMANTFLAAQGAKLGASLMEPDY 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS---VPLDSIILDVGFKT 301
            +    I   A+R+ C++++P D VVARE K G   +VV+      +  D ++LD G ++
Sbjct: 239 METARTIMQSAERAGCKLLLPVDGVVAREFKAGADFEVVALGKDTVLAEDQMVLDAGPQS 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  +       +T++WNGPLG FEI PF++AT   A   A+LTK   +IS+AGGGDT+ A
Sbjct: 299 VAAVMAAFRTLKTLIWNGPLGAFEITPFNQATNATALEAARLTKSGALISVAGGGDTVAA 358

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG + +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 359 LNQAGAAADFTYISTAGGAFLEWMEGKTLPGVAALQG 395


>gi|254486366|ref|ZP_05099571.1| phosphoglycerate kinase [Roseobacter sp. GAI101]
 gi|214043235|gb|EEB83873.1| phosphoglycerate kinase [Roseobacter sp. GAI101]
          Length = 397

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 183/397 (46%), Positives = 262/397 (65%), Gaps = 6/397 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP   G+V D TRI+R+VPT+ +++ K  + V+ +H GR
Sbjct: 4   KTLDDM-DLHGKRVLVRVDINVPVEKGRVTDDTRIQRIVPTVQDILAKGGRPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  +D SL  V    E+ L++ ++         +      +++  ++L EN+RFY  
Sbjct: 63  PKGKRVQDLSLLVVKPALEAALNRKVVLAETL--EAVETGTEEITKADVLLLENIRFYPG 120

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP F + L+  GD Y NDAFS +HRAHAS   L+ LLP   GR MQ ELS LE+  
Sbjct: 121 EEKNDPGFAQRLAALGDVYCNDAFSAAHRAHASTEALARLLPCCAGRLMQAELSALEAAL 180

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S+ ++P+ A+VGG+KVSTKI LL NLV ++D LVIGGGMAN+FL A G  +G SL + DF
Sbjct: 181 SKPERPVGAVVGGAKVSTKIELLENLVNRLDLLVIGGGMANTFLGAMGADLGSSLSEPDF 240

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA---QSVPLDSIILDVGFKT 301
            +    I  +A ++ C +++P D +VARE K   P +VV      ++  D ++LD G  T
Sbjct: 241 FETAKDIMLQADKAGCRVLLPVDGLVAREFKAAAPHEVVELGPDTTLAADQMVLDAGPAT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  ++   A  +T++WNGP+G FEI PFD ATV  A   A++T++  +IS+AGGGDT++A
Sbjct: 301 VALVEAAFAGLKTLIWNGPMGAFEIPPFDTATVAAAQAAAQMTRDGALISVAGGGDTVSA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG + +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 361 LNQAGAAEDFTYISTAGGAFLEWMEGKTLPGVAALGG 397


>gi|149916359|ref|ZP_01904879.1| Phosphoglycerate kinase [Roseobacter sp. AzwK-3b]
 gi|149809813|gb|EDM69665.1| Phosphoglycerate kinase [Roseobacter sp. AzwK-3b]
          Length = 394

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 261/394 (66%), Gaps = 3/394 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G   L RVD NVP  +G+V D TRI R+VPTI  ++      ++ +H GR
Sbjct: 4   KTLDDM-DLTGKTVLTRVDINVPIENGRVTDATRITRIVPTIEAILAAGGTPMLIAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   D SL  VV   E  L + + F+    G+      A  ++  ++L EN+RF+  
Sbjct: 63  PKGKVVDDLSLRPVVPALEQALGRKVTFIETLDGAENLTDEARAAD--VLLLENIRFHPG 120

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDPDF R L+  GD Y NDAFS +HRAHAS   L+HLLP+  GR MQ EL  L++  
Sbjct: 121 EEANDPDFARRLAGLGDIYCNDAFSAAHRAHASTEALAHLLPACAGRLMQAELQALQAAL 180

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              ++P+VA+VGG+KVSTK+ LL NLV+KVD+LVIGGGMAN+FL AQG+ VG SLC+ D 
Sbjct: 181 GAPQRPVVAVVGGAKVSTKLDLLGNLVEKVDQLVIGGGMANTFLAAQGLTVGTSLCEHDM 240

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +  V  I   A  S CEI++P DVVVAR  K G   + V A + P D++ILD G ++V  
Sbjct: 241 AGTVRSIMTRAGASGCEILLPADVVVARAFKAGAAHECVPAHACPEDAMILDAGPQSVAR 300

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I      ART++WNGPLG FEIEPFD AT   A + A L++  +++S+AGGGDT+ AL  
Sbjct: 301 ITTAFDAARTLIWNGPLGAFEIEPFDAATNAAAAHAAALSRAGKLVSVAGGGDTVAALNK 360

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 361 SGAAADFTYISTAGGAFLEWMEGKVLPGVAALGG 394


>gi|149204030|ref|ZP_01880998.1| phosphoglycerate kinase [Roseovarius sp. TM1035]
 gi|149142472|gb|EDM30517.1| phosphoglycerate kinase [Roseovarius sp. TM1035]
          Length = 394

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 189/392 (48%), Positives = 263/392 (67%), Gaps = 3/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP  +G V D TRI+R+ PT+ +++ K  + ++ +H GR
Sbjct: 4   KTLDDI-DLTGKRVLVRVDINVPVENGLVTDATRIDRIAPTVTDILAKGGRPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   D SL   V   E+ L + +  +    G+      A  S+  ++L EN+RF+  
Sbjct: 63  PKGKVVLDMSLRVTVPALEAALGRKVRLIETLEGAENLTDEALASD--VLLLENIRFHPG 120

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP F   L++ GD Y NDAFS +HRAHAS  GL+  LPS  GR MQ EL  LE+  
Sbjct: 121 EEANDPAFAARLAQLGDIYCNDAFSAAHRAHASTEGLARHLPSCAGRLMQAELQALEAAL 180

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              K+P+VA+VGG+KVSTK+ LL NLV KVD L+IGGGMAN+FL A G+ VG+SLC+ D 
Sbjct: 181 GTPKRPVVAVVGGAKVSTKLDLLGNLVAKVDSLIIGGGMANTFLAAMGLDVGKSLCEHDM 240

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +    +I  +A  + C+I++P DVVVAR+   G P +VV A + P D++ILD G + V  
Sbjct: 241 TATAREIMLKAGDAGCKIVLPADVVVARDFAAGAPHEVVGAHACPPDAMILDAGPQAVAR 300

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I   +  A+T++WNGPLG FEI PFD AT   A + A+L++  ++IS+AGGGDT+ AL  
Sbjct: 301 IIATLDAAKTLIWNGPLGAFEIAPFDTATNAAASHAAQLSRAGKLISVAGGGDTVAALNK 360

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGKDLPG+ AL
Sbjct: 361 SGAAEDFTYISTAGGAFLEWMEGKDLPGVAAL 392


>gi|83943194|ref|ZP_00955654.1| phosphoglycerate kinase [Sulfitobacter sp. EE-36]
 gi|83846202|gb|EAP84079.1| phosphoglycerate kinase [Sulfitobacter sp. EE-36]
          Length = 389

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 189/391 (48%), Positives = 258/391 (65%), Gaps = 11/391 (2%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+RG R L+RVD NVP  +GKV D TRI+R++PT+ +++E+    V+ +H GRP+ K  +
Sbjct: 2   DLRGKRVLVRVDINVPVENGKVTDDTRIQRIIPTLRDILEQGGTPVLLAHFGRPKGKRVQ 61

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSE---GGIILAENVRFYSEEERN 128
           D SL  V+   E  L + ++     +  TL  + A   E     ++L EN+RFY  E  N
Sbjct: 62  DLSLRVVLPALEDALGRKVV-----LAETLEAAEAGTEEINAADVLLLENIRFYPGETEN 116

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           DPDF + L+  GD Y NDAFS +HRAHAS  G++ LLPS  GR MQ ELS LE+  +  K
Sbjct: 117 DPDFAKRLAGLGDIYCNDAFSAAHRAHASTEGVARLLPSCAGRLMQAELSALEAALATPK 176

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ A+VGG+KVSTKI LL NLV ++D LVIGGGMAN+FL AQG  +G+SL + DF D  
Sbjct: 177 RPVGAVVGGAKVSTKIELLENLVNRLDLLVIGGGMANTFLGAQGADLGKSLSEPDFYDTA 236

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREM--KTGIPTQVVSAQSV-PLDSIILDVGFKTVEYI 305
             I  +A+++ C +++P D +VARE           + A +V   D ++LD G KTVE +
Sbjct: 237 KDILAQAEKAGCRVLLPVDGLVAREFAAHAAHEVAALGADTVLAADQMVLDAGPKTVELV 296

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
           K      +T++WNGP+G FEI PFD ATV  A   A LT++  +IS+AGGGDT+ AL  A
Sbjct: 297 KDAFNGLKTLIWNGPMGAFEIAPFDTATVAAAKAAAALTRDGALISVAGGGDTVAALNQA 356

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           G +++FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 357 GAADDFTYISTAGGAFLEWMEGKTLPGVAAL 387


>gi|159044698|ref|YP_001533492.1| phosphoglycerate kinase [Dinoroseobacter shibae DFL 12]
 gi|189036814|sp|A8LQM4|PGK_DINSH RecName: Full=Phosphoglycerate kinase
 gi|157912458|gb|ABV93891.1| phosphoglycerate kinase [Dinoroseobacter shibae DFL 12]
          Length = 393

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 192/392 (48%), Positives = 261/392 (66%), Gaps = 5/392 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+  + G   L RVD NVP  DG V D TRIER+VPT+ +++ K    V+ +H GR
Sbjct: 4   KTLDDMA-LDGKIVLTRVDINVPVADGVVTDTTRIERIVPTVTDILAKGGLPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   + SL  V+   E  L + + F    I      ++ +L +  ++LAEN RF   
Sbjct: 63  PKGKVVPEMSLRVVLPALEEALGRPVEF----IAHPDRAALEALPKCTVVLAENTRFAPG 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+    L+  GD Y NDAFS +HRAHAS  G++ LLPS  GR MQ EL  L+   
Sbjct: 119 EEKNDPEMAAALAALGDIYCNDAFSAAHRAHASTEGIARLLPSCAGRLMQAELEALQRAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
               +P+VA+VGG+KVSTK+ LL NLV+KVD LVIGGGMAN+FL AQG+ VG SL + + 
Sbjct: 179 GTPTRPVVAVVGGAKVSTKLALLGNLVEKVDDLVIGGGMANTFLAAQGIDVGASLAEHEM 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +D   +I  +A R+ C I +P+D+VVAR+ + G P+Q +     P D++ILD G +TV  
Sbjct: 239 ADTAREIMEKAARAGCSIHLPKDIVVARKFEAGAPSQTLPVSECPRDAMILDAGPETVAA 298

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           +K+V AQART++WNGPLG FEI PFD AT   A   A  TK   +I++AGGGDT+ AL  
Sbjct: 299 LKEVFAQARTLIWNGPLGAFEIPPFDMATNAAARAAADATKAGTLITVAGGGDTVAALNK 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++++FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 359 AGVADDFTYISTAGGAFLEWMEGKTLPGVAAL 390


>gi|307946963|ref|ZP_07662298.1| phosphoglycerate kinase [Roseibium sp. TrichSKD4]
 gi|307770627|gb|EFO29853.1| phosphoglycerate kinase [Roseibium sp. TrichSKD4]
          Length = 404

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 186/396 (46%), Positives = 262/396 (66%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           +  LR++ D  D+RG   L+R D NVP  DG + D TRI    PT+  LV + A VVI +
Sbjct: 3   LGTLRSI-DSADVRGKTVLIRADLNVPMQDGAITDATRISHFAPTVSGLVNRGAAVVIAT 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + +   S   +    E  L + ++F  DC+G     + A L  G +++ EN+R
Sbjct: 62  HLGRPKGEPNPCLSTRPIAQALEEALGRPVVFAKDCVGEPAESATADLQPGRVVVLENLR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ E  N  +F   LS NGD Y+NDAFS +HRAHAS   ++ L+PSY G ++  E++ L
Sbjct: 122 FHAGEMENSRNFAMRLSVNGDIYVNDAFSCAHRAHASTHAITDLMPSYAGPSLLAEVAAL 181

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E+     ++P+VA+VGG+KVSTKI +L NL+ K+D ++IGGGMAN+FL A G+ +G+SL 
Sbjct: 182 EAALVSPERPVVAVVGGAKVSTKIAVLKNLMNKLDAVIIGGGMANTFLYANGVPMGKSLH 241

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  + V +I   A+++ C I +P DVVV+RE       + V     P+D++ILD G +
Sbjct: 242 EADQVETVREIEQLAEKAGCMICLPTDVVVSREFTANAQNRTVPVDGCPVDAMILDAGPE 301

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +    +++I  A+TV+WNGPLG FEI+PFDRATV +A   A+ T E  ++SIAGGGDT+ 
Sbjct: 302 STRRFQELITSAKTVLWNGPLGAFEIQPFDRATVNLARIAAQRTAEGALVSIAGGGDTVA 361

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  AG+SN+FTYVSTAGGAFLEWLEGK LPGI AL
Sbjct: 362 ALNAAGVSNDFTYVSTAGGAFLEWLEGKTLPGIAAL 397


>gi|254512085|ref|ZP_05124152.1| phosphoglycerate kinase [Rhodobacteraceae bacterium KLH11]
 gi|221535796|gb|EEE38784.1| phosphoglycerate kinase [Rhodobacteraceae bacterium KLH11]
          Length = 396

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/392 (46%), Positives = 265/392 (67%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           ++++D+ ++ G R L+RVD NVP  DG V D TRI R+VPT+ +++    + ++ +H GR
Sbjct: 4   KSLDDM-ELGGKRVLVRVDINVPVADGVVTDDTRIRRIVPTVRDILGAGGRPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +   + SL ++V   E+     + F +DC+G     + A+L+ G ++L EN RF++E
Sbjct: 63  PGGRHVPEMSLKQLVPTLEAAFGVPVRFADDCVGHEAETAAAALAGGEVLLLENTRFHAE 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +N       +++ GD Y NDAFS +HRAH+S   L+ LLP+  GR MQ+ELS LE+  
Sbjct: 123 ETKNSVPLAEGMAKLGDIYCNDAFSAAHRAHSSTEALARLLPACAGRLMQQELSALEAAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              K+P+ A+VGG+KVSTK+ LL NL++KVD LVIGGGMAN+FLVA+G+ VG+SL +R  
Sbjct: 183 GTPKRPVTAVVGGAKVSTKLDLLGNLIEKVDYLVIGGGMANTFLVAKGLDVGKSLAERAM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           SD    I  +A+ + C I++P D+VVA   K   P QV+ A   P D++ILD G ++V  
Sbjct: 243 SDTAAGIMRKAEAAGCTIVLPSDIVVAGAFKANAPHQVLPADQCPSDAMILDAGPESVTA 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I +V+ +++T++WNGPLG FE+ PFD AT   A   A LT+  ++ S+AGGGDT+ AL  
Sbjct: 303 ISEVLDRSQTLIWNGPLGAFELTPFDAATNAAALKAATLTRAGKLTSVAGGGDTVAALNA 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 SGAAKDFTYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|83954329|ref|ZP_00963049.1| phosphoglycerate kinase [Sulfitobacter sp. NAS-14.1]
 gi|83841366|gb|EAP80536.1| phosphoglycerate kinase [Sulfitobacter sp. NAS-14.1]
          Length = 397

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 190/399 (47%), Positives = 261/399 (65%), Gaps = 12/399 (3%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           + ++D+ D+RG R L+RVD NVP  +GKV D TRI+R++PT+ +++E+    V+ +H GR
Sbjct: 4   KALDDM-DLRGKRVLVRVDINVPVENGKVTDDTRIQRIIPTLRDILEQGGTPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSE---GGIILAENVRF 121
           P+ K  +D SL  V+   E  L + ++     +  TL  + A   E     ++L EN+RF
Sbjct: 63  PKGKRVQDLSLRVVLPALEDALGRKVV-----LAETLEAAEAGTEEINAADVLLLENIRF 117

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  E  NDPDF + L+  GD Y NDAFS +HRAHAS  G++ LLPS  GR MQ ELS LE
Sbjct: 118 YPGETENDPDFAKRLAGLGDIYCNDAFSAAHRAHASTEGVARLLPSCAGRLMQAELSALE 177

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +  +  K+P+ A+VGG+KVSTKI LL NLV ++D LVIGGGMAN+FL AQG  +G+SL +
Sbjct: 178 AALATPKRPVGAVVGGAKVSTKIELLENLVNRLDLLVIGGGMANTFLGAQGADLGKSLSE 237

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREM--KTGIPTQVVSAQSV-PLDSIILDVG 298
            DF D    I  +A+++ C +++P D +VARE           + A +V   D ++LD G
Sbjct: 238 PDFYDTAKDILAQAEKAGCRVLLPVDGLVAREFAAHAAHEVAALGADTVLAADQMVLDAG 297

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KTVE +K      +T++WNGP+G FEI PFD ATV  A   A LT+   +IS+AGGGDT
Sbjct: 298 PKTVELVKDAFDGLKTLIWNGPMGAFEITPFDTATVAAAKAAAALTRNGALISVAGGGDT 357

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + AL  AG + +FTY+STAGGAFLEW+EGK LPG+ AL 
Sbjct: 358 VAALNQAGAAEDFTYISTAGGAFLEWMEGKTLPGVAALD 396


>gi|294084298|ref|YP_003551056.1| phosphoglycerate kinase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663871|gb|ADE38972.1| Phosphoglycerate kinase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 399

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/388 (45%), Positives = 253/388 (65%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  D++G R LLR+D NVP  DGKV++ TRI+R++P + +++   A V+I +H GRP+ K
Sbjct: 9   DELDVKGKRVLLRLDLNVPLQDGKVSEDTRIKRILPGLKDMLAAGASVIILTHFGRPKGK 68

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
              + S+  +      ++ K +    D IG+    + A L  G I++ EN+RF+  EE N
Sbjct: 69  MMPEFSVQPIADCLAKLIGKQVAIEADVIGAGGKVAAAGLQSGQILMMENLRFFPGEEAN 128

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESK 188
           D DF   L+  GD Y+ DAFS +HRAHAS+  L  ++ +  GRA+  EL+ LES  +  K
Sbjct: 129 DTDFAAALAALGDIYVGDAFSCTHRAHASVEALPKMMKAAAGRALGAELTALESALANPK 188

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P+ A+VGG+KVSTK+ +L NLV KVD L++GGGMAN+FL+A+G  VG SL + D  D  
Sbjct: 189 RPVAALVGGAKVSTKLNVLNNLVTKVDGLILGGGMANTFLLAKGFSVGASLAEPDMVDIA 248

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             I   A+ S C++I+P D +VA E K G   ++ +  ++  D +ILD G K++E     
Sbjct: 249 SAIIQRAEESNCKLILPDDALVAGEFKAGAVHRIATIDTIEDDDMILDAGPKSIESAIAF 308

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +A   TV+WNGP+G FEI PFD AT  +A  V   +     +S+AGGGDT+ ALA+AG+S
Sbjct: 309 LATCNTVVWNGPMGAFEIPPFDTATNAIAKAVGMRSAGGSTMSVAGGGDTLAALANAGVS 368

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 369 DQFSYVSTAGGAFLEWLEGKTLPGVEAL 396


>gi|119384652|ref|YP_915708.1| phosphoglycerate kinase [Paracoccus denitrificans PD1222]
 gi|119374419|gb|ABL70012.1| phosphoglycerate kinase [Paracoccus denitrificans PD1222]
          Length = 398

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 192/396 (48%), Positives = 272/396 (68%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+   T++DL D+ G   L+RVD NVP  +G+V D TRIE++VPT+ ++  +    V+ +
Sbjct: 1   MADFNTIDDL-DLDGKVVLVRVDVNVPVENGQVTDATRIEKIVPTVKDIQGRGGIPVLLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H  RP+ K     SL  V+   E  L + + F ++ IG    +++A L++G ++L EN R
Sbjct: 60  HFDRPKGKRVDGMSLKVVLPALEKALGQPVKFSDEAIGGPAKRAVADLAKGDVLLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE ND  F   L+  G  Y+NDAFS +HRAHAS  G++ LLP+  GR M+ EL  L
Sbjct: 120 FYPGEETNDATFAASLAALGQAYVNDAFSAAHRAHASTEGIARLLPAAAGRLMEAELKAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ++     ++P+VA+VGG+KVSTK+ LL NL++KVD LVIGGGMAN+FLVAQ + VG+SL 
Sbjct: 180 DAALGNPQRPVVAVVGGAKVSTKLDLLGNLIEKVDHLVIGGGMANTFLVAQNIEVGKSLA 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +RD +D    I  +A+++ C I +P DVVVARE K G  ++ V+A + P D++ILD G  
Sbjct: 240 ERDMTDTARDILAKAEKTGCTIHLPVDVVVAREFKAGADSETVAADACPADAMILDAGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  I++V   +RT++WNGPLG FEI PFD AT   A   A+LT+E ++IS+AGGGDT+ 
Sbjct: 300 TVAKIREVFESSRTLIWNGPLGAFEIPPFDAATNAAAQEAARLTREGKLISVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  AG+S +FT++STAGGAFLEW++GK+LPG+ AL
Sbjct: 360 ALNKAGVSGDFTFISTAGGAFLEWMKGKELPGVAAL 395


>gi|190571235|ref|YP_001975593.1| phosphoglycerate kinase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018634|ref|ZP_03334442.1| phosphoglycerate kinase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|238057766|sp|B3CM25|PGK_WOLPP RecName: Full=Phosphoglycerate kinase
 gi|190357507|emb|CAQ54943.1| phosphoglycerate kinase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995585|gb|EEB56225.1| phosphoglycerate kinase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 396

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 177/385 (45%), Positives = 255/385 (66%), Gaps = 7/385 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D      LLRVD+NVP  +G++ D TRI R +PTI  L    AKV++ SH GRP++K D 
Sbjct: 11  DFHNKNVLLRVDFNVPIKNGRICDATRILRALPTIQYLANAGAKVIVISHFGRPKAK-DS 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  VV     +L K + F++DCIG  + ++I ++  G IIL EN+RFY EEE+ND +
Sbjct: 70  NLSLKNVVETLSRLLSKEVKFIDDCIGERVQRAINAMDGGDIILLENLRFYKEEEQNDSN 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + L+   D YINDAFS SHRAHASI+ ++  LPSY G  +Q EL  LE   S   KP+
Sbjct: 130 FAKQLASLADIYINDAFSCSHRAHASISRITEFLPSYAGFCLQDELKYLEQAISFDAKPI 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AIVGG+K+STKI +LI L +KVD L++GG +AN+FL+   + +G+S  Q    D +H I
Sbjct: 190 TAIVGGAKISTKIKMLIKLAEKVDYLILGGAIANNFLLFNKVNIGKSFFQNGVDDLLHDI 249

Query: 252 AWEAKRSACEIIVPRDVVVA--REMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
              A ++ C+I+VP DV+VA   +  TG+  ++   +S+    IILD+G +T+  I  +I
Sbjct: 250 VETANKNNCKIVVPEDVLVAVNSDYSTGVLRKI---ESILDGDIILDIGPQTLSTISGII 306

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A ++T++WNGP+GVFE   F   TVEV   V+ LT E ++ S+ GGGD+++A+  AG+++
Sbjct: 307 ASSKTLLWNGPIGVFEHSAFANGTVEVMRVVSDLTHEGKLTSVIGGGDSLSAINTAGLAD 366

Query: 370 -EFTYVSTAGGAFLEWLEGKDLPGI 393
            +FTY+ST GGAFL WL G ++PG+
Sbjct: 367 KDFTYISTGGGAFLSWLSGDEMPGL 391


>gi|85705342|ref|ZP_01036441.1| phosphoglycerate kinase [Roseovarius sp. 217]
 gi|85670215|gb|EAQ25077.1| phosphoglycerate kinase [Roseovarius sp. 217]
          Length = 394

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 190/392 (48%), Positives = 262/392 (66%), Gaps = 3/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP  +G V D TRI+R+ PTI +++ K  + ++ +H GR
Sbjct: 4   KTLDDM-DLNGKRVLVRVDINVPVENGLVTDATRIDRIAPTITDILAKGGRPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   D SL   V   E+ L + +  +    G+      A  S+  ++L EN+RF+  
Sbjct: 63  PKGKVVLDMSLRVTVPALEAALGRKVRLIETLEGAENLTDEALASD--VLLLENIRFHPG 120

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP F   L++ GD Y NDAFS +HRAHAS  GL+  LPS  GR MQ EL  LE+  
Sbjct: 121 EEANDPAFAARLAQLGDVYCNDAFSAAHRAHASTEGLARHLPSCAGRLMQAELQALEAAL 180

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              K+P+VA+VGG+KVSTK+ LL NLV KVD L+IGGGMAN+FL A G+ VG+SLC+ D 
Sbjct: 181 GTPKRPVVAVVGGAKVSTKLDLLGNLVAKVDSLIIGGGMANTFLAAMGLDVGKSLCEHDM 240

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +    +I  +A  + C+I++P DVVVAR+   G P +VV A + P D++ILD G + V  
Sbjct: 241 ATTAREIMLKAGAAGCKILLPADVVVARDFAAGAPHEVVGAHACPPDAMILDAGPQAVAR 300

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I   +  A+T++WNGPLG FEI PFD AT   A + A L++  ++IS+AGGGDT+ AL  
Sbjct: 301 IIATLDAAKTLIWNGPLGAFEIAPFDSATNAAASHAASLSRAGKLISVAGGGDTVAALNK 360

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGKDLPG+ AL
Sbjct: 361 SGAAEDFTYISTAGGAFLEWMEGKDLPGVAAL 392


>gi|126739336|ref|ZP_01755029.1| phosphoglycerate kinase [Roseobacter sp. SK209-2-6]
 gi|126719436|gb|EBA16145.1| phosphoglycerate kinase [Roseobacter sp. SK209-2-6]
          Length = 397

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 179/392 (45%), Positives = 260/392 (66%), Gaps = 1/392 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP +DG V D TRI R+ PT+ +++      ++ +H GR
Sbjct: 4   KTLDDM-DLNGKRVLVRVDINVPLVDGVVTDSTRIRRIAPTVRDIIAAGGFPILLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +  ++ SL ++V   E      + F  DC+G+   ++  +L  G ++L EN RF++ 
Sbjct: 63  PGGERRENLSLNQLVPTLERAFETKVHFAADCVGAGAKEAAETLQPGEVLLLENTRFHAA 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +NDP+    ++  GD Y NDAFS +HRAH+S   L+ LLP+  GR MQ EL  LE+  
Sbjct: 123 ETKNDPELAAGMAALGDVYCNDAFSAAHRAHSSTEALARLLPACAGRLMQAELEALEAAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              ++P+ A+VGG+KVSTK+ LL NL++KVD LVIGGGMAN+FLVAQG  VG SL +R  
Sbjct: 183 GAPERPVTAVVGGAKVSTKLELLGNLIEKVDYLVIGGGMANTFLVAQGKNVGVSLAERIM 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +I  +A  + C+II+P D+VVA++ +     +V+S ++ P D +ILD G  +VE 
Sbjct: 243 KDTAAEILAKADSTGCKIILPSDIVVAKKFEAHTEHEVLSTENCPEDGMILDAGPASVEQ 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I  +  +++T++WNGPLG FE+EPFD AT   A   A LT+   + S+AGGGDT+ AL  
Sbjct: 303 IISIFEESKTLIWNGPLGAFELEPFDAATNAAALKAAALTRAGLLTSVAGGGDTVAALNA 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G + +FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 363 SGAAGDFTYISTAGGAFLEWMEGKTLPGVAAL 394


>gi|89054185|ref|YP_509636.1| phosphoglycerate kinase [Jannaschia sp. CCS1]
 gi|122498917|sp|Q28RQ1|PGK_JANSC RecName: Full=Phosphoglycerate kinase
 gi|88863734|gb|ABD54611.1| phosphoglycerate kinase [Jannaschia sp. CCS1]
          Length = 396

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 254/394 (64%), Gaps = 5/394 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           R  T++D+ D+ G   L RVD NVP     V D TRI R+VPTI +++ K  + V+ +H 
Sbjct: 2   RFNTLDDM-DLAGKLVLTRVDINVPVDGDTVTDATRITRIVPTIKDILAKGGRPVMLAHF 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+     + SL   V   E  L + + F+     +TL     +L EG I L EN RF 
Sbjct: 61  GRPKGAYVPEMSLRVTVPALEQALGQPVNFIERPDRATLD----ALPEGTITLIENTRFS 116

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           + EE NDP     L+  GD Y NDAFS +HRAHAS  G++ LLPS  GR M+ ELS LE+
Sbjct: 117 AMEEANDPKMAGFLASLGDVYCNDAFSAAHRAHASTEGVARLLPSCAGRLMEAELSALEA 176

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                ++P+VA+VGG+KVSTK+ LL NL++KVD ++IGGGMAN+FL AQG+ VG SLC+ 
Sbjct: 177 ALGAPQRPVVAVVGGAKVSTKLDLLGNLIEKVDTIIIGGGMANTFLAAQGVQVGTSLCEH 236

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  D    I  +A  + C +I+P D+VVA E K G    V    + P D +ILD G KTV
Sbjct: 237 DLGDTARAIMQKAAAANCTLILPGDIVVAAEFKAGAANAVYDVDACPADQMILDAGPKTV 296

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E I      A+TV+WNGPLG FEI PFD ATV  A   A+ T+  ++IS+AGGGDT+ AL
Sbjct: 297 ETIAATFNTAKTVIWNGPLGAFEIAPFDAATVTAARAAAEETQAGKLISVAGGGDTVAAL 356

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            HAG++++FTY+STAGGAFLEW+EGK LPG+ AL
Sbjct: 357 NHAGVADQFTYISTAGGAFLEWMEGKTLPGVAAL 390


>gi|260460232|ref|ZP_05808484.1| Phosphoglycerate kinase [Mesorhizobium opportunistum WSM2075]
 gi|259033877|gb|EEW35136.1| Phosphoglycerate kinase [Mesorhizobium opportunistum WSM2075]
          Length = 405

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 175/395 (44%), Positives = 254/395 (64%), Gaps = 2/395 (0%)

Query: 4   LRTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           ++ + D+R  +I G   L+R D NVP  +G VAD TRI R  PT+ +L+ + AKVV+ +H
Sbjct: 1   MKPLPDIRTAEIAGKTVLVRADLNVPLKNGMVADATRIVRFAPTVRDLLARGAKVVVMTH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP   ++   S+  V     S + + ++FV DC+G T  ++     +G ++L EN+RF
Sbjct: 61  LGRPDGDANPIYSVRPVTGTLSSEVGREVVFVPDCVGPTAEKAAKHHQDGKVLLLENLRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE N  +F   LS NGD ++NDAFS +HRAHAS   ++H++P+Y G ++  E++ L 
Sbjct: 121 HKGEEANSRNFALRLSVNGDLFVNDAFSCAHRAHASTHAIAHIMPAYAGPSLLAEVAALT 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +     +KP+ A+VGGSKVS+KI +L NL+ ++D L+IGGGMAN+FL A G  VGRS+ +
Sbjct: 181 AALDAPEKPVAALVGGSKVSSKIRVLKNLIGRMDHLIIGGGMANTFLAASGYRVGRSVHE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D       I   A  + C I++P DV VAR  +       V   ++P +++ LDVG +T
Sbjct: 241 PDCVSIARDIMEAAAANGCRILLPSDVTVARMFEAEALATTVPVAAIPDEAMALDVGPRT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  IK V+   RT++WNGPLG FE+ PF  AT  VA + A L+K  ++ +IAGGGDT  A
Sbjct: 301 VAEIKHVLNACRTLLWNGPLGAFEMRPFGDATFTVARHAAALSKAGQLATIAGGGDTAAA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L+ AG++++ TY+STAGGAFLEWLEG  LPGI  L
Sbjct: 361 LSLAGVADQITYLSTAGGAFLEWLEGCRLPGIEVL 395


>gi|111074975|gb|ABH04835.1| phosphoglycerate kinase [Heliobacillus mobilis]
          Length = 394

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 261/393 (66%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D++  R L+RVD+NVP  D G + D TRI   +PTI  L++  AKV++ SH G
Sbjct: 4   KTIKDI-DVKAKRVLVRVDFNVPVNDAGVITDDTRIRAALPTIQYLIQAGAKVILASHFG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +    L  +      +L++++  ++DCIG  +  ++     G +IL ENVRFY 
Sbjct: 63  RPKGKVNDKYRLTPIAGHLSELLNRSVKKLDDCIGPDVEAAVKEAQPGDVILLENVRFYP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP+F R L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M KE+S++   
Sbjct: 123 EEEKNDPEFSRKLASLADVYVNDAFGTAHRAHASTAGVAAYLPAVAGFLMDKEISIMGKA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            ++ ++P VA++GG+KV+ KI ++ NL+ KVD L+IGGGMAN+F  A  + VG+SLC++D
Sbjct: 183 LAQPERPFVAVMGGAKVADKIAVIENLLNKVDTLIIGGGMANTFFYAMNLEVGKSLCEKD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +D   ++  +A+++  ++++P DVV+A  +   +PT+VV   ++P D   LD+G ++V+
Sbjct: 243 KADTARELLQKAEKAGVKMMLPVDVVIADTLAANVPTEVVPVNAIPADKSALDIGPESVK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              Q ++ ++ V+WNGP+G FE+EPFDR T+ VA  +  +       +I GGGD++ A+ 
Sbjct: 303 QFAQALSASKMVLWNGPMGAFEVEPFDRGTMGVAQAMVNVQG----TTIIGGGDSVAAVE 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++ + T+VST GGA LE+LEG++LPG+ AL
Sbjct: 359 KAGLAEKMTHVSTGGGASLEFLEGRELPGVAAL 391


>gi|262277503|ref|ZP_06055296.1| phosphoglycerate kinase [alpha proteobacterium HIMB114]
 gi|262224606|gb|EEY75065.1| phosphoglycerate kinase [alpha proteobacterium HIMB114]
          Length = 393

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/396 (43%), Positives = 254/396 (64%), Gaps = 5/396 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS+L+++ DL  I+G +  LRVD+NVP   G+V+D T+IE++   I +L+ +  K+++ S
Sbjct: 1   MSQLKSLKDLSKIKGKKVFLRVDFNVPISGGRVSDATKIEKLEENIKDLLNQNCKIILGS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRPQ K     SL  V  + E IL++ I F+     +  ++ I S S+  I + EN+R
Sbjct: 61  HLGRPQKKGKSGLSLLPVKKMTEKILNEEINFLEI---NNEAKKIISESDNKIFMLENLR 117

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE N  D+ ++L+   D YIN+AFS SHRAHASI  ++  L SY G ++  E+  L
Sbjct: 118 FNPGEEANSKDYAKLLASFADVYINEAFSCSHRAHASIDAITQFLESYAGSSIINEVEAL 177

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E  F  SKKP+  ++GGSK+STKI L+INL+ K+D ++IGG MAN+F   +G  VG+SL 
Sbjct: 178 EKVFLNSKKPVACLIGGSKISTKIDLIINLMPKMDFMIIGGAMANNFFKYEGFNVGKSLL 237

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +    + QI  EAKR+ CE+I+P DVV +++     P +      +  + IILD+G +
Sbjct: 238 EENIEQTIKQIYQEAKRNNCELILPVDVVCSKKFDQ--PGENKKLNEIEDNDIILDIGIE 295

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
               I +++ Q++TV+WNGP G+FE + F   T +++  +A+ TK   +IS+AGGGDT  
Sbjct: 296 GTGKIDEILKQSKTVLWNGPFGLFEYDDFANGTNDISRSIARYTKNNNLISVAGGGDTFA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  +   N FTY+STAGGAFLEWLEGK LPG+  L
Sbjct: 356 AIKKSNQQNNFTYISTAGGAFLEWLEGKMLPGLKVL 391


>gi|163731361|ref|ZP_02138808.1| phosphoglycerate kinase [Roseobacter litoralis Och 149]
 gi|161394815|gb|EDQ19137.1| phosphoglycerate kinase [Roseobacter litoralis Och 149]
          Length = 398

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 183/398 (45%), Positives = 258/398 (64%), Gaps = 8/398 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ D+ G R L+RVD NVP  +G+V D TRI+R++PT+ ++++K    ++ +H GR
Sbjct: 4   KTLDDM-DLAGKRVLVRVDINVPVENGQVTDTTRIDRIIPTLKDILDKGGMPIMLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K   + SL   +   E+ L + + FV     +TLS    SL  G ++L EN RF + 
Sbjct: 63  PKGKVVPEMSLRVTLPALEAALGQKVTFVEKPDVTTLS----SLEAGSVVLIENTRFAAG 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP   + L+  GD + NDAFS +HRAHAS TG++HL+PS  GR MQ ELS LE+  
Sbjct: 119 EEANDPHMAQFLATLGDVFCNDAFSAAHRAHASTTGIAHLMPSCAGRLMQAELSALEAAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P+ A+VGG+KVSTKI LL NLV ++D LVIGGGMAN+FL AQG  +G SL + D+
Sbjct: 179 STPQRPVGAVVGGAKVSTKIALLENLVNRLDVLVIGGGMANTFLAAQGAKLGASLMEPDY 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPL---DSIILDVGFKT 301
            +    I   A+ + C++++P D +VARE K G    V+      +   D ++LD G   
Sbjct: 239 IETALAIMRSAESAGCKVLLPVDGLVAREFKAGAAFDVIPLSKDTVLDDDQMVLDAGPHA 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  +       +T++WNGPLG FEI PF++AT   A    +LTKE  +IS+ GGGDT+ A
Sbjct: 299 VAAVVAAFGTLKTLIWNGPLGAFEIAPFNQATNAAALEAGRLTKEGALISVVGGGDTVAA 358

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           L  AG + +FTY+STAGGAFLEW+EGK LPG+ AL G 
Sbjct: 359 LNQAGAAADFTYISTAGGAFLEWMEGKTLPGVAALKGQ 396


>gi|254437324|ref|ZP_05050818.1| phosphoglycerate kinase [Octadecabacter antarcticus 307]
 gi|198252770|gb|EDY77084.1| phosphoglycerate kinase [Octadecabacter antarcticus 307]
          Length = 392

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 187/394 (47%), Positives = 258/394 (65%), Gaps = 5/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
            T++D+ D+ G   L RVD NVP   G V D TRIER+ PTI+ ++ K  K V+ +H GR
Sbjct: 4   NTLDDM-DLAGKVVLTRVDINVPVKGGVVTDATRIERIKPTIMNILRKGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL   +   E +L + + F+     +T+  + A      +IL EN RF + 
Sbjct: 63  PKGEYVPEMSLKVTIPTLEKVLGRAVTFIERPDRATIDAAPAD----AVILIENTRFSAM 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP     L+  GD + NDAFS +HRAHAS TG++ LLP+  GR M +EL  LE   
Sbjct: 119 EEANDPKMAGFLAGLGDVFCNDAFSAAHRAHASTTGVAELLPNCAGRLMAEELDALEKAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
            + ++P+VA+VGG+KVSTK+ LL NL+ +VD ++IGGGMAN+FL AQG  VG+SLC+ D 
Sbjct: 179 GDPQRPVVAVVGGAKVSTKLDLLGNLIARVDSIIIGGGMANTFLAAQGHDVGKSLCEHDL 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
           +     I  +AK + C +++P DVVVA E KTG   Q V+A + P D +ILD G K+V  
Sbjct: 239 AGTAQDIMAKAKTANCSLLLPCDVVVAAEFKTGAANQTVAADACPPDMMILDAGPKSVAQ 298

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           IK +   A+TV+WNGPLG FEI+PF +AT   A   A LTK   +I++AGGGDT+ AL  
Sbjct: 299 IKTLFETAKTVIWNGPLGAFEIDPFHKATFAAAKAAADLTKSGNLITVAGGGDTVAALNL 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AG++++FTY+S+AGGAFLEW+EGK LPG+  L G
Sbjct: 359 AGVADDFTYISSAGGAFLEWMEGKTLPGVAVLGG 392


>gi|254453253|ref|ZP_05066690.1| phosphoglycerate kinase [Octadecabacter antarcticus 238]
 gi|198267659|gb|EDY91929.1| phosphoglycerate kinase [Octadecabacter antarcticus 238]
          Length = 384

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 251/387 (64%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G   L RVD NVP  +G V D TRIER+ PTI++ +    K V+ +H GRP+ +   
Sbjct: 2   DLAGKVVLTRVDINVPVENGVVTDATRIERIKPTIMDTLAAGGKPVLLAHFGRPKGEYVP 61

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL   V   E +L + + F+     +TL  + A    G +IL EN RF + EE NDP 
Sbjct: 62  EMSLRVTVPTLEKVLGRPVTFIERPDRATLDAAPA----GAVILIENTRFSAMEEANDPK 117

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
               L+  GD + NDAFS +HRAHAS TG++ LLP+  GR M +ELS LE      ++P+
Sbjct: 118 MASFLASLGDVFCNDAFSAAHRAHASTTGVAELLPNCAGRLMAEELSALEKALGNPQRPV 177

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VA+VGG+KVSTK+ LL NL+ +VD +VIGGGMAN+FL AQG  VG+SLC+ D +     I
Sbjct: 178 VAVVGGAKVSTKLDLLGNLISRVDSIVIGGGMANTFLAAQGHDVGKSLCEHDLAGTAQDI 237

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK + C +++P DVVVA E K G   + V+A + P D +ILD G  +V  I  + + 
Sbjct: 238 MAKAKAANCSLLLPSDVVVAAEFKAGAAHETVAADACPPDMMILDAGPNSVAQIAALFST 297

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A+TV+WNGPLG FEI+PF  AT   A   A LTK   +I++AGGGDT+ AL  AG+++ F
Sbjct: 298 AKTVIWNGPLGAFEIDPFQTATFAAAKAAADLTKSGDLITVAGGGDTVAALNLAGVADNF 357

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALSG 398
           TY+S+AGGAFLEW+EGK LPG+ AL G
Sbjct: 358 TYISSAGGAFLEWMEGKTLPGVAALGG 384


>gi|221109623|ref|XP_002163367.1| PREDICTED: similar to phosphoglycerate kinase [Hydra
           magnipapillata]
          Length = 397

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 257/393 (65%), Gaps = 5/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFSHLG 63
           RT++D+ +    + ++R+D NVP  DG + D TRI + +PT+  L++   K +VI SHLG
Sbjct: 4   RTIDDI-NFTNKKIIIRLDLNVPLKDGNILDSTRISKALPTLQHLLKNSPKRLVILSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   D   +L  +      +L + ++F    I   L  ++ SL +G +++ EN+RFY+
Sbjct: 63  RPKGAEDNALTLVPIAEKLSELLGRKVIFETTPISKNLLHNMESLPDGAVVMLENIRFYN 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE N+ +F ++LS  G+ ++N+AFS SHRAHAS+ G++  LPSY G     E+  LES 
Sbjct: 123 SEETNNVEFSKLLSGLGEIFVNEAFSCSHRAHASVAGITQYLPSYAGLGFDAEVKALESV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  K+P++ IV GSKVSTKI LLINL+ K+D L +GGGMAN+ L A+G  +G+SL + +
Sbjct: 183 LN-PKRPVIGIVAGSKVSTKIELLINLLNKLDYLFVGGGMANTILTAKGYNLGKSLVEHE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   QI   AK + C++++P D VVA  +     T+ VS  +V  D  I DVG +T+ 
Sbjct: 242 CLNVAKQILEHAKTAGCKLLLPLDAVVANNIDA--KTENVSIDAVTNDLAIYDVGSETLN 299

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +K+V+ +  TV+WNGP+GV+EI PFD+ +V +A  +A LTK+  + S+AGGGDT+  ++
Sbjct: 300 MLKEVLEKCHTVLWNGPVGVYEIPPFDKGSVAIAEMIANLTKKNSLKSVAGGGDTVAVIS 359

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              + + F+Y+STAGGAFLEWLEGK+LPGI  L
Sbjct: 360 KTNLCDNFSYISTAGGAFLEWLEGKELPGIACL 392


>gi|114763383|ref|ZP_01442790.1| phosphoglycerate kinase [Pelagibaca bermudensis HTCC2601]
 gi|114543921|gb|EAU46932.1| phosphoglycerate kinase [Roseovarius sp. HTCC2601]
          Length = 402

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 180/386 (46%), Positives = 245/386 (63%), Gaps = 1/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKS-D 70
           ++ G R L+R D NVP   G+V+D TRI R    +  L+ K A++VI +H GRP+    D
Sbjct: 10  EVAGQRLLVRADLNVPVEGGRVSDATRITRFAEGMKPLLAKGARLVILTHFGRPKPNELD 69

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              S+ K+       L   + F ++C   +       L +G ++L EN+R+   E  NDP
Sbjct: 70  PSFSVDKLRPALSEALGVPVRFSDNCATDSAVLLSQQLRDGEVLLCENLRYNPGETTNDP 129

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
            F   L+R GD Y+NDAFS +HRAHAS   ++ LLP+Y G  + +E++ L       ++P
Sbjct: 130 AFAAELARLGDLYVNDAFSCAHRAHASTAAVAGLLPAYAGPLLVEEMTALTQALEAPERP 189

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
            VA+VGG+KVSTKI++L NLV K+D ++IGGGMAN+FL A+G  +G SL + D    V Q
Sbjct: 190 SVALVGGAKVSTKISVLKNLVGKLDAVIIGGGMANTFLYARGYRMGTSLHEADQVATVRQ 249

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           I   A+ + CEI++P DVVVARE   G P + V A   P D++ILD G ++ E     + 
Sbjct: 250 IETLAEAAGCEILLPEDVVVAREFAAGAPCETVPADQCPADAMILDAGPQSAEAFMARLN 309

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
            A T++WNGPLG FEI PFD AT  VA   AKL+ E R +++AGGGDT+ AL  AG++ +
Sbjct: 310 HAHTILWNGPLGAFEIPPFDAATAAVARKAAKLSFESRAVTVAGGGDTVAALNAAGVTGD 369

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
           FTYVSTAGGAFLEWLEGK LPGI AL
Sbjct: 370 FTYVSTAGGAFLEWLEGKTLPGIAAL 395


>gi|58697244|ref|ZP_00372634.1| phosphoglycerate kinase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698742|ref|ZP_00373627.1| phosphoglycerate kinase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630837|ref|YP_002727628.1| phosphoglycerate kinase [Wolbachia sp. wRi]
 gi|254782229|sp|C0R4J5|PGK_WOLWR RecName: Full=Phosphoglycerate kinase
 gi|58534740|gb|EAL58854.1| phosphoglycerate kinase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536418|gb|EAL59848.1| phosphoglycerate kinase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592818|gb|ACN95837.1| phosphoglycerate kinase [Wolbachia sp. wRi]
          Length = 398

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 257/387 (66%), Gaps = 5/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+     LLRVD+NVP  DG++ DVTRI R +PTI  LV   AK++I SH GRP+++ D 
Sbjct: 10  DLHNKAVLLRVDFNVPIKDGEIRDVTRILRALPTIQYLVNASAKIIIISHFGRPKAR-DN 68

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  V+     +L+K + F++DC+G  + ++++++  G IIL EN+RFY  E+ ND +
Sbjct: 69  NLSLKNVIDTLSQLLNKKVKFIDDCVGEKVQKAVSAMDAGDIILLENLRFYEGEKENDAN 128

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F R L+   D Y+NDAFS SHRAHASI+ ++  LPSY G  +Q EL  LE   S   KP+
Sbjct: 129 FARQLASLADIYVNDAFSCSHRAHASISRITEFLPSYAGFCLQDELKYLEKAVSFKAKPI 188

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AIVGG+K+STKI +L+ L +KVD LV+GG +AN+FL    + +G+S  Q    D +H I
Sbjct: 189 TAIVGGAKISTKIKVLMKLTEKVDYLVLGGAIANNFLSFSKVNIGKSFFQNGVDDLLHNI 248

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLD-SIILDVGFKTVEYIKQVIA 310
              A ++ C+I+VP DV+VA  + +   T +       LD  IILD+G +T+  I  +IA
Sbjct: 249 VETANKNNCKIVVPEDVLVA--VNSDYSTSISRKTESILDGDIILDIGSQTLSTISSIIA 306

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN- 369
            ++T++WNGP+GVFE   F   T+ V   V+ LT + ++ SI GGGD+++A++ AG+++ 
Sbjct: 307 SSKTLLWNGPIGVFEHSAFASGTIGVMKIVSDLTHKGKLTSIIGGGDSLSAISAAGLTDK 366

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +FTYVST GGAFL+WL G ++PG+ AL
Sbjct: 367 DFTYVSTGGGAFLDWLSGDEMPGVAAL 393


>gi|58584941|ref|YP_198514.1| phosphoglycerate kinase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75507950|sp|Q5GRV2|PGK_WOLTR RecName: Full=Phosphoglycerate kinase
 gi|58419257|gb|AAW71272.1| 3-phosphoglycerate kinase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 399

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 256/387 (66%), Gaps = 5/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G   LLRVD+N+P  +GKV D TR+ R +PTI  LV   AKV+I SH GRP++K D 
Sbjct: 11  DLHGKAVLLRVDFNIPIKNGKVHDATRVLRSLPTIRHLVNAGAKVIIISHFGRPRAK-DN 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  VV     +L+K + FV+DCIG  + + + +++   +IL EN+RFY EEE+ND +
Sbjct: 70  NLSLKNVVKTLSQLLNKEVKFVDDCIGKKVQKVVNAIAIRDVILLENLRFYKEEEQNDAN 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + L+   D Y+NDAFS SHRAHASI+ ++  LPSY G  +Q EL  LE   S   KP+
Sbjct: 130 FAKQLASLADVYVNDAFSCSHRAHASISRITEFLPSYAGFCLQDELRYLEKAVSFEAKPI 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AIVGG+K+STKI +LI L +KVD LV+GG +AN+FL+   + +G+S  Q      +H +
Sbjct: 190 TAIVGGAKISTKIKMLIRLAEKVDYLVLGGAIANNFLLFNKVNIGKSFFQNGVDSLLHDV 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVV-SAQSVPLDSIILDVGFKTVEYIKQVIA 310
              A ++ C+I++P DV++A  + +   T ++   +SV  + +ILD+G +T+  I  ++A
Sbjct: 250 VKIADKNNCKIVIPEDVLIA--VNSDYSTCILRKTESVLDNDVILDIGPQTLSTISSIVA 307

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN- 369
            ++ ++WNGP+GVFE   F   T+EV   V+  T + ++ S+ GGGD+++A+  AG+++ 
Sbjct: 308 SSKALLWNGPIGVFEHSAFANGTIEVMKVVSDSTHKGKLTSVIGGGDSLSAINAAGLTDK 367

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +FTYVST GGAFL WL G  +PGI AL
Sbjct: 368 DFTYVSTGGGAFLSWLSGDKMPGIAAL 394


>gi|323701498|ref|ZP_08113171.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
 gi|323533507|gb|EGB23373.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
          Length = 393

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 167/386 (43%), Positives = 249/386 (64%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R  +RVD+NVP    K+ D TRI + +PTI  L+++ AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKRVFVRVDFNVPLDGDKITDDTRIRKALPTIQYLIDQGAKVILASHLGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V      +L K ++ VN+ +G    Q+IA++  G ++L ENVRF++EE +ND  
Sbjct: 70  KYRLTPVAKRLSELLGKEVIKVNESVGPEPQQAIANMQPGDVLLLENVRFHAEETKNDEK 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           + R L++  D Y+NDAF  +HRAHAS  G++  LP   G  M+KEL ML    +  ++P 
Sbjct: 130 YARQLAQLADVYVNDAFGAAHRAHASTAGIAEYLPGVAGFLMEKELEMLGKAVTNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  VG+SL ++D  D   ++
Sbjct: 190 VAIIGGAKVSDKIGVIENLLTKVDSLIIGGGMANTFLKAQGYNVGKSLLEQDKVDLAREL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK    ++++P DVVVA  M+     +VV    +P D ++LD+G  + E    V+ +
Sbjct: 250 MERAKSRGVDLLLPTDVVVALAMEPTARQKVVPVAEIPDDWMVLDIGPASAEKFAAVVQK 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A TV+WNGP+GVFE+EPF + T  VA  +A         +I GGGD++ A+   G++++ 
Sbjct: 310 AATVVWNGPMGVFEMEPFAKGTEAVARALAN----SNATTIVGGGDSVAAVNKTGVADKI 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           T++ST GGA LE+LEGK+LPG+ AL 
Sbjct: 366 THISTGGGASLEFLEGKELPGVAALQ 391


>gi|42520965|ref|NP_966880.1| phosphoglycerate kinase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|52783769|sp|P62422|PGK_WOLPM RecName: Full=Phosphoglycerate kinase
 gi|42410706|gb|AAS14814.1| phosphoglycerate kinase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 398

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 174/388 (44%), Positives = 258/388 (66%), Gaps = 7/388 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+     LLRVD+NVP  DG++ DVTRI R +PTI  LV   AK++I SH GRP+++ D 
Sbjct: 10  DLHNKTVLLRVDFNVPIKDGEIRDVTRILRALPTIQYLVNASAKIIIISHFGRPKAR-DN 68

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  V+     +L+K + F++DC G  + ++++ +  G IIL EN+RFY EEE++D +
Sbjct: 69  NLSLKNVIDTLSQLLNKKVKFIDDCFGEKVQRAVSVMDAGDIILLENLRFYKEEEQSDSN 128

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + L+   D Y+NDAFS SHRAHASI+ ++  LPSY G  +Q EL  LE   S   KP+
Sbjct: 129 FAKQLASLADIYVNDAFSCSHRAHASISRITEFLPSYAGFCLQDELKYLEKAVSFKAKPI 188

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AIVGG+K+STKI +L+ L +KV+ LV+GG +AN+FL    + +G+S  Q    D +H I
Sbjct: 189 TAIVGGAKISTKIKVLMKLTEKVNYLVLGGAIANNFLSFSKVNIGKSFFQNGVDDLLHNI 248

Query: 252 AWEAKRSACEIIVPRDVVVA--REMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
              A ++ C+I+VP DV+VA   +  T I  +    +S+    IILD+G +T+  I  +I
Sbjct: 249 LETANKNNCKIVVPEDVLVAVNSDYSTSISRR---TESILDGDIILDIGPQTLSTISSII 305

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A ++T++WNGP+GVFE   F   T+ V   V+ LT + ++ SI GGGD+++A++ AG+++
Sbjct: 306 ASSKTLLWNGPIGVFEHSAFASGTIGVMKIVSDLTHKGKLTSIIGGGDSLSAISAAGLAD 365

Query: 370 -EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +FTYVST GGAFL+WL G ++PG+ AL
Sbjct: 366 KDFTYVSTGGGAFLDWLSGDEMPGVAAL 393


>gi|148252056|ref|YP_001236641.1| phosphoglycerate kinase [Bradyrhizobium sp. BTAi1]
 gi|146404229|gb|ABQ32735.1| phosphoglycerate kinase [Bradyrhizobium sp. BTAi1]
          Length = 400

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 174/393 (44%), Positives = 250/393 (63%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L++++D+ DI   R L+R D NVP  +G VAD TRIER V  +  L+ + A+ V+ SHLG
Sbjct: 3   LKSVHDV-DISSRRLLIRADLNVPMNNGGVADATRIERFVAGLKPLLARGARAVVLSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  +   + SL  V +    +L K++ F     G   ++S A+L  G +++ EN+RF  
Sbjct: 62  RPDGQRRPELSLEPVAAALGRVLGKDVAFSEAISGPVAARSAAALGPGDVLVCENLRFDQ 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE ND      L+  GD Y+NDAFS +HRAHAS   ++  LP+  G  M  E+S L   
Sbjct: 122 REEANDASLAEELAELGDLYVNDAFSCAHRAHASTVAIAERLPAVAGPLMMAEISALTQA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P VA+VGG+KVS+KI +L NL+ K+D +++GGGMAN+FL A G+ +G+S  +  
Sbjct: 182 LEAPQRPAVALVGGAKVSSKIDVLFNLIGKLDTVIVGGGMANTFLAANGLPIGKSPHESA 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             + V +I   A+   C+I++P D+V A   + G    +      P   +ILD G +++E
Sbjct: 242 KFETVRKILSRAQSCGCQIVLPVDIVWADRFERGAEAHIAELDCCPQHGMILDAGPRSIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I  V+A+A+T++WNGPLG FEIEPFD AT  VA   A+LT+  ++ SIAGGGDT+ AL 
Sbjct: 302 RIWDVLAEAKTILWNGPLGAFEIEPFDHATEAVAAEAARLTRVGKVKSIAGGGDTVAALN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++ +FTYVSTAGGAFLEWLEGK+LPG+  L
Sbjct: 362 AAGVTEDFTYVSTAGGAFLEWLEGKELPGVSVL 394


>gi|78044457|ref|YP_359153.1| phosphoglycerate kinase [Carboxydothermus hydrogenoformans Z-2901]
 gi|123577044|sp|Q3AFD1|PGK_CARHZ RecName: Full=Phosphoglycerate kinase
 gi|77996572|gb|ABB15471.1| phosphoglycerate kinase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 394

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 257/387 (66%), Gaps = 5/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           +++G +  +RVD+NVP  + + + D TRI   +PT+  L E+ AK+++ SHLGRP+ + +
Sbjct: 10  EVKGKKVFVRVDFNVPLNENREITDDTRIRAALPTLQYLREQGAKLIVASHLGRPKGQFN 69

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +  SL  V      +L   +    D +G  + +    L  G ++L ENVRFY EEE+NDP
Sbjct: 70  EKYSLKPVAKRLAELLGIEVKMAPDVVGPEVEKMAGELRPGEVLLLENVRFYPEEEKNDP 129

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
           +F R L+R  + +++DAF  +HRAHAS  G++  LP+  G  M+KE++ L    +  ++P
Sbjct: 130 EFARKLARLAEIFVSDAFGAAHRAHASTAGIASYLPAVAGFLMEKEINFLSRALNNPERP 189

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
            VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL A G   G+SL + D  +   +
Sbjct: 190 FVAIIGGAKVSDKIGVIENLLGKVDVLLIGGGMANTFLKAMGYETGKSLVEEDKVNLAGE 249

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    ++++P DVVVA  ++ G+P+++V+  S+P + + LD+G KT ++ ++ I 
Sbjct: 250 LMNKAKEVGVKLLLPSDVVVAPRIEAGVPSKIVAVDSIPAEEMALDIGEKTAKHFREEIL 309

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
           +A+TV+WNGP+GVFE+EPFDR TV VA  VA    E   +S+ GGGD++ A+  AG++++
Sbjct: 310 KAKTVVWNGPMGVFEVEPFDRGTVAVAEAVA----ESGALSVVGGGDSVAAVEKAGVADK 365

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVALS 397
            T++ST GGA LE+LEGK LPG+  L+
Sbjct: 366 ITHISTGGGASLEFLEGKKLPGVEVLN 392


>gi|83589132|ref|YP_429141.1| phosphoglycerate kinase [Moorella thermoacetica ATCC 39073]
 gi|123525151|sp|Q2RLU1|PGK_MOOTA RecName: Full=Phosphoglycerate kinase
 gi|83572046|gb|ABC18598.1| phosphoglycerate kinase [Moorella thermoacetica ATCC 39073]
          Length = 393

 Score =  342 bits (876), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 173/397 (43%), Positives = 257/397 (64%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++L T+ DL ++   R L+RVD+NVP   G+V D TRI   +PTI  L++  A+V++ S
Sbjct: 1   MAKL-TLKDL-ELNNKRVLVRVDFNVPLEAGRVTDNTRIRAALPTIEYLLDHGARVILMS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K  ++  L  V    ES+L + +  VNDC+G  +  + A+L  G ++L EN+R
Sbjct: 59  HLGRPKGKVKEELRLDPVARELESLLGRQVHKVNDCVGPEVEAAAAALKPGEVLLLENLR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP F R L+   D Y+NDAF  +HRAHAS  G++H LP+  G  +QKE+  L
Sbjct: 119 FHPEEEKNDPGFARQLASLADVYVNDAFGAAHRAHASTEGVAHYLPAAAGFLLQKEIETL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               ++ ++P VAI+GG+KVS KI+++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL 
Sbjct: 179 GKALADPERPFVAIIGGAKVSDKISVIRNLLTKVDTLIIGGGMANTFLKAQGYAMGKSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D      ++   A +   ++++PRD+VVA+E K   P QVV+  +VP   + LD+G +
Sbjct: 239 EEDQVPLAQELIQLAAQKGVKMLLPRDLVVAQEFKADAPHQVVAVNAVPDGWMALDIGPE 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T       +  ARTV+WNGP+GVFE+E F   T      VA+       ++I GGGD++ 
Sbjct: 299 TARAYAGALEGARTVVWNGPMGVFEMEAFAHGT----EAVARAVAAVDGMTIVGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G++ +  ++ST GGA LE+LEGK LPG+VAL+
Sbjct: 355 AVEKMGVAGKIGHISTGGGASLEFLEGKALPGVVALT 391


>gi|51891380|ref|YP_074071.1| phosphoglycerate kinase [Symbiobacterium thermophilum IAM 14863]
 gi|81692233|sp|Q67SW6|PGK_SYMTH RecName: Full=Phosphoglycerate kinase
 gi|51855069|dbj|BAD39227.1| phosphoglycerate kinase [Symbiobacterium thermophilum IAM 14863]
          Length = 392

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/395 (43%), Positives = 253/395 (64%), Gaps = 9/395 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L T+ D+ D++G R  +RVD+NVP  DG++ D TRI   VPTI  LVE+ A  V+ SHLG
Sbjct: 3   LMTVRDI-DVKGKRVFVRVDFNVPLEDGRITDDTRIRAAVPTIRYLVEEGAVAVLASHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + ++  SL         +L + ++F  DCIG  + + +A    G ++L ENVRFY+
Sbjct: 62  RPKGQRNEKYSLAPCARRLSELLGREVVFAPDCIGEEVERLVAEQPPGSVVLLENVRFYA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLES 182
           EEE+NDP+F   L+R G+ ++NDAF  +HRAHAS  G++  +P  + G  MQKE+ ++  
Sbjct: 122 EEEKNDPEFAAKLARLGEIFVNDAFGTAHRAHASTRGVADHMPVRVAGFLMQKEVDIMGK 181

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S+  +P VAI+GG+KVS KI ++ NL+ KVD+L+IGGGMAN+FL A+G   G+SL + 
Sbjct: 182 ALSDPDRPFVAIIGGAKVSDKIMVIENLLTKVDRLIIGGGMANTFLRARGFATGKSLVEE 241

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  D   ++     +   +I++P D+VVA E K     +VV   ++P   + LD+G +T 
Sbjct: 242 DRVDTAREL---LAKGGDKILLPTDLVVASEFKADAEQKVVPVDAIPEGWMALDIGPETA 298

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
                VI  A TV+WNGP+GVFE+EPF R T  VA  +A        ++I GGGD++ A+
Sbjct: 299 RAFADVIRGAHTVVWNGPMGVFEMEPFARGTFAVAQAMADCEG----VTIVGGGDSVAAV 354

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             AG+++  T+VST GGA LE+LEGK+LPG+  L+
Sbjct: 355 EAAGLADRMTHVSTGGGASLEFLEGKELPGVACLA 389


>gi|260893463|ref|YP_003239560.1| phosphoglycerate kinase [Ammonifex degensii KC4]
 gi|260865604|gb|ACX52710.1| Phosphoglycerate kinase [Ammonifex degensii KC4]
          Length = 392

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 168/392 (42%), Positives = 250/392 (63%), Gaps = 6/392 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ ++RG R L+RVD+NVP  DGKV D TR+   +PTI  L ++ AKV++ SHLGR
Sbjct: 4   KTVKDV-EVRGKRVLVRVDFNVPLKDGKVTDDTRLRAALPTIEYLCQQGAKVILVSHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+   D+   L  V    E +L + +  ++ C+G  + +++A+L+ G ++L EN+RF+  
Sbjct: 63  PKGAPDESLRLDPVAQRLEELLGRPVRKLDSCVGPEVEEAVAALNPGDVLLLENIRFHPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +NDP+  + L++  D Y+NDAF  +HRAHAS  G++ L P+  G  M KE+  L    
Sbjct: 123 ETKNDPELAQGLAKLCDIYVNDAFGTAHRAHASTVGVAKLRPAVAGFLMAKEIEALSRLL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +   +P VA++GG+K+S KI +L +L+ +VD L+IGGGMAN+FL AQG  +GRSL + D 
Sbjct: 183 TSPARPFVALIGGAKISDKIGVLRSLLTRVDSLLIGGGMANTFLAAQGYNLGRSLLEPDQ 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +    I  EA+     +++PRD+VVA   + G   +VV    VP   + LDVG  TVE 
Sbjct: 243 LEQARSIMEEARERGVNLVLPRDLVVAANKEAGAEHRVVPVNEVPEGWMALDVGPATVEE 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
             +++A ART+ WNGPLG FE  P+D  TV VA  +    +     +I GGGDT+ A+  
Sbjct: 303 FCRILAGARTIFWNGPLGYFEQPPYDAGTVAVARALPATAE-----TIVGGGDTVAAVTR 357

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG+++  T++ST GGA LE+LEGK+LPGI  L
Sbjct: 358 AGVADRITHISTGGGASLEFLEGKELPGIAVL 389


>gi|20808180|ref|NP_623351.1| phosphoglycerate kinase [Thermoanaerobacter tengcongensis MB4]
 gi|22095976|sp|Q8R965|PGK_THETN RecName: Full=Phosphoglycerate kinase
 gi|20516772|gb|AAM24955.1| 3-phosphoglycerate kinase [Thermoanaerobacter tengcongensis MB4]
          Length = 394

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 171/392 (43%), Positives = 252/392 (64%), Gaps = 6/392 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           + +T+ D+ D+ G R L+RVD+NVP  + K + D  RI   +PTI  L+   AKV++ SH
Sbjct: 2   KKKTVRDI-DVSGKRVLVRVDFNVPMDENKNITDDRRIREALPTIEYLINHNAKVILVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K + D SL  V      +L K ++   D IG       A+L EG ++L ENVRF
Sbjct: 61  LGRPKGKFNPDYSLKPVAKRLSELLKKPVIMAEDVIGEDAKVKAAALKEGEVLLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           ++EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KELS++ 
Sbjct: 121 HAEEEKNDPEFAKELASLADIYVNDAFGTAHRAHASTAGVAKYLPAVAGFLIEKELSIMG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL +
Sbjct: 181 EALENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +I  +AK+     ++P D V+A+E+K+G+P +VV    +P D I +D+G KT
Sbjct: 241 EDKIELAKEIMEKAKQKGVNFMLPVDTVIAKELKSGVPYEVVDIDKMPEDQIGVDIGPKT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E   +VI  A TV+WNGP+GVFEI  F + T      +AK   E +  +I GGGD+  A
Sbjct: 301 IEEYSKVIKHAMTVVWNGPMGVFEIPEFAKGT----KAIAKALSECKGTTIVGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           +   G +++ T++ST GGA LE+LEGK LPGI
Sbjct: 357 IEQLGYADKVTHISTGGGASLEFLEGKVLPGI 388


>gi|332799911|ref|YP_004461410.1| phosphoglycerate kinase [Tepidanaerobacter sp. Re1]
 gi|332697646|gb|AEE92103.1| Phosphoglycerate kinase [Tepidanaerobacter sp. Re1]
          Length = 394

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 247/387 (63%), Gaps = 5/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           +++  R L+RVD NVP  + G + D TRI   +PTI  L+ K AKV++ SH GRP+ K +
Sbjct: 10  EVKDKRVLVRVDLNVPIDENGDITDDTRIRAALPTINYLISKDAKVILVSHFGRPKGKVN 69

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              SL  V      +L K ++   DCIG T+   +A +    +IL ENVRF+  EE+NDP
Sbjct: 70  PKYSLAPVAKRLSELLDKEVVMAPDCIGETVENLVAQMKPKDVILLENVRFHEGEEKNDP 129

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
           +F R L++  D +INDAF  SHRAHAS  G++  LP+  G  MQKE+ ++ +     ++P
Sbjct: 130 EFARKLAKLADIFINDAFGTSHRAHASTVGVAKFLPAGAGYLMQKEIEIMGNALENPERP 189

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
            VAI+GG+KV  KI ++ NL+ KVD L+IGGGMA +FL +QG  +G+SL + D  +    
Sbjct: 190 FVAILGGAKVGDKIGVIKNLLSKVDVLLIGGGMAYTFLKSQGYEIGKSLLESDKIELAAS 249

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  EAK    ++++P DVVV  E+K G+P + VS   +P D + +D+G KT E    +I 
Sbjct: 250 LLNEAKEKNVKLLLPDDVVVTSELKEGLPYETVSIADIPKDKMGVDIGEKTREKFADIIK 309

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
           +A+TV+WNGP+GVFEIE +   T+ VA  +A    E + ++I GGGD+  A+   G++  
Sbjct: 310 EAKTVIWNGPMGVFEIEEYAAGTLAVAKAMA----ESKAVTIIGGGDSAAAVEQMGLAKY 365

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVALS 397
            T++ST GGA LE+LEGK+LPG+ AL+
Sbjct: 366 MTHISTGGGASLEFLEGKELPGVAALN 392


>gi|289578742|ref|YP_003477369.1| phosphoglycerate kinase [Thermoanaerobacter italicus Ab9]
 gi|289528455|gb|ADD02807.1| Phosphoglycerate kinase [Thermoanaerobacter italicus Ab9]
          Length = 393

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 255/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+  KAKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINNKAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K +    D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKFNPEYSLKPVAKRLSELLGKQVSMAEDVIGEDARAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDPQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPKDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T      +AK   E +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGT----EAIAKALSECKGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ T++ST GGA LE+LEGK LPGI  L+
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLN 391


>gi|167039950|ref|YP_001662935.1| phosphoglycerate kinase [Thermoanaerobacter sp. X514]
 gi|256751247|ref|ZP_05492127.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915491|ref|ZP_07132803.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X561]
 gi|307724726|ref|YP_003904477.1| phosphoglycerate kinase [Thermoanaerobacter sp. X513]
 gi|166854190|gb|ABY92599.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X514]
 gi|256749802|gb|EEU62826.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888443|gb|EFK83593.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X561]
 gi|307581787|gb|ADN55186.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X513]
          Length = 393

 Score =  338 bits (867), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 255/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+   AKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIQYLINNNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K +    D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKVNPEYSLKPVAKRLSELLGKQVSMAEDVIGEDAKAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDPQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPQDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T      +AK   E + I+I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGT----EAIAKALSECKGITIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ T++ST GGA LE+LEGK LPGI  L+
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIEVLN 391


>gi|134298012|ref|YP_001111508.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
 gi|134050712|gb|ABO48683.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
          Length = 393

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/389 (43%), Positives = 247/389 (63%), Gaps = 6/389 (1%)

Query: 10  LRDI--RGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQS 67
           LR+I  +G R  +RVD+NVP    K+ D TRI++ +PTI  LVE+ A+V++ SHLGRP+ 
Sbjct: 6   LREIAVKGKRVFVRVDFNVPLDGDKITDDTRIQKALPTIQYLVEQGARVILASHLGRPKG 65

Query: 68  KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
           +  +   L  V      +L K +L VND +G  + Q +A + EG ++L ENVRFY+ E +
Sbjct: 66  EVVEKYRLTPVAQRLSELLGKQVLKVNDSVGQEVLQVVAGMDEGDVVLLENVRFYAAETK 125

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSES 187
           ND  + R L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KELSML    +  
Sbjct: 126 NDEQYARQLAELADIYVNDAFGAAHRAHASTAGIARFLPAVAGFLMEKELSMLGQAVTTP 185

Query: 188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDN 247
           ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL+AQG  +G SL + D    
Sbjct: 186 QRPFVAIIGGAKVSDKIGVIENLLNKVDVLIIGGGMANTFLMAQGYRIGNSLVEADKVKL 245

Query: 248 VHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQ 307
             ++   AK    ++++P DV+VA+ M+  +  QVV    +P   + LD+G +T      
Sbjct: 246 AAELIERAKARQVQLLLPTDVLVAQTMEPEVEQQVVPVTGIPEQWMALDIGPETAANFAA 305

Query: 308 VIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGI 367
            +  A TV+WNGP+GVFE+E F + T      VAK   E    SI GGGD++ A+   G+
Sbjct: 306 AVKSAATVVWNGPMGVFEMEAFAKGT----EAVAKALAEAPATSIVGGGDSVAAINKIGL 361

Query: 368 SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +++ +++ST GGA LE+LEGK+LPG+ AL
Sbjct: 362 AHKISHISTGGGASLEFLEGKELPGVAAL 390


>gi|309388869|gb|ADO76749.1| phosphoglycerate kinase [Halanaerobium praevalens DSM 2228]
          Length = 394

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/393 (42%), Positives = 253/393 (64%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D +G + L+RVD+NVP  DG V D TRI+  +PTI  L++++AKV++ SHLGR
Sbjct: 3   KTLKDM-DFKGKKVLVRVDFNVPLKDGVVGDKTRIKAALPTIEYLIKEEAKVLLISHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +   D  +  V     ++L+K +   +DCIG  L ++  +L  G ++L EN RFY+ 
Sbjct: 62  PGGEVKSDLKMDPVAKALANLLNKEVKKADDCIGDELKKAANNLENGEVLLLENSRFYAG 121

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E++NDP+F + L+   D Y+NDAF  +HRAHA+  G++  LP+  G  MQ+EL+ L    
Sbjct: 122 EKKNDPEFAKKLASLADLYVNDAFGAAHRAHATTVGVTEYLPAAAGFLMQRELNALGEVM 181

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
                P VAI+GG+KVS KI ++ NL+ KVDKL++ GG+AN+FL+A+G  VG SL + D 
Sbjct: 182 ENPASPFVAIMGGAKVSDKIDVIKNLINKVDKLIVAGGIANTFLLAKGYEVGDSLVEADK 241

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF-KTVE 303
            +   ++  EA+    EI++P DVV+A +      T+ VS + VP    ILD G  +++E
Sbjct: 242 VELAKELMAEAEEKGVEIVLPIDVVIADDFSNDANTKTVSVEKVPAGWQILDCGGPQSLE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
             K++I  A+TV+WNGPLGVFE+E F   TVE+A  +A    E    S+ GGGD+  A+ 
Sbjct: 302 NYKEIIKTAKTVIWNGPLGVFEMEKFAHGTVELAKALA----ESDAHSVIGGGDSAAAIN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++ + +++ST GGA L + EGK+LPG+ AL
Sbjct: 358 EAGVAEKMSHISTGGGASLMFFEGKELPGVAAL 390


>gi|255264801|ref|ZP_05344143.1| phosphoglycerate kinase [Thalassiobium sp. R2A62]
 gi|255107136|gb|EET49810.1| phosphoglycerate kinase [Thalassiobium sp. R2A62]
          Length = 395

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 174/397 (43%), Positives = 254/397 (63%), Gaps = 8/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D+ ++ G   L RVD NVP  +G V D TRI+R+VPTI +++    K V+ +H GR
Sbjct: 4   KTLDDM-ELDGKTVLTRVDINVPVENGAVTDTTRIDRIVPTIRDILASGGKPVLLAHFGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL  +V   E+     + F+         ++  +L +  ++L EN RF + 
Sbjct: 63  PKGQVVPEMSLKPLVPALEAAFCTAVTFIE----RPSREAFDALPQDAVVLIENTRFSAM 118

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE NDP     L+  GD Y NDAFS +HRAHAS TG++ LLP+  GR M +EL+ LE   
Sbjct: 119 EEANDPKMAGFLATLGDIYCNDAFSAAHRAHASTTGVAELLPNCAGRLMAEELAALEKAL 178

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
            + ++P+ A+VGG+KVSTK+ LL NLV+K+D L+IGGGMAN+FL+AQG  +G SL + D 
Sbjct: 179 GDPQRPVGAVVGGAKVSTKLDLLNNLVEKLDVLIIGGGMANTFLMAQGAQLGASLVEADL 238

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV--SAQSV-PLDSIILDVGFKT 301
            D   +I  +A  + C +++P D +V+R    G   + +  +A++V   D ++LD G  +
Sbjct: 239 LDTAREIMAKAHTTGCALVLPTDGLVSRAFAAGANFEEIELTAETVLDADQMVLDAGPAS 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  +   I    T++WNGPLG FEIEPFD AT+  A   A+ T++  ++S+AGGGDTI A
Sbjct: 299 VAAVILQIGDLNTLIWNGPLGAFEIEPFDTATIACAQIAAQHTRDGSLVSVAGGGDTIAA 358

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG + +FTY+STAGGAFLEW+EGK LPG+ AL G
Sbjct: 359 LNQAGAAADFTYISTAGGAFLEWMEGKKLPGVAALGG 395


>gi|68171558|ref|ZP_00544935.1| Phosphoglycerate kinase [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999024|gb|EAM85698.1| Phosphoglycerate kinase [Ehrlichia chaffeensis str. Sapulpa]
          Length = 394

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 249/385 (64%), Gaps = 5/385 (1%)

Query: 4   LRTMNDLRDIR--GLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
            R M  ++D    G   LLR D NVP  +G V D TRI R+  TI  L+   AK+VI SH
Sbjct: 9   FRNMKKIQDFSCSGKTVLLRADLNVPVDNGIVLDDTRIVRLTTTIKYLLSNDAKIVIMSH 68

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            G P+S  DK+ SL  VV     I   N++F++  IG  + Q+I S+  G I+L EN+RF
Sbjct: 69  YGSPKS-YDKEFSLKFVVEYLNKIFATNVVFIDGVIGDYVEQTIQSVPAGTILLLENLRF 127

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + L+   D Y+NDAFS  HR HASI  ++ ++PS+IG   Q+E+  L 
Sbjct: 128 YAEEEKNDLNFAKQLALLADIYVNDAFSCLHRKHASIDAITRVMPSFIGFNFQEEMKYLS 187

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S S+KP+  IVGGSK+STK+ +L NL+KK+D L++GG +AN+FL++QG+ +G+SL +
Sbjct: 188 CVVSNSEKPVAVIVGGSKISTKVHMLKNLIKKIDFLIVGGAIANNFLLSQGLKIGKSLYE 247

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D V +I   AKR  C+IIVP D VVA+    G  T +    ++  D +ILDVG +T
Sbjct: 248 ELEKDLVTEIVDLAKRYECKIIVPVDYVVAKNYICGDST-IKDNDTLESDDMILDVGPQT 306

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  I   I + RTV+WNGP G+FE EPF + T  VA+ ++KLTK  ++ SI GGGD+I A
Sbjct: 307 VNMIAATINKCRTVLWNGPCGMFEKEPFSKGTFSVANLLSKLTKVGKLKSIVGGGDSICA 366

Query: 362 LAHAGISNE-FTYVSTAGGAFLEWL 385
           +  +G+SNE FTY+ST GGA L +L
Sbjct: 367 IKLSGLSNEDFTYISTGGGALLHFL 391


>gi|217967518|ref|YP_002353024.1| phosphoglycerate kinase [Dictyoglomus turgidum DSM 6724]
 gi|226699803|sp|B8E2D3|PGK_DICTD RecName: Full=Phosphoglycerate kinase
 gi|217336617|gb|ACK42410.1| Phosphoglycerate kinase [Dictyoglomus turgidum DSM 6724]
          Length = 396

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 165/395 (41%), Positives = 249/395 (63%), Gaps = 6/395 (1%)

Query: 5   RTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +T+ DLRD  ++G R L+RVD+NVP  +G + D  RI   +PTI  L++K AKV++ SHL
Sbjct: 4   KTILDLRDEDLKGKRVLVRVDFNVPLKNGVITDDRRIREALPTIKYLMDKGAKVILVSHL 63

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   D D  L  V      +L K +  +NDCIG  + + I+++ EG +IL EN+RFY
Sbjct: 64  GRPKGFQD-DLRLDPVAKRLSELLGKPVKKLNDCIGEEVEREISNMKEGDVILLENIRFY 122

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EEE NDP+F + L+   D Y+NDAF  +HRAHAS  G++  +P   G  M+KE+ ++  
Sbjct: 123 KEEEANDPEFAKKLASLADLYVNDAFGTAHRAHASTAGVAQYIPGVAGLLMKKEIEIMGK 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                ++P + I+GG+KVS KI ++ NL+ KVD  +IGGGM  +FL A G  +G+S+ + 
Sbjct: 183 ALESPERPFICILGGAKVSDKIGVIKNLMNKVDGFLIGGGMMFTFLKALGYEIGKSIVEE 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  D   +I   AK    + ++P+D VV +E+K   PT +        D I +D+G KT+
Sbjct: 243 DKLDLAREIMNMAKERGIQFLLPKDAVVVKEIKEDAPTSIKDIDKFEKDDIGVDIGPKTI 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E  ++ I +A+T++WNGP+G+FEI  F   T ++A  +A   + R  +SI GGGD+  A+
Sbjct: 303 ELFREEILKAKTIIWNGPMGIFEIPAFANGTRKIAEAIA---ENRNCVSIVGGGDSAAAI 359

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              G+ ++FT++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 QTLGLEDKFTHISTGGGASLEFLEGKELPGVAVLQ 394


>gi|167037150|ref|YP_001664728.1| phosphoglycerate kinase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115569|ref|YP_004185728.1| phosphoglycerate kinase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326390584|ref|ZP_08212140.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus JW 200]
 gi|166855984|gb|ABY94392.1| Phosphoglycerate kinase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928660|gb|ADV79345.1| Phosphoglycerate kinase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993409|gb|EGD51845.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus JW 200]
          Length = 393

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 169/394 (42%), Positives = 254/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+   AKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINHNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K ++   D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKVNPEYSLKPVAKRLSELLGKQVIMAEDVIGDDAKTKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDTQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPQDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T      +AK   E +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGT----EAIAKALSECKGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ T++ST GGA LE+LEGK LPGI  L+
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLN 391


>gi|297544979|ref|YP_003677281.1| phosphoglycerate kinase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842754|gb|ADH61270.1| Phosphoglycerate kinase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 393

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 169/394 (42%), Positives = 254/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+  KAKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINNKAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K +    D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKFNPEYSLKPVAKRLSELLGKQVSMAEDVIGEDARAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDPQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +A +    +++P D V+A+E+K+G+P +VV    +P D I +D+G +T+E
Sbjct: 242 KIELAKELMEKANQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPKDQIGVDIGPQTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T      +AK   E +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGT----EAIAKALSECKGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ T++ST GGA LE+LEGK LPGI  L+
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLN 391


>gi|219670714|ref|YP_002461149.1| phosphoglycerate kinase [Desulfitobacterium hafniense DCB-2]
 gi|219540974|gb|ACL22713.1| Phosphoglycerate kinase [Desulfitobacterium hafniense DCB-2]
          Length = 395

 Score =  336 bits (861), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 165/391 (42%), Positives = 249/391 (63%), Gaps = 7/391 (1%)

Query: 10  LRDI--RGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQ 66
           L+DI  +G R  +RVD+NVP  D G + + TRI   +PTI  L+++ AK+++ SHLGRP+
Sbjct: 7   LKDIAVQGKRVFVRVDFNVPMDDHGNITNDTRIRAALPTIHYLIDEGAKIILASHLGRPK 66

Query: 67  SKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEE 126
            K D + SL  V      +L + +    DCIG  + ++ A L EG ++L ENVR+++EEE
Sbjct: 67  GKPDPNYSLAPVAKRLGELLKRPVAMATDCIGPEVEKAAAQLQEGEVLLLENVRYHAEEE 126

Query: 127 RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSE 186
           +N+P+FV+ L+R  + Y+NDAF  +HRAHAS  G++H LP   G  +QKE+  +      
Sbjct: 127 KNEPEFVKQLARLAEVYVNDAFGTAHRAHASTEGIAHHLPGVAGFLLQKEIESMGKALEN 186

Query: 187 SKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSD 246
            ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL + D   
Sbjct: 187 PERPFVAIIGGAKVSDKIGVIENLLHKVDALIIGGGMANTFLKAQGYSLGKSLVEGDKLS 246

Query: 247 NVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIK 306
              +I  + +    +I++P+DVV A+E K   P +V   + +  D + LD+G ++     
Sbjct: 247 LAQEILEQGRELQVDILLPQDVVAAKEFKADAPYRVTPVREIAEDEMALDIGPESAGLFS 306

Query: 307 QVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAG 366
             I +ART++WNGP+GVFE+E F + T +VA  VA        ++I GGGD++ A+   G
Sbjct: 307 ARIQKARTIVWNGPMGVFEMEQFAKGTEKVAQAVALCPG----LTIVGGGDSVAAVEKMG 362

Query: 367 ISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  + +++ST GGA L+ LEGK LPGI AL 
Sbjct: 363 VGEQMSHISTGGGASLKLLEGKTLPGIAALQ 393


>gi|307298983|ref|ZP_07578785.1| triosephosphate isomerase [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915408|gb|EFN45793.1| triosephosphate isomerase [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 655

 Score =  336 bits (861), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 175/400 (43%), Positives = 257/400 (64%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID--GKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+  T+ D+ D+ G R L+RVD+NVP     G+V+D TRI   +PTI E++E+  K ++
Sbjct: 1   MSKTLTLKDI-DLAGKRVLVRVDFNVPLDKETGEVSDDTRIVAALPTINEIIERGGKAIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+ K D   SL KV    +S++ K + FV DCIG  + ++++ ++ G I+L EN
Sbjct: 60  VSHLGRPKGKRDPKYSLEKVAERLQSLIGKPVTFVPDCIGEEVEKAVSKMNNGDILLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRFYSEEE+NDPDF R LS   D ++NDAF  +HR+HAS  G++  L S  G  MQKE+ 
Sbjct: 120 VRFYSEEEKNDPDFSRRLSSIADIHVNDAFGTAHRSHASNVGVARYLTSVPGFLMQKEIE 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ML       + P V I+GG+KVS KI ++ NL++K D+++IGG M  +FL AQG  VG S
Sbjct: 180 MLGMAIENPEHPYVVILGGAKVSDKIGVITNLLEKADRILIGGAMMFTFLKAQGKSVGDS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDV 297
           L + D  D   +I  +A+    E ++P D V+A+E+  G  ++VV   + VP     LD+
Sbjct: 240 LVEEDKIDLAREILQKAREKNVEFVLPVDTVIAKEIAAGSESKVVDLEEGVPAGWKGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + ++ A+TV+WNGP+GVFEI+ F + T  +A  +A L      ++I GGGD
Sbjct: 300 GPSTIELFNKKLSDAKTVVWNGPMGVFEIDDFAKGTESIARTLASLND---AVTIIGGGD 356

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  A+   G++ + ++VST GGA LE LEGK++PGI +LS
Sbjct: 357 SAAAINKFGLAEKVSHVSTGGGASLEMLEGKEMPGIKSLS 396


>gi|89897587|ref|YP_521074.1| hypothetical protein DSY4841 [Desulfitobacterium hafniense Y51]
 gi|89337035|dbj|BAE86630.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 395

 Score =  335 bits (860), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 165/391 (42%), Positives = 249/391 (63%), Gaps = 7/391 (1%)

Query: 10  LRDI--RGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQ 66
           L+DI  +G R  +RVD+NVP  D G + + TRI   +PTI  L+++ AK+++ SHLGRP+
Sbjct: 7   LKDIAVQGKRVFVRVDFNVPMDDHGNITNDTRIRAALPTIDYLIDEGAKIILASHLGRPK 66

Query: 67  SKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEE 126
            K D + SL  V      +L + +    DCIG  + ++ A L EG ++L ENVR+++EEE
Sbjct: 67  GKPDPNYSLAPVAKRLGELLKRPVAMATDCIGPEVEKAAAQLQEGEVLLLENVRYHAEEE 126

Query: 127 RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSE 186
           +N+P+FV+ L+R  + Y+NDAF  +HRAHAS  G++H LP   G  +QKE+  +      
Sbjct: 127 KNEPEFVKQLARLAEVYVNDAFGTAHRAHASTEGIAHHLPGVAGFLLQKEIESMGKALEN 186

Query: 187 SKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSD 246
            ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL + D   
Sbjct: 187 PERPFVAIIGGAKVSDKIGVIENLLHKVDALIIGGGMANTFLKAQGYSLGKSLVEGDKLS 246

Query: 247 NVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIK 306
              +I  + +    +I++P+DVV A+E K   P +V   + +  D + LD+G ++     
Sbjct: 247 LAQEILEQGRELQVDILLPQDVVAAKEFKADAPYRVTPVREIAEDEMALDIGPESAGLFS 306

Query: 307 QVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAG 366
             I +ART++WNGP+GVFE+E F + T +VA  VA        ++I GGGD++ A+   G
Sbjct: 307 ARIQKARTIVWNGPMGVFEMEQFAKGTEKVAQAVALCPG----LTIVGGGDSVAAVEKMG 362

Query: 367 ISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  + +++ST GGA L+ LEGK LPGI AL 
Sbjct: 363 VGEQMSHISTGGGASLKLLEGKTLPGIAALQ 393


>gi|302390385|ref|YP_003826206.1| phosphoglycerate kinase [Thermosediminibacter oceani DSM 16646]
 gi|302201013|gb|ADL08583.1| phosphoglycerate kinase [Thermosediminibacter oceani DSM 16646]
          Length = 394

 Score =  335 bits (859), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 248/394 (62%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D  D++G R L+RVD+NVP  D G + D TRI   +PTI  LV ++AKV++ SHLG
Sbjct: 4   KTVEDF-DVKGRRVLVRVDFNVPMDDRGTITDDTRIRAALPTIEYLVNREAKVILASHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V      +L + ++   DCIG  + +++AS+  G ++L ENVRFY+
Sbjct: 63  RPKGKFNPKYSLAPVARRLSELLGREVIMAEDCIGGKVEKAVASMKPGDVMLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND  F   L++  D YINDAF  +HRAHAS  G++  LP+  G  M+KE+  +   
Sbjct: 123 EEEANDRGFAEKLAKLADIYINDAFGTAHRAHASTAGVAEFLPAGAGFLMKKEIETMGRA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +FL + G  +G SL + D
Sbjct: 183 LENPDRPFVAILGGAKVSDKIGVIKNLLGKVDHLLIGGGMAFTFLKSMGYNIGMSLLEED 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  EA++   E+++P DVVVA E+K G+  + V    +P D I +D+G  T E
Sbjct: 243 KVELAASLLEEARKKGVEVLLPVDVVVAPEIKEGVGYRTVPVSEIPDDMIGVDIGEATRE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI +A TV+WNGP+GVFEI  F   T+ VA  +A    E   ++I GGGD+  A+ 
Sbjct: 303 RFAEVIKKAGTVVWNGPMGVFEIRAFAEGTLAVARAMA----ESGAVTIVGGGDSAAAVE 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G ++  T++ST GGA LE+LEGK+LPG+  L+
Sbjct: 359 QLGFADSMTHISTGGGASLEFLEGKELPGVAVLN 392


>gi|330836441|ref|YP_004411082.1| phosphoglycerate kinase [Spirochaeta coccoides DSM 17374]
 gi|329748344|gb|AEC01700.1| phosphoglycerate kinase [Spirochaeta coccoides DSM 17374]
          Length = 394

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 172/396 (43%), Positives = 251/396 (63%), Gaps = 8/396 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKA-KVVIFSH 61
           +L T+ D + + G R L+RVD+NVP  DG V D TRI   +PT+  ++ KK   +V+ +H
Sbjct: 2   KLNTIEDAK-LEGKRVLIRVDFNVPLKDGVVTDDTRIVAALPTVKHILGKKGTSLVVMTH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + + + SL  V    E +L   +   +D IGS + + +ASL  G ++L ENVRF
Sbjct: 61  LGRPKGQKNMEFSLAPVARRFEELLGSPVKLASDVIGSQVKEDVASLKPGEVLLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y EEE NDP F + L+  GD Y+NDAF  +HRAHAS  G++H LP+Y G  ++KE+  + 
Sbjct: 121 YKEEEANDPAFAKELASFGDIYVNDAFGTAHRAHASTEGVAHFLPAYAGYLIEKEVRFMA 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                   P VAI+GG+KVS+KIT+L +L+K VD +VIGGGMA +FL  QG  +G SL +
Sbjct: 181 PLLENPAHPFVAIIGGAKVSSKITVLESLLKTVDTIVIGGGMAYTFLKVQGREIGGSLFE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFK 300
            D+         +A+    ++I+P D V A E  +T +P  V  A  VP D + LD+G K
Sbjct: 241 PDYIGTAESFLKKAEDKGVKVILPVDYVCASEFSETAVPVYV-DAPDVPADMMSLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T + I   I+ A++V+WNGP+GVFE E F + T+ VA  +A        +++ GGGD++ 
Sbjct: 300 TTQLIIDAISTAKSVVWNGPMGVFEFEAFAKGTLAVAQALAA----SSAVTVVGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++++ ++VST GGA LE+LEGK+LPGIVAL
Sbjct: 356 AINKFGLADKISHVSTGGGASLEFLEGKELPGIVAL 391


>gi|51241761|dbj|BAD36768.1| phosphoglycerate kinase, chloroplast precursor [Cyanidioschyzon
           merolae]
          Length = 477

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 171/397 (43%), Positives = 250/397 (62%), Gaps = 4/397 (1%)

Query: 3   RLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           R+R++ DL+D  IRG R  +R D NVP    ++ D TRI   VPTI  L +K AKV++ S
Sbjct: 79  RVRSIRDLQDAEIRGKRVFVRSDLNVPLDGKRITDDTRIRASVPTIKYLADKGAKVIVVS 138

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +   SL  V      +L K +    DCIG  ++  +A++S G ++L ENVR
Sbjct: 139 HLGRPKGGFEDKYSLAPVAERLSELLGKKVRMAKDCIGDAVATEVAAMSPGDVVLLENVR 198

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSM 179
           FY EEE+NDPDF R L+ N D Y+NDAF  +HRAHAS  G++  L P+  G  ++KEL  
Sbjct: 199 FYPEEEKNDPDFARKLAANADLYVNDAFGTAHRAHASTEGVTAFLKPAVAGFLLEKELDY 258

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +     K+P  AIVGGSKVSTKI +L  L++K D ++IGGGM  +FL A+G+  G SL
Sbjct: 259 LSNAIESPKRPFAAIVGGSKVSTKIAVLEKLLQKCDTIIIGGGMVFTFLRARGLKTGSSL 318

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +    I  EA++   E+++P DVVVA +      T+VV  + +P   + LD G 
Sbjct: 319 VEEDKIELARVIEEEARKRGIELLLPLDVVVADKFANDANTKVVPVEEIPDGWMGLDNGP 378

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T   I++ +   +TV+WNGPLGVFE+  F + T  +A  +A++T +   I+I GGGD++
Sbjct: 379 ETTRMIQEKLRTMKTVLWNGPLGVFEMPNFAKGTFAIAETLAEIT-QNGCITIVGGGDSV 437

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  +G +++ +++ST GGA LE +EG+ LPG+ AL
Sbjct: 438 AAMEQSGKADKVSHISTGGGAALELIEGRVLPGVAAL 474


>gi|302840184|ref|XP_002951648.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
 gi|11134148|sp|Q9SBN4|PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|5902588|gb|AAD55564.1|AF110782_1 phosphoglycerate kinase precursor [Volvox carteri f. nagariensis]
 gi|300263257|gb|EFJ47459.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
          Length = 462

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/398 (43%), Positives = 257/398 (64%), Gaps = 8/398 (2%)

Query: 5   RTMNDL--RDIRGLRCLLRVDWNVPFIDGK---VADVTRIERVVPTILELVEKKAKVVIF 59
           +++ DL   D+ G R  +R D NVP +D K   + D TRI   VPT+  L++  AKV++ 
Sbjct: 64  KSVGDLGKADLEGKRVFVRADLNVP-LDKKTLAITDDTRIRAAVPTLKYLLDNGAKVLLT 122

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   +    L  VV+    +L K +  V+DCIG ++ Q++ASL  G ++L ENV
Sbjct: 123 SHLGRPKGGPEDKYRLTPVVARLSELLGKEVKKVDDCIGPSVEQAVASLKSGELLLLENV 182

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELS 178
           RFY EEE+NDP+F + L+ N D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL 
Sbjct: 183 RFYKEEEKNDPEFAKKLASNADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELD 242

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L+   S  K+P VAIVGGSKVS+KIT++  L++K DK++IGGGM  +F  A+G+ VG S
Sbjct: 243 YLDGAVSAPKRPFVAIVGGSKVSSKITVIEKLMEKCDKIIIGGGMIFTFYKARGLKVGSS 302

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  +    +   AK    ++++P DVVVA +      TQ VS +++P   + LD+G
Sbjct: 303 LVEEDKLELAKNLEAIAKAKGVQLLLPSDVVVADKFDANANTQTVSVEAIPDGWMGLDIG 362

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             +++  +  +A A+TV+WNGP+GVFE   F   TV +A+ +++LT  +  I+I GGGD+
Sbjct: 363 PDSIKTFQDALADAKTVVWNGPMGVFEFPKFAVGTVAIANTLSELT-PKGAITIIGGGDS 421

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 422 VAAVEQAGVAEKMSHISTGGGASLELLEGKVLPGVAAL 459


>gi|88658248|ref|YP_506886.1| phosphoglycerate kinase [Ehrlichia chaffeensis str. Arkansas]
 gi|88599705|gb|ABD45174.1| phosphoglycerate kinase [Ehrlichia chaffeensis str. Arkansas]
          Length = 383

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 248/382 (64%), Gaps = 8/382 (2%)

Query: 10  LRDIRGLRC-----LLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           ++ I+   C     LLR D NVP  +G V D TRI R+  TI  L+   AK+VI SH G 
Sbjct: 1   MKKIQDFSCSGKTVLLRADLNVPVDNGIVLDDTRIVRLTTTIKYLLSNDAKIVIMSHYGS 60

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+S  DK+ SL  VV     I   N++F++  IG  + Q+I S+  G I+L EN+RFY+E
Sbjct: 61  PKS-YDKEFSLKFVVEYLNKIFATNVVFIDGVIGDYVEQTIQSVPAGTILLLENLRFYAE 119

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND +F + L+   D Y+NDAFS  HR HASI  ++ ++PS+IG   Q+E+  L    
Sbjct: 120 EEKNDLNFAKQLALLADIYVNDAFSCLHRKHASIDAITRVMPSFIGFNFQEEMKYLSCVV 179

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S S+KP+  IVGGSK+STK+ +L NL+KK+D L++GG +AN+FL++QG+ +G+SL +   
Sbjct: 180 SNSEKPVAVIVGGSKISTKVHMLKNLIKKIDFLIVGGAIANNFLLSQGLKIGKSLYEELE 239

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D V +I   AKR  C+IIVP D VVA+    G  T +    ++  D +ILDVG +TV  
Sbjct: 240 KDLVTEIVDLAKRYECKIIVPVDYVVAKNYICGDST-IKDNDTLESDDMILDVGPQTVNM 298

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I   I + RTV+WNGP G+FE EPF + T  VA+ ++KLTK  ++ SI GGGD+I A+  
Sbjct: 299 IAATINKCRTVLWNGPCGMFEKEPFSKGTFSVANLLSKLTKVGKLKSIVGGGDSICAIKL 358

Query: 365 AGISNE-FTYVSTAGGAFLEWL 385
           +G+SNE FTY+ST GGA L +L
Sbjct: 359 SGLSNEDFTYISTGGGALLHFL 380


>gi|206900130|ref|YP_002250853.1| phosphoglycerate kinase [Dictyoglomus thermophilum H-6-12]
 gi|226699802|sp|B5YE95|PGK_DICT6 RecName: Full=Phosphoglycerate kinase
 gi|206739233|gb|ACI18291.1| phosphoglycerate kinase [Dictyoglomus thermophilum H-6-12]
          Length = 396

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 163/395 (41%), Positives = 248/395 (62%), Gaps = 6/395 (1%)

Query: 5   RTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +T+ DL+D  ++G R L+RVD+NVP  +G + D  RI   +PTI  L+++ AKV++ SHL
Sbjct: 4   KTILDLQDEELKGKRVLVRVDFNVPIKNGVITDDRRIREALPTIKYLIDRGAKVILVSHL 63

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   D D  L  V      +L K +  +NDCIG  + + I+++ EG ++L EN+RFY
Sbjct: 64  GRPKGFQD-DLRLDPVAKRLSELLGKPVKKLNDCIGEEVEKEISNMKEGDVVLLENIRFY 122

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EEE NDP+F + L++  D Y+NDAF  +HRAHAS  G++  +P   G  M+KE+ ++  
Sbjct: 123 KEEEANDPEFAKKLAKLADLYVNDAFGTAHRAHASTAGVAQYIPGVAGLLMKKEIEIMGK 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                ++P + I+GG+KVS KI ++ NL+ KVD  +IGGGM  +FL A G   G+S+ + 
Sbjct: 183 ALESPERPFICILGGAKVSDKIGVIKNLMTKVDGFLIGGGMMFTFLKALGYETGKSIVED 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  +   +I   AK    E ++P+D VV +E+K   PT +        D I +D+G KT+
Sbjct: 243 DKLELAKEIMNMAKERGVEFLLPKDAVVVKEIKEDAPTSIKDVDKFEKDDIGVDIGPKTI 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E  ++ I +ART++WNGP+G+FEI  F   T  +A  +A   + +  ISI GGGD+  A+
Sbjct: 303 ELFREEILKARTIIWNGPMGIFEIPAFANGTRRIAEAIA---ENKNCISIVGGGDSAAAI 359

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              G+ ++FT++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 QMLGLEDKFTHISTGGGASLEFLEGKELPGVAVLQ 394


>gi|47177007|ref|YP_015618.1| phosphoglycerate kinase [Oligotropha carboxidovorans OM5]
 gi|47115398|emb|CAG28451.1| phosphoglycerate-kinase [Oligotropha carboxidovorans OM5]
          Length = 333

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 162/326 (49%), Positives = 222/326 (68%), Gaps = 1/326 (0%)

Query: 72  DCSLFKVVSIAESILHKNILFV-NDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           D SL  +    E  L +++ FV  D         +A    G I+L EN RF+  EE NDP
Sbjct: 3   DYSLAPLRPALEKSLKRSVRFVETDWRNGAPRAEVAKAIPGDILLMENTRFHPGEEENDP 62

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
           +F R L+  GD ++NDAFSVSHRAHAS  G++ LLPS+ GR M+ EL+ L+    +  + 
Sbjct: 63  EFSRTLADLGDIFVNDAFSVSHRAHASTEGVARLLPSFAGRGMEAELTALDRALGKPMRS 122

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           + A+VGG+KVSTKIT+L NLV +VD+L+IGGGMAN+FL A+G+ VGRSLC+ DF + V +
Sbjct: 123 VGAVVGGAKVSTKITVLENLVTRVDELIIGGGMANTFLYAKGINVGRSLCEPDFKETVER 182

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           I   A    C I++PRDVV+A+E     P +VV   +VP DS+ILDVG ++V  I +   
Sbjct: 183 ILQRAADHHCNIVLPRDVVIAKEFAPNAPHEVVDVHAVPADSMILDVGPESVADIMEQFG 242

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             +T++WNGP+G FE EPF R T  +A   A+LTK  +++++AGGGDT+ AL+ AGI ++
Sbjct: 243 DLKTLLWNGPVGAFETEPFGRGTFALARCAARLTKAGKLVTVAGGGDTVAALSAAGIQDD 302

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
           F+YVSTAGGAFLEWLEG+ LPG+  L
Sbjct: 303 FSYVSTAGGAFLEWLEGRGLPGVDVL 328


>gi|307266212|ref|ZP_07547754.1| Phosphoglycerate kinase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918742|gb|EFN48974.1| Phosphoglycerate kinase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 393

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 169/394 (42%), Positives = 254/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+   AKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINHNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K ++   D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKVNPEYSLKPVAKRLSELLGKQVIMAEDVIGDDAKAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDTQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPQDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T      +AK   E +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGT----EAIAKALSECKGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ T++ST GGA LE+LEGK LPGI  L+
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLN 391


>gi|258517030|ref|YP_003193252.1| Phosphoglycerate kinase [Desulfotomaculum acetoxidans DSM 771]
 gi|257780735|gb|ACV64629.1| Phosphoglycerate kinase [Desulfotomaculum acetoxidans DSM 771]
          Length = 394

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 169/387 (43%), Positives = 250/387 (64%), Gaps = 5/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+RG R  +RVD+NVP  +  +V D TRI   +PTI  L E+KAKV++ SHLGRP+ K  
Sbjct: 10  DVRGKRVFVRVDFNVPLDEKHEVTDDTRIRAALPTIRYLTEQKAKVILASHLGRPKGKVA 69

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           ++  L  VV   E +L K ++  +DCIG  +  +I+ + EG I+L EN+RFY  EE++DP
Sbjct: 70  EEFRLDPVVRHLEELLGKKVIKTDDCIGEEVKAAISEMQEGDILLLENLRFYPGEEKDDP 129

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
            F R L+   D Y+NDAF  +HRAHAS  G++ LLP+  G  +QKE+ ML S  +  ++P
Sbjct: 130 VFARELAALADVYVNDAFGTAHRAHASTHGIARLLPAVAGFLLQKEIKMLGSAINNPQRP 189

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
             AI+GG+KVS KI ++ NL+ KVD L++GGGMAN+F+ AQG  VG+SL + D  +   +
Sbjct: 190 FTAILGGAKVSDKIGIIKNLLGKVDNLLLGGGMANTFIKAQGYDVGKSLLESDKVELAGE 249

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  EA+      ++P DVVVA  +     TQVV    +P D++ LD+G ++++   ++I 
Sbjct: 250 LINEARVKGINFLLPVDVVVAPMLSPDAMTQVVEISHIPGDNMALDIGPESIKKYSEIIK 309

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
            ++TV+WNGP+GVFE+  F   T ++   +A    +   ++I GGGD   A+   G+S++
Sbjct: 310 SSKTVIWNGPMGVFEMNAFANGTNDLVRVLA----DSGAVTIVGGGDLDAAVEKTGLSDK 365

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVALS 397
            T+VST GGA LE+LEGK+LPGI  L 
Sbjct: 366 ITHVSTGGGASLEFLEGKELPGIAVLQ 392


>gi|73666661|ref|YP_302677.1| phosphoglycerate kinase [Ehrlichia canis str. Jake]
 gi|72393802|gb|AAZ68079.1| phosphoglycerate kinase [Ehrlichia canis str. Jake]
          Length = 394

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 175/386 (45%), Positives = 247/386 (63%), Gaps = 8/386 (2%)

Query: 6   TMNDLRDIRGLRC-----LLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           T  +++ I+   C     LLR D NVP  +G V D TRI R+  TI  L+   AK+VI S
Sbjct: 8   TFCNMKKIQDFSCSGKTVLLRADLNVPMDNGVVLDDTRIVRLTTTIKYLLSNDAKIVIMS 67

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+S  DK+ SL  ++     I   N++F++  IG  + Q+I S S G I+L EN+R
Sbjct: 68  HYGRPKS-YDKEFSLKFLIEYLNKIFTTNVIFIDGVIGDYVEQTIQSASLGSILLLENLR 126

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY+EEE ND  F + L+   D Y+NDAFS  HR HASI  ++ L+PS+IG   Q+E+  L
Sbjct: 127 FYAEEETNDLAFAKQLALLADIYVNDAFSCLHRKHASIDAITRLIPSFIGFNFQEEMKYL 186

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S S+KP+  IVGGSK+STKI +L NL KKVD L++GG +AN+FL++QG+ +GRSL 
Sbjct: 187 NCVVSNSEKPVAVIVGGSKISTKIHMLKNLTKKVDFLIVGGAIANNFLLSQGLKIGRSLY 246

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +    D V +I   AKR  C+IIVP D VVA+    G  + +    ++  D +ILD+G +
Sbjct: 247 EELEKDLVKEIMDLAKRHECKIIVPVDYVVAKNSIYG-KSSIKDNDTIESDDVILDIGPQ 305

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+  +   + + RT++WNGP G+FE E F + T  VA+ +AKLTK  ++ SI GGGD+I 
Sbjct: 306 TINIVTATVNKCRTILWNGPCGMFEKEQFSKGTFSVANLLAKLTKAGKLKSIVGGGDSIC 365

Query: 361 ALAHAGISN-EFTYVSTAGGAFLEWL 385
           A+  +G+SN +FTY+ST GGA L +L
Sbjct: 366 AIKLSGLSNDDFTYISTGGGALLHFL 391


>gi|147679057|ref|YP_001213272.1| 3-phosphoglycerate kinase [Pelotomaculum thermopropionicum SI]
 gi|189036824|sp|A5CYN8|PGK_PELTS RecName: Full=Phosphoglycerate kinase
 gi|146275154|dbj|BAF60903.1| 3-phosphoglycerate kinase [Pelotomaculum thermopropionicum SI]
          Length = 393

 Score =  333 bits (853), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 253/392 (64%), Gaps = 5/392 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R LLRVD+NVP  +G+VAD  +I+  VPTI  L+ +KA+V++ SHLGR
Sbjct: 4   KTVRDI-DVKGKRVLLRVDFNVPMENGRVADDVKIKEAVPTINYLIGQKARVILVSHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ + D+   +  V      +L K ++   DC+G     ++A + +G ++L ENVRF+ E
Sbjct: 63  PKGRVDERYKMDPVARRLSELLGKTVVKAGDCVGEAARSAVAQMQDGDVVLLENVRFHPE 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND  F R L+   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    
Sbjct: 123 EEKNDEKFARQLAELADVFVNDAFGTAHRAHASTEGVAGFLPAVAGLLMEKELEILGRLL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +  ++P  A+VGGSKVS K+ ++ NL+ KVD ++IGGGMAN+FL AQG  VG+SL + D 
Sbjct: 183 TSPERPFAAVVGGSKVSDKLGVIFNLLTKVDTVIIGGGMANTFLKAQGYSVGKSLLEADK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   ++  EA+    ++++P DVVVA     G   + V    +P + + LD+G +++  
Sbjct: 243 IDLARKLIAEARSREVKLLLPVDVVVAPGPAPGQEQRTVPVDQIPAEWMALDIGPESIRL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
             + +  ARTV+WNGP+GVFE++PF R T  +A  +A+L      +++ GGGDT  A   
Sbjct: 303 FTEALRAARTVVWNGPMGVFEMDPFARGTEAIARTLAELNA----VTVIGGGDTAAAAKK 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++ + T++ST GGA LE+LEGK LPG+ AL
Sbjct: 359 AGVAGKMTHISTGGGASLEFLEGKQLPGVRAL 390


>gi|27446627|gb|AAK40345.1| phosphoglycerate kinase [Chondrus crispus]
          Length = 456

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 175/396 (44%), Positives = 254/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   DI G R L+R D NVP +DGK + D TRI   VPTI  L+E  AKV++ SH
Sbjct: 60  KSIKDLSPADIAGKRVLVRCDLNVP-LDGKTITDDTRIRASVPTIKFLMEAGAKVLLSSH 118

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+   +   SL  V +    +L K++    DCIG  +++ ++ ++ G + L ENVRF
Sbjct: 119 LGRPKDGPEDKFSLSPVAARLTQLLGKDVTMAPDCIGDGVTKIVSGMANGDVTLLENVRF 178

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSML 180
           Y EE +NDPDF + L+ N DF++NDAF  +HRAH S  G++ HL PS  G  ++KEL+ L
Sbjct: 179 YKEETKNDPDFAKKLAANADFFVNDAFGTAHRAHGSTAGVTAHLKPSVAGLLLEKELAYL 238

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S+  +P  AIVGGSKVS+KI ++ +L++KVDKL+IGGGM  +FL A+G+ VG SL 
Sbjct: 239 AGTVSDPARPFAAIVGGSKVSSKIGVIDSLLQKVDKLIIGGGMVFTFLKAKGLNVGSSLV 298

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++   A+     II+P DVV+A +      TQV S  S+P   + LD G  
Sbjct: 299 EDDKLELARELVKTAEAKGVSIILPTDVVLADKFAADANTQVTSVDSIPDGWMGLDQGED 358

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + + I+  + + +TV+WNGP+GVFE+E F + T  +A  +A LT E   I+I GGGD++ 
Sbjct: 359 STKLIQNELKECKTVIWNGPMGVFEMEKFAKGTFAIADTLADLT-ESGCITIIGGGDSVA 417

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 418 AVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 453


>gi|323704684|ref|ZP_08116262.1| Phosphoglycerate kinase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536146|gb|EGB25919.1| Phosphoglycerate kinase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 393

 Score =  332 bits (850), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 256/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D++G R L+RVD+NVP    K + D TRI+  +PTI  L++  AKV++ SHLG
Sbjct: 3   KTVRDI-DVKGKRVLVRVDFNVPMDSEKNITDDTRIKAALPTIQYLLDNNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + S+  V      +L K ++  +D IG        +L +G ++L ENVRF++
Sbjct: 62  RPKGKFNMEYSMKPVAKRLSELLGKQVIVADDVIGEDAKAKANALKDGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDPDF + L+   D ++NDAF  +HRAHAS TG++  LP+  G  ++KEL+ +   
Sbjct: 122 EEEKNDPDFSKELASLADVFVNDAFGTAHRAHASTTGVASYLPAVSGFLIEKELNFMGGA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPERPFVAILGGAKVSDKIGVITNLLDKVDSLLIGGGMAYTFIKAEGHEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  +AK+   ++++P D VV+ E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KLELAKDLIEKAKQKGVKLLLPVDTVVSAELKSGVPYEVVDIDKMPNDKIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A+TV+WNGP+GVFEI  F + T      +AK   E    +I GGGD+  A+ 
Sbjct: 302 EFSKVIKGAKTVVWNGPMGVFEIREFAKGT----EAIAKAMSECSGTTIIGGGDSAAAVE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ +++ST GGA LE+LEGK LPGI AL+
Sbjct: 358 QLGYADKVSHISTGGGASLEFLEGKVLPGIAALN 391


>gi|220932418|ref|YP_002509326.1| Phosphoglycerate kinase [Halothermothrix orenii H 168]
 gi|219993728|gb|ACL70331.1| Phosphoglycerate kinase [Halothermothrix orenii H 168]
          Length = 394

 Score =  332 bits (850), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 170/394 (43%), Positives = 253/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D +G R L+RVD+NVP  DGK+ D TRIE  +PTI  LV++ AKV++ SHLGR
Sbjct: 3   KTLKDV-DFKGKRTLVRVDFNVPLEDGKITDDTRIEAALPTIKYLVDEGAKVILMSHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K      L  V      +L K +  V+DCIG    ++++ +  G ++L EN RF++ 
Sbjct: 62  PKGKVVDSLRLDPVAQRLAELLGKEVTKVDDCIGDEPKEAVSEMENGDVLLLENTRFHAG 121

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E++NDPDF R L+   + ++NDAF  +HRAHAS  G++  LPS  G  +Q+EL+ L    
Sbjct: 122 EKKNDPDFARQLAELAEVFVNDAFGAAHRAHASTVGVTEHLPSVAGFLLQRELNALGEAM 181

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
                P VAI+GG+KVS KI ++ NL+ KVD L++GGG+AN+FL+A+G  VG SL + D 
Sbjct: 182 ENPGHPFVAILGGAKVSDKIGVIKNLLDKVDYLLVGGGIANTFLLAKGYEVGDSLVEEDK 241

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF-KTVE 303
            +   ++  EA+    ++++P DVV+A E K     +VVSA S+P    ILD G  KT+E
Sbjct: 242 VELAKELLKEAEEKGVDLVLPEDVVIAEEFKEDANHKVVSADSIPEGWQILDSGGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
               +IA+A TV+WNGP+GVFE++ F + T  +A  +A+ +  R +I   GGGD+  A+ 
Sbjct: 302 KYSDIIAKAETVIWNGPIGVFEMDTFAKGTNALAEAMAR-SSARTVI---GGGDSAAAVK 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG+ ++ +++ST GGA L + EGK LPG+ AL 
Sbjct: 358 KAGLEDKMSHISTGGGASLMFFEGKPLPGVEALD 391


>gi|298571337|gb|ADI87680.1| phosphoglycerate kinase [uncultured Nitrospirae bacterium MY2-3C]
          Length = 397

 Score =  332 bits (850), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 162/388 (41%), Positives = 248/388 (63%), Gaps = 6/388 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G R  +RVD+NVPF +   + D  R+   +PTI   +EK AKV++ SHLGRP+ K +
Sbjct: 12  DLKGKRTFIRVDFNVPFDEANNITDDNRVRAALPTINMAIEKGAKVILASHLGRPKGKPN 71

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              +L  V    E +L+K + F  DCIG  + + +A + +G ++L ENVRF++EEE+NDP
Sbjct: 72  PKYTLQPVAKCLEGLLNKKVAFAPDCIGPEVEKMVADMKDGDVLLLENVRFHAEEEKNDP 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSMLESCFSESKK 189
           +F + L++  D Y+NDAF  +HR HA+  G++  +  S  G  M+KEL+ L        K
Sbjct: 132 EFSKSLAKLADVYVNDAFGTAHRGHATTEGMTKFVSTSAAGLLMEKELNYLLVSVESPVK 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P VAIVGG+KVS KI +L +L  KVDK+++GGGMAN+F  A G  +G SLC+ D  D   
Sbjct: 192 PFVAIVGGAKVSGKIGVLDHLATKVDKVIVGGGMANTFFKAMGYEIGDSLCEDDMLDVAK 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  + K    + ++P D ++A + + G PTQV  A  VP    ILD+G ++ +     +
Sbjct: 252 KVMAKMKELNVKFLLPVDCLIAEKAEQGAPTQVAPASKVPAGWRILDIGPESAKLFADAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           + A+TV+WNGP+G+FEI+ F + T ++AH VA      +  +I GGGD++ A+  AG+++
Sbjct: 312 SDAKTVVWNGPMGLFEIDTFAKGTFDLAHAVA----NTQATTIIGGGDSVLAVKRAGVTD 367

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 368 KVSFISTGGGASLELLEGKVLPGVAALT 395


>gi|224534935|ref|ZP_03675504.1| phosphoglycerate kinase [Borrelia spielmanii A14S]
 gi|224513875|gb|EEF84200.1| phosphoglycerate kinase [Borrelia spielmanii A14S]
          Length = 393

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 253/393 (64%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L ++ AKVV+ SHLG
Sbjct: 3   IKTLKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLRKRGAKVVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L +++  ++DCIGS +  S   + +G I+L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANRLSELLDQDVKMLSDCIGSEIVNSTLQMKDGDIVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS +GD +++DAF  +HRAHAS  G+S  LPS+ G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSESGDVFVSDAFGAAHRAHASTVGVSEYLPSFGGFLMEKEDKFLGGV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPEKPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGHSIGKSLLEME 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + + ++P + I +DVG  T++
Sbjct: 243 YIDTASSFLRKAKELGVKVILPLDHIVADDFNKNSTPEYIDSFNIPENKIGMDVGVNTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++V+  A+T++WNGPLGVFE   F + T +VA  VA  +     +++ GGGD++ A+ 
Sbjct: 303 EIEEVVKTAKTIIWNGPLGVFEFNSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|302338946|ref|YP_003804152.1| phosphoglycerate kinase [Spirochaeta smaragdinae DSM 11293]
 gi|301636131|gb|ADK81558.1| Phosphoglycerate kinase [Spirochaeta smaragdinae DSM 11293]
          Length = 395

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 169/396 (42%), Positives = 248/396 (62%), Gaps = 6/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKK-AKVVIFSHL 62
           +RT+ DL D+RG R L+RVD+NVP  +G + D TRI+  +PT+  ++E++ + +VI SHL
Sbjct: 3   IRTVKDL-DLRGKRVLIRVDFNVPLKEGVITDDTRIKAALPTLKYILEQEGSSLVIMSHL 61

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + SL  V      +L + +    DCIG  ++   ASL  G I+L ENVR+Y
Sbjct: 62  GRPKGEKKPEFSLAPVAKRLSELLGRPVEMAADCIGDAVTSRAASLKAGEILLLENVRYY 121

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           + E +NDPDF + L+  GD Y+NDAF  +HRAHAS  G++  LPS  G  ++KE++  E 
Sbjct: 122 AGETKNDPDFAKKLASLGDVYVNDAFGTAHRAHASTEGVTKFLPSAAGFLIEKEVAFFEP 181

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                + P VAI+GG+KVSTKI +L NL+ K D LVIGGGM  +FL A G  +G+SL + 
Sbjct: 182 LLKNPEHPFVAIIGGAKVSTKIGVLENLIDKCDTLVIGGGMCYTFLKATGKSIGKSLFEE 241

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +F      +  +A++   ++I+P D V A+          V   ++P D I +D+G +T+
Sbjct: 242 EFLKTATDLLKKAEQKGTKVILPLDHVCAKAFSEKETPIAVDGANIPEDLIGMDIGVQTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             IK  +A AR+++WNGP+GVFE E + + TVEVA  VA      +  ++ GGGD++ A+
Sbjct: 302 AEIKNALAGARSIVWNGPMGVFEFEAYAKGTVEVAEMVASC----KGTTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
              G ++   +VST GGA LE+LEGK LPGI AL G
Sbjct: 358 NKFGFADRIDHVSTGGGASLEFLEGKVLPGIAALEG 393


>gi|111114877|ref|YP_709495.1| phosphoglycerate kinase [Borrelia afzelii PKo]
 gi|122956431|sp|Q0SPA9|PGK_BORAP RecName: Full=Phosphoglycerate kinase
 gi|110890151|gb|ABH01319.1| phosphoglycerate kinase [Borrelia afzelii PKo]
          Length = 393

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 253/393 (64%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFNSFAGKRVLVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L++++   +DCIGS +  +   + +G ++L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANRLSGLLNQDVKMFSDCIGSEIVNNTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD +++DAF  +HRAHAS  G+S  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVSDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLGEV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPEKPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLYSKGYSIGKSLLESE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + + ++P + I +D+G  T++
Sbjct: 243 YIDTASSFLRKAKELGVKVILPLDHIVADDFNKNSTPEYIDSLNIPENKIGMDIGVNTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+ 
Sbjct: 303 EIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|216263892|ref|ZP_03435886.1| phosphoglycerate kinase [Borrelia afzelii ACA-1]
 gi|215979936|gb|EEC20758.1| phosphoglycerate kinase [Borrelia afzelii ACA-1]
          Length = 393

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 253/393 (64%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFNSFAGKRVLVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L++++   +DCIGS +  +   + +G ++L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANRLSELLNQDVKMFSDCIGSEIVNNTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD +++DAF  +HRAHAS  G+S  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVSDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLGEV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               +KP V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPEKPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLYSKGYSIGKSLLESE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + + ++P + I +D+G  T++
Sbjct: 243 YIDTASSFLRKAKELGVKVILPLDHIVADDFNKNSTPEYIDSLNIPENKIGMDIGVNTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+ 
Sbjct: 303 EIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|226509797|ref|NP_001142404.1| hypothetical protein LOC100274579 [Zea mays]
 gi|194707626|gb|ACF87897.1| unknown [Zea mays]
 gi|194708658|gb|ACF88413.1| unknown [Zea mays]
 gi|195632546|gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
          Length = 402

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 171/400 (42%), Positives = 253/400 (63%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D++G +  +R D NVP  D  K+ D TRI   VPTI  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   ++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKGVTPK-YSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++ +L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P D+VVA +      +++V A ++P D + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAESKIVPATAIPDDWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG    +   + +   +TV+WNGP+GVFE + F   T  +A  +A+LT  + + +I GGG
Sbjct: 300 VGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAIAKKLAELTTTKGVTTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|226314823|ref|YP_002774719.1| phosphoglycerate kinase [Brevibacillus brevis NBRC 100599]
 gi|254782191|sp|C0Z6L6|PGK_BREBN RecName: Full=Phosphoglycerate kinase
 gi|226097773|dbj|BAH46215.1| phosphoglycerate kinase [Brevibacillus brevis NBRC 100599]
          Length = 394

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 162/390 (41%), Positives = 245/390 (62%), Gaps = 6/390 (1%)

Query: 10  LRDIR--GLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQS 67
           +RD+   G R   RVD+NVP  DG + D TRI   VPTI  ++E  AKV++ SH GRP+ 
Sbjct: 6   IRDVELAGKRVFCRVDFNVPMQDGVITDDTRIRAAVPTIRFMMEAGAKVILASHFGRPKG 65

Query: 68  KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
           +  ++  L  V +   S+L K++  + DC G+ +  ++  +  G +IL ENVRF++ EE+
Sbjct: 66  QVVEEMRLTPVAAHLSSLLGKDVRKLEDCQGADVEAAVERMESGDVILLENVRFHAGEEK 125

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSES 187
           NDP+  +  +   D ++NDAF  +HRAHAS  G++  +P+  G  M+KE+  +    S  
Sbjct: 126 NDPELAKSFAALADLFVNDAFGTAHRAHASTAGIAEYIPAVAGLLMEKEIRFMGGALSNP 185

Query: 188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDN 247
           ++P  AIVGG+KV  KI ++ NL+ KVD L+IGGGMAN+FL AQG G+G SLC+ D  D 
Sbjct: 186 ERPFTAIVGGAKVKDKIAVIENLLTKVDHLIIGGGMANTFLKAQGYGIGASLCEDDKLDL 245

Query: 248 VHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQ 307
              +  +AK    ++++P DVVVA         QVV+  ++P   + LD+G KTVE    
Sbjct: 246 ARTLMEQAKERGVQLLMPVDVVVADRFAADAEKQVVAIDAIPEGWMALDIGPKTVEQYHS 305

Query: 308 VIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGI 367
           VI  ++TV+WNGP+GVFE++ F   T+ VA  +A  +      +I GGGD++ A+  AG+
Sbjct: 306 VIVDSKTVVWNGPMGVFEMDAFAGGTIGVAKAMAACSG----TTIIGGGDSVAAVEKAGV 361

Query: 368 SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + + T++ST GGA LE++EGK+LPG+  L+
Sbjct: 362 AEQMTHISTGGGASLEFMEGKELPGVAVLA 391


>gi|285808460|gb|ADC35985.1| phosphoglycerate kinase [uncultured bacterium 148]
          Length = 406

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 161/385 (41%), Positives = 242/385 (62%), Gaps = 1/385 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  +RVD+NVP  DGKV D +RI   +PTI  L+++ A+VV+ SHLGRP  K   
Sbjct: 11  DVAGKRVFVRVDFNVPLADGKVTDDSRIRAAIPTINALLQQGARVVLASHLGRPDGKVSD 70

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V      ++ +N+    D +G     ++  L  G +IL EN+RF+ EEE+NDP+
Sbjct: 71  SLRLRPVGLRLTELMRRNVPVTGDALGLGTEDAVKRLRAGEVILLENLRFHVEEEQNDPE 130

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F   L+   D Y+NDAF  +HRAHAS  G++ LLP+Y G  M++EL  L        +P 
Sbjct: 131 FAAKLAAYADVYVNDAFGTAHRAHASTVGIAKLLPAYAGLLMERELEALSGLLESPARPF 190

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KVS KI ++ +L+ KVD LV+GGGMAN+FL+AQG  +G+SL + D  +   +I
Sbjct: 191 AAILGGAKVSDKIKVIDHLLTKVDILVLGGGMANTFLLAQGKAIGKSLAEPDRVEEARRI 250

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              A+++  ++++P DV+VA+E+  G   + + A+ +P    I+D+G  + E I  ++A 
Sbjct: 251 LTNAEKNGVQVVLPVDVIVAKEVTRGTEYKTLPAEKIPASWHIVDLGKVSQEQILDILAG 310

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A+TV WNGPLGVFEI  F   T  VA  +A   +    + I GGGD++ A+   G++++ 
Sbjct: 311 AKTVFWNGPLGVFEIPSFAHGTNAVARMLADAAEHGATVVI-GGGDSVAAITQQGLADKM 369

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T++ST GGA LE+LEG++LPG+  L
Sbjct: 370 THISTGGGASLEFLEGRELPGVTVL 394


>gi|219685334|ref|ZP_03540153.1| phosphoglycerate kinase [Borrelia garinii Far04]
 gi|219673107|gb|EED30127.1| phosphoglycerate kinase [Borrelia garinii Far04]
          Length = 393

 Score =  330 bits (845), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 252/393 (64%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L EK A++V+ SHLG
Sbjct: 3   IKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L +++  ++DCIGS +  +   + +G ++L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGSEIVNNTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLGEV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGYSIGKSLLESE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + +  +P + I +DVG  T++
Sbjct: 243 YIDVASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEYIDSFDIPENKIGMDVGGNTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++VI  A+T++WNGPLGVFE + F + T +VA  VA  +     ++I GGGD++ A+ 
Sbjct: 303 EIEKVIKTAKTIIWNGPLGVFEFDSFAKGTAKVAEMVASCSG----LTIVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|219684893|ref|ZP_03539835.1| phosphoglycerate kinase [Borrelia garinii PBr]
 gi|219671838|gb|EED28893.1| phosphoglycerate kinase [Borrelia garinii PBr]
          Length = 393

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 251/393 (63%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L EK A++V+ SHLG
Sbjct: 3   IKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L +++  ++DCIGS +  +   + +G ++L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGSEIVNNTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLGEV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGYSIGKSLLESE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + +  +P + I +DVG  T++
Sbjct: 243 YIDVASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEYIDSFDIPENKIGMDVGGNTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++VI  A+T++WNGPLGVFE + F + T  VA  VA  +     ++I GGGD++ A+ 
Sbjct: 303 EIEKVIKTAKTIIWNGPLGVFEFDSFSKGTAMVAEMVASCSG----LTIVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|312143198|ref|YP_003994644.1| Phosphoglycerate kinase [Halanaerobium sp. 'sapolanicus']
 gi|311903849|gb|ADQ14290.1| Phosphoglycerate kinase [Halanaerobium sp. 'sapolanicus']
          Length = 398

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 251/394 (63%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D +G + L+RVD+NVP  +G+V D TRI+  +PTI  L+ ++AKV++ SHLGR
Sbjct: 7   KTLKDM-DFKGKKVLVRVDFNVPLKEGEVTDSTRIKAALPTIEYLIREEAKVLLISHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  + ++D  +  V     + L+K +   +DCIG  + ++  +L  G ++L EN RFY  
Sbjct: 66  PGGEVNEDLRMDAVAKELANQLNKEVKKADDCIGKEVKKAANNLENGEVLLLENSRFYPG 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E+ NDP+F + L+   D Y+NDAF  +HRAHA+  G++  LPS  G  MQKEL+ L    
Sbjct: 126 EKANDPEFSKKLASLADLYVNDAFGAAHRAHATTVGVTEYLPSAAGFLMQKELNALGEVM 185

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +  + P VAI+GG+KVS KI ++ NL+ KVD L++ GG+AN+FL+A+G  VG SL + D 
Sbjct: 186 AAPESPFVAIMGGAKVSDKIDVIKNLINKVDILIVAGGIANTFLLAKGYEVGDSLVEADK 245

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF-KTVE 303
            D   ++  EA+     I++P DVV+A E      TQVV    +P    +LD G  +++E
Sbjct: 246 VDLARELMAEAEEKGVNIVLPIDVVIADEFSNDAETQVVKVDQIPAGWQVLDCGGPESLE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
             K++I  A+TV+WNGPLGVFE+E F   TVE    +AK   +    S+ GGGD+  A+ 
Sbjct: 306 QYKEIIKNAKTVIWNGPLGVFEMEKFAHGTVE----LAKALGQSDAHSVIGGGDSAAAIN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG++++  ++ST GGA L + EGK+LPG+VAL 
Sbjct: 362 LAGVADQMDHISTGGGASLMFFEGKELPGVVALD 395


>gi|304317441|ref|YP_003852586.1| phosphoglycerate kinase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778943|gb|ADL69502.1| Phosphoglycerate kinase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 393

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 253/394 (64%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G + L+RVD+NVP    K + D TRI+  +PTI  L++  AKV++ SHLG
Sbjct: 3   KTVRDV-DVSGKKVLVRVDFNVPMDSEKNITDDTRIKAALPTIKYLIDNNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + S+  V      +L+K ++  +D IG        SL +G ++L ENVRF++
Sbjct: 62  RPKGKFNPEYSMKPVAKRLSELLNKPVIMADDVIGEDAKSKANSLKDGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + L+   D Y+NDAF  +HRAHAS TG++  LP+  G  ++KEL+ +   
Sbjct: 122 EEEKNDTNFSKELASLADIYVNDAFGTAHRAHASTTGVASYLPAVSGFLIEKELNFMGGA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLDKVDSLLIGGGMAYTFIKAEGHEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  +A++   ++++P D VV  E+K G+P +VV    +P D I +D+G KTVE
Sbjct: 242 KLELAKDLIEKARQKGVKLLLPVDTVVCEELKPGVPYEVVDIDKMPQDKIGVDIGPKTVE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
               VI  A+TV+WNGP+GVFEI+ F + T      +AK   E    +I GGGD+  A+ 
Sbjct: 302 AFSNVIKDAKTVVWNGPMGVFEIKEFAKGT----EAIAKAMSECSGTTIIGGGDSAAAVE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +++ +++ST GGA LE+LEGK LPGI AL+
Sbjct: 358 QLGYADKVSHISTGGGASLEFLEGKVLPGIAALN 391


>gi|323701578|ref|ZP_08113250.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
 gi|323533351|gb|EGB23218.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
          Length = 393

 Score =  328 bits (842), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 164/394 (41%), Positives = 255/394 (64%), Gaps = 7/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKV-ADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +++ D+ +++G R  +RVD+NVP +DG+V  D TRI + +PTI  L+E+ A+V++ SHLG
Sbjct: 4   KSVKDI-EVKGKRVFVRVDFNVP-LDGEVITDDTRIRKALPTIQYLMEQGARVILASHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +  +   L  V      +L K ++ VND +G  + Q+IA++  G ++L ENVRF++
Sbjct: 62  RPKGEVVEKYRLTPVARRLSELLGKEVIKVNDSVGEEVKQAIAAMQNGDVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EE +ND  + R L+   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL+ML   
Sbjct: 122 EETKNDEKYARQLAELADVFVNDAFGAAHRAHASTAGIAKYLPAVAGFLMEKELTMLGQA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG   G+SL + D
Sbjct: 182 VTTPRRPFVAIIGGAKVSDKIGVIENLLSKVDTLIIGGGMANTFLRAQGYQTGKSLVEPD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   ++   A     E+++P DVVVAR  +     +VV+   +P D ++LD+G  T  
Sbjct: 242 KVDLARELIERAATRQVELLLPTDVVVARAFEPTAENRVVTVTKIPEDWMVLDIGPATAA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + + +A TV+WNGP+GVFE++ F + T      VAK   +   I+I GGGD++ A+ 
Sbjct: 302 KYAEAVQKAATVVWNGPMGVFEMDVFAKGT----EAVAKALADSPAITIIGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G++++ +++ST GGA LE+LEGK+LPG+  L 
Sbjct: 358 KIGVADKISHISTGGGASLEFLEGKELPGVAVLQ 391


>gi|51598317|ref|YP_072505.1| phosphoglycerate kinase [Borrelia garinii PBi]
 gi|81691595|sp|Q662V8|PGK_BORGA RecName: Full=Phosphoglycerate kinase
 gi|51572888|gb|AAU06913.1| phosphoglycerate kinase [Borrelia garinii PBi]
          Length = 393

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 250/393 (63%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L EK A++V+ SHLG
Sbjct: 3   IKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L +++  ++DCIG  +  +   + +G ++L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGREIVNNTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLGEV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGYSIGKSLLESE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + +  +P + I +DVG KT++
Sbjct: 243 YIDIASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEYIDSFDIPENKIGMDVGGKTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++VI  A+T++WNGPLGVFE + F + T  VA  VA        ++I GGGD++ A+ 
Sbjct: 303 EIEKVIKTAKTIIWNGPLGVFEFDSFSKGTAMVAEMVASCAG----LTIVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|330814407|ref|YP_004358646.1| phosphoglycerate kinase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487502|gb|AEA81907.1| phosphoglycerate kinase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 396

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 167/396 (42%), Positives = 249/396 (62%), Gaps = 4/396 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M  L+ +   +DI+ L+  LRVD+NVP  +  V+D T+I +V   + +L+ + A V++ S
Sbjct: 1   MQELKLLEKNKDIKNLKVFLRVDFNVPMQNQAVSDSTKITKVKTIVEDLLNRGAVVILCS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRPQ K  +  SL  V S AE I+ + I+FV +   + +SQ I+      + L EN+R
Sbjct: 61  HLGRPQVKGKEGFSLEPVRSEAEKIIGREIVFVAEDFKNIISQKISE--NKNLFLLENIR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+N  D  + L+   D YIN+AFS SHR HASI G++  + SY G  + +EL+ L
Sbjct: 119 FDPNEEKNGHDLSKKLADLCDIYINEAFSCSHRKHASIFGITQFVDSYAGETIHQELTAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            S  ++++KP+  ++GGSK+STKI L+ +L+ K+D ++IGG MAN+F   QG  VG+S  
Sbjct: 179 NSIVTDTQKPVACLIGGSKISTKIDLITSLMPKIDYMIIGGAMANNFFKHQGFQVGKSKI 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +    V  I   A +S C++I+P DVV A+  +     +  +   V  D +ILD+G K
Sbjct: 239 EENIDSIVKNIITTASKSNCKLILPIDVVTAKRFEDQGANK--NLDQVENDEMILDIGTK 296

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+  I  ++ +++TV WNGP G FE + F   T  +++ VA LTK+ +++SIAGGGDT  
Sbjct: 297 TIASISNILQESKTVFWNGPFGFFEKDSFANGTKAISNTVADLTKQGKLVSIAGGGDTFA 356

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  +   NEFTY+STAGGAFLEWLEGK LPG+  L
Sbjct: 357 AIKKSKRENEFTYISTAGGAFLEWLEGKVLPGLKVL 392


>gi|325971263|ref|YP_004247454.1| phosphoglycerate kinase [Spirochaeta sp. Buddy]
 gi|324026501|gb|ADY13260.1| Phosphoglycerate kinase [Spirochaeta sp. Buddy]
          Length = 392

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 243/393 (61%), Gaps = 5/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L T+ D  D    + L+RVD+NVP  DG V D TRI+  +PTI  L+E  A VV+ SH G
Sbjct: 3   LNTIRDY-DFSNKKALVRVDFNVPLKDGVVTDDTRIQAALPTISYLLEHGATVVVMSHFG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + S+  +      +L K ++   D IG  ++  +A L +G ++L ENVRFY+
Sbjct: 62  RPKGKKNPEFSMAPIAKRFSELLGKQVILAKDVIGPEVALQVAGLKKGDVLLLENVRFYA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE NDP+F + L+  GD Y+NDAF  +HRAHAS  G++H LPS+ G  ++KE+  +   
Sbjct: 122 EEETNDPEFSKNLASFGDVYVNDAFGTAHRAHASTEGVAHFLPSFAGFLIEKEVKFMAPL 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                KP VAI+GGSKVS+KI++L +LV+  + +VIGGGMA +FL  QG  +G+SL + D
Sbjct: 182 LENPDKPFVAIIGGSKVSSKISVLESLVRTCNTIVIGGGMAYTFLAVQGHSIGKSLVEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +       +AK    ++I+P D +   E K       + +  +P + I +D+G KTV 
Sbjct: 242 YKETAASFLAKAKEKGVQVILPVDHLCGEEFKEDTAVVTIDSADIPQNLIGMDIGPKTVA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I   ++QA++V+WNGP+GVFE   F   T+ VA  +A    +    ++ GGGD++ A+ 
Sbjct: 302 LIVAAVSQAKSVVWNGPMGVFEFNSFANGTLTVAKALA----QSNATTVVGGGDSVAAIN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              ++++ ++VST GGA LE+LEG+ LPGI AL
Sbjct: 358 KFNLADKISHVSTGGGASLEFLEGQVLPGIKAL 390


>gi|312135204|ref|YP_004002542.1| triosephosphate isomerase [Caldicellulosiruptor owensensis OL]
 gi|311775255|gb|ADQ04742.1| triosephosphate isomerase [Caldicellulosiruptor owensensis OL]
          Length = 650

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 162/393 (41%), Positives = 248/393 (63%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI+  +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIKEALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +A + EG ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVAQMKEGDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASVADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI +++NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVIMNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|167629685|ref|YP_001680184.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
 gi|167592425|gb|ABZ84173.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
          Length = 394

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 242/385 (62%), Gaps = 4/385 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+RG R L+R D NVP   G + D TRI   +PT+  L+++ A+V++ SHLGRP+ +   
Sbjct: 10  DVRGKRVLVREDLNVPLKKGVITDDTRIRMTLPTLQYLIDRGARVIVASHLGRPKGQPVD 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V      +L K +  V+D IG  +  ++A++ EG ++L ENVRFY EEE+ND  
Sbjct: 70  EFRLTPVAKRLAELLGKPVAKVDDVIGPEVQAAVAAMQEGDVLLLENVRFYKEEEKNDKA 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           + + L+   D Y+NDAF  SHRAHAS  G++  LP+  G  M+KELSML    +  ++P 
Sbjct: 130 YAKALADLADIYVNDAFGTSHRAHASTAGVADFLPAVAGFLMEKELSMLGKAVTNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VA++GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL A G   G SL + D  D   ++
Sbjct: 190 VAVIGGAKVSDKIGVIENLLNKVDSLIIGGGMANTFLRALGYETGNSLVETDKVDLAGEL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK     +++P DVVVA+  + G P + V+  ++    + LD+G +T +    V+ +
Sbjct: 250 ILRAKAQKVNLLLPTDVVVAQAFEAGAPQKTVAVNAIEPGWMALDIGPETAKGYADVVKE 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A TV+WNGP+GVFEI+ F + T  VA  +A    E R I++ GGGD++ A+   G++   
Sbjct: 310 AATVLWNGPMGVFEIDDFAKGTEAVARAMA----ECRGITVIGGGDSVAAVNKVGVAERM 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           +++ST GGA LE+LEGK LPG+  L
Sbjct: 366 SHISTGGGASLEFLEGKTLPGVAVL 390


>gi|307151342|ref|YP_003886726.1| phosphoglycerate kinase [Cyanothece sp. PCC 7822]
 gi|306981570|gb|ADN13451.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7822]
          Length = 401

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 250/387 (64%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ SH GRP+ K  
Sbjct: 13  DVAGKRVLVRVDFNVPLDDQGNITDDTRIRAALPTIQDLMGKGAKVILCSHFGRPKGKVV 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L         +L ++++   DC+G  ++Q++ +L +G + L EN+RF++EEE ND 
Sbjct: 73  ESMRLTPTAKRLSELLGQDVVMCGDCVGDAVTQALNTLKDGQVALLENLRFHAEEEDNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL+ L++     ++
Sbjct: 133 EFSKQLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKELNYLQAAIENPQR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  D   
Sbjct: 193 PLAAIIGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKARGLSVGKSLVEEDKLDLAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK    ++++P DVVVA   K     Q VS +++P   + LD+G  +++  +  +
Sbjct: 253 SLEAKAKEKGVQLLLPTDVVVADAFKADANAQTVSIENIPDGWMGLDIGPDSIKVFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  ++V+WNGP+GVFE + F + T  +AH +A LT  + + +I GGGD++ A+   G++ 
Sbjct: 313 ADCKSVIWNGPMGVFEFDQFAKGTEAIAHTLADLTG-KGVTTIIGGGDSVAAVEKVGVAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|115444481|ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 gi|49388607|dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica
           Group]
 gi|113535551|dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gi|119395228|gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gi|218190147|gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gi|222622261|gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
          Length = 402

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 172/400 (43%), Positives = 250/400 (62%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D+RG +  +R D NVP  D  K+ D TRI   VPT+  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  +++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKGVTPK-YSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P DVVVA +      ++ V+A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +    T++WNGP+GVFE E F   T  +A  +A LT  +   +I GGG
Sbjct: 300 VGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|58616750|ref|YP_195949.1| phosphoglycerate kinase [Ehrlichia ruminantium str. Gardel]
 gi|58416362|emb|CAI27475.1| Phosphoglycerate kinase [Ehrlichia ruminantium str. Gardel]
          Length = 395

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 246/384 (64%), Gaps = 6/384 (1%)

Query: 6   TMNDLRDI--RGLRCLLRVDWNVPFIDGKVA-DVTRIERVVPTILELVEKKAKVVIFSHL 62
            M  ++D   RG   LLRVD NVP  D KV  D TRI R+  T+  L+   AK+V+ SH 
Sbjct: 11  NMKKIQDFSCRGKTILLRVDLNVPVDDNKVVLDDTRIVRLTTTVKYLLSNNAKIVMISHY 70

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+S  D++ SL  +V     I   N+LFV+  IGS + Q++ S+  G ++L EN+RFY
Sbjct: 71  GRPKS-YDREFSLKFLVEYLNKIFATNVLFVDGVIGSYVEQAVQSVPLGSVLLLENLRFY 129

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EEE+ND +F + L+   D Y+NDAFS  HR HASI  ++ LLPS+IG   Q+EL  L  
Sbjct: 130 VEEEKNDLNFAKQLALLADVYVNDAFSCMHRKHASIDAVARLLPSFIGFNFQEELKYLSY 189

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S S KP+  IVGG+K+STKI +L NL +KV+ L++GG +AN+FL++QG+ +G SLC++
Sbjct: 190 VVSSSDKPVGVIVGGAKISTKIHMLRNLTQKVNFLILGGAIANNFLLSQGLKIGNSLCEK 249

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              D    +   AK+  CEIIVP D +V +++ +     V + Q +  D IILD+G  T+
Sbjct: 250 LDEDPFVDVINFAKKYGCEIIVPEDYLVTKDLVSN-EAVVKNNQELAPDDIILDIGPHTI 308

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             I  +I + RTV+WNGP+G+FE EPF   T  +A  +A+ TK  ++ SI GGGD+I A+
Sbjct: 309 NIITSIIGKCRTVLWNGPMGMFEKEPFSHGTFSIARLLAEFTKAGKLKSIVGGGDSICAI 368

Query: 363 AHAG-ISNEFTYVSTAGGAFLEWL 385
             +G +S +FTY+ST GGA L +L
Sbjct: 369 KLSGLLSEDFTYISTGGGALLHFL 392


>gi|268317353|ref|YP_003291072.1| Phosphoglycerate kinase [Rhodothermus marinus DSM 4252]
 gi|262334887|gb|ACY48684.1| Phosphoglycerate kinase [Rhodothermus marinus DSM 4252]
          Length = 402

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 175/405 (43%), Positives = 259/405 (63%), Gaps = 14/405 (3%)

Query: 1   MSRLR--TMNDLRDIRGLRCLLRVDWNVPFIDGK-----VADVTRIERVVPTILELVEKK 53
           MS LR  T++DL D++G R L+RVD+NVP  + +     VAD TRI   +PTI  L++  
Sbjct: 1   MSTLRKLTIDDL-DVKGKRVLVRVDFNVPLKEDEQGNLVVADDTRIREALPTIRALMQAG 59

Query: 54  AKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGI 113
           AKV++ SHLGRP+ + D   SL  V    E +L   + FV++ +G  + Q+I S+ EGG+
Sbjct: 60  AKVILMSHLGRPKGQPDPKYSLAPVARRLEELLGVRVRFVSNIVGEAVRQAINSMPEGGV 119

Query: 114 ILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRA 172
           IL EN RF+  E +NDP+  R L+   D Y+NDAF  +HRAHAS  G++H +  + +G  
Sbjct: 120 ILLENTRFHPGETKNDPELARQLAELADVYVNDAFGSAHRAHASTEGVAHYVKQAAMGYL 179

Query: 173 MQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQG 232
           M++E+  L       + P VAI+GG+KVS KI ++ NL+ +VD+L+IGG M+ +FL A G
Sbjct: 180 MKREVEYLSRLLENPEHPFVAILGGAKVSDKIGVIKNLLPRVDRLLIGGAMSYTFLKALG 239

Query: 233 MGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDS 292
             VG S  + D  +   Q+  EA+    +I++P D VVA E     P QVV    +P   
Sbjct: 240 HNVGASRVEEDRLEEARQLYEEAQ---GKILLPVDHVVAPEFSNEAPAQVVEG-DIPDGL 295

Query: 293 IILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISI 352
           + LD+G KT+E  ++ I QARTV+WNGP+GVFE+  F + T  +A  +A+ T +R  +++
Sbjct: 296 MGLDIGPKTIERYREEILQARTVVWNGPMGVFEMPNFAKGTFAIAEALAEAT-DRGALTV 354

Query: 353 AGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            GGGD++ A+  AG ++  ++VST GGA LE+LEGK+LPG+VAL+
Sbjct: 355 VGGGDSVAAITQAGYADRVSHVSTGGGAMLEFLEGKELPGLVALT 399


>gi|58613477|gb|AAW79325.1| phosphoglycerate kinase [Isochrysis galbana]
          Length = 436

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 252/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D+ G R L+R D NVP +DGK + D TRI   +PTI  L++  AKV++ SH
Sbjct: 40  KSVGDLTKADLEGKRVLVRCDLNVP-LDGKTITDDTRIRASIPTIKYLIDNGAKVLLSSH 98

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+   +   SL  V      +L K +    DCIG  ++  +  ++ G ++L EN RF
Sbjct: 99  LGRPKGGPEDKFSLGPVAPRLSELLGKEVTMAPDCIGDAVADCVTKMANGDVLLLENTRF 158

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+NDP+F   L+ N D ++NDAF  +HRAH S  G++  L PS  G  +QKEL  L
Sbjct: 159 YKEEEKNDPEFAEKLAANADMFVNDAFGTAHRAHGSTEGVTKFLSPSVAGFLLQKELDYL 218

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +   S+ K+P  AIVGGSKVS+KI ++ +L++KVDK+VIGGGM  +FL A+G+  G SL 
Sbjct: 219 DGAVSDPKRPFAAIVGGSKVSSKIGVIESLMEKVDKIVIGGGMVFTFLKARGLETGSSLV 278

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++   AK    + I+P DV+VA +      TQ+VS  ++P   + LD G +
Sbjct: 279 EEDQLELAKKLEVIAKEKGIDFILPTDVIVADKFAADAATQIVSVDAIPEGWMGLDNGPE 338

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + + I+Q +++ +T++WNGP+GVFE E F + T +VA  +A+LT  +   +I GGGD++ 
Sbjct: 339 STKMIQQKLSECKTIIWNGPMGVFEFEAFAKGTFDVADTLAELTG-KGCTTIIGGGDSVA 397

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 398 AVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 433


>gi|114386664|gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
          Length = 402

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/400 (43%), Positives = 250/400 (62%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D+RG +  +R D NVP  D  K+ D TRI   VPT+  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  +++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKGVTPK-YSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P DVVVA +      ++ V+A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESRTVAASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +    T++WNGP+GVFE E F   T  +A  +A LT  +   +I GGG
Sbjct: 300 VGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|325291298|ref|YP_004267479.1| phosphoglycerate kinase [Syntrophobotulus glycolicus DSM 8271]
 gi|324966699|gb|ADY57478.1| phosphoglycerate kinase [Syntrophobotulus glycolicus DSM 8271]
          Length = 394

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 162/390 (41%), Positives = 248/390 (63%), Gaps = 5/390 (1%)

Query: 9   DLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQS 67
           D  D++G R L+RVD+NVP  D GK+ D TRI   +PTI  L EK A+V++ SHLGRP+ 
Sbjct: 7   DQVDVKGKRVLVRVDFNVPLDDSGKITDDTRITAALPTIKYLREKGARVILASHLGRPKG 66

Query: 68  KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
           K +   SL  V      +L  ++L   DCIG  +++    LS G ++L ENVRFY EEE+
Sbjct: 67  KFNPKYSLAPVAGRLSELLKTDVLMAKDCIGPEVAEQAKELSGGQVMLLENVRFYEEEEK 126

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSES 187
           ND  F   L+   + ++NDAF  +HRAHAS  G++  +P+Y G  M+KE+ ++       
Sbjct: 127 NDRSFAGKLAGLAEIFVNDAFGTAHRAHASTEGIAGFIPAYAGFLMKKEVEIMGKALENP 186

Query: 188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDN 247
           ++P VAI+GG+KVS KI ++ +L+ KVD L+IGGGMAN+F+ AQG   G+SL +++ +  
Sbjct: 187 ERPFVAIIGGAKVSDKIAVIDHLISKVDTLIIGGGMANTFIKAQGYETGKSLVEKEKTGL 246

Query: 248 VHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQ 307
             ++  +AK+   + ++P DVV A++      +++ S + + LD   LD+G  +     +
Sbjct: 247 AQELLAKAKQKGIKFLLPTDVVAAKDFAPDAQSRITSVKEIALDEQALDIGPDSAAKFAE 306

Query: 308 VIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGI 367
            I  A+T++WNGP+GVFE+  F + T +VA  VA    E + ++I GGGD++ A+   G+
Sbjct: 307 EIRPAKTLIWNGPMGVFEMPKFAQGTEKVAIAVA----ECQGVTIVGGGDSVAAVEKMGV 362

Query: 368 SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ T+VST GGA LE+LEGK LPG+ AL 
Sbjct: 363 ADKITHVSTGGGASLEFLEGKLLPGVAALQ 392


>gi|224532260|ref|ZP_03672892.1| phosphoglycerate kinase [Borrelia valaisiana VS116]
 gi|224511725|gb|EEF82131.1| phosphoglycerate kinase [Borrelia valaisiana VS116]
          Length = 393

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 250/393 (63%), Gaps = 4/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ AK+V+ SHLG
Sbjct: 3   IKTVKDFDSFAGKRALVRCDFNVPLKEGIISDDTRIKSALPTIEYLKERGAKIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V +    +L +++  ++DCIGS +  +   +  G ++L ENVRFY+
Sbjct: 63  RPEGKKNLKYSLKPVANRLSELLDQDVKMLSDCIGSEIVNNTLQMKNGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLGGV 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K D +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSDVVVIGGGMAYTFLHSKGYSIGKSLLEGE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA +       + + + ++P + I +DVG  T++
Sbjct: 243 YIDVASSFLKKAKELGVKVILPLDHIVASDFDKNSTPEYIDSFNIPENKIGMDVGGNTLK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I+ V+  A+T++WNGPLGVFE + F + T +VA  VA        +++ GGGD++ A+ 
Sbjct: 303 EIENVVKIAKTIIWNGPLGVFEFDLFSKGTAKVAEMVASCAG----LTVVGGGDSVAAVN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 359 KFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|325479317|gb|EGC82413.1| phosphoglycerate kinase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 398

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 168/397 (42%), Positives = 257/397 (64%), Gaps = 10/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI---DGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ DL D++G + L+RVD+NVP     + ++AD TRI+  +PTI  L+E  AKV++ SH
Sbjct: 4   KTVKDL-DVKGKKVLVRVDFNVPLSKENNEEIADDTRIKAALPTIDYLLENNAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVN--DCIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ ++  + +L  V    E+       F    + +   + + +A+L EG + L EN 
Sbjct: 63  LGRPKGEAKPEFALKPVADWLENHYKDKFHFFPSPEVVDDKVKEEVANLKEGEVCLIENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE+ +
Sbjct: 123 RYVAGETKNDPEFAKKLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKEIDV 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +     + + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G+SL
Sbjct: 183 MGKALEDPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+ +  EI++P DVV+A E+K+G+ T+VV   S+P D   LD+G 
Sbjct: 243 LEEDKMDLSLELIKKAEENNVEILLPVDVVIADEIKSGVETEVVDIDSIPEDKEALDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT E     I  A+TV+WNGP+GVFE++ F   T +VA  +A    E   I+I GGGD+ 
Sbjct: 303 KTAELFASKIKNAKTVVWNGPMGVFEVKEFANGTNKVAESLA----ESDAITIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  AG+ ++ T+VST GGA LE+LEGKDLPGI ++
Sbjct: 359 LAIELAGLKDKITHVSTGGGASLEFLEGKDLPGISSI 395


>gi|57238766|ref|YP_179902.1| phosphoglycerate kinase [Ehrlichia ruminantium str. Welgevonden]
 gi|58578687|ref|YP_196899.1| phosphoglycerate kinase [Ehrlichia ruminantium str. Welgevonden]
 gi|57160845|emb|CAH57743.1| phosphoglycerate kinase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417313|emb|CAI26517.1| Phosphoglycerate kinase [Ehrlichia ruminantium str. Welgevonden]
          Length = 395

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 172/384 (44%), Positives = 245/384 (63%), Gaps = 6/384 (1%)

Query: 6   TMNDLRDI--RGLRCLLRVDWNVPFIDGKVA-DVTRIERVVPTILELVEKKAKVVIFSHL 62
            M  ++D   RG   LLRVD NVP  D KV  D TRI R+  T+  L+   AK+V+ SH 
Sbjct: 11  NMKKIQDFSCRGKTILLRVDLNVPVDDNKVVLDDTRIVRLTTTVKYLLSNNAKIVMISHY 70

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           G P+S  D++ SL  +V     I   N+LFV+  IGS + Q++ S+  G ++L EN+RFY
Sbjct: 71  GSPKS-YDREFSLKFLVEYLNKIFATNVLFVDGVIGSYVEQAVQSVPLGSVLLLENLRFY 129

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EEE+ND +F + L+   D Y+NDAFS  HR HASI  ++ LLPS+IG   Q+EL  L  
Sbjct: 130 VEEEKNDLNFAKQLALLADVYVNDAFSCMHRKHASIDAVARLLPSFIGFNFQEELKYLSY 189

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S S KP+  IVGG+K+STKI +L NL +KV+ L++GG +AN+FL++QG+ +G SLC++
Sbjct: 190 VVSNSDKPVGVIVGGAKISTKIHMLRNLTQKVNFLILGGAIANNFLLSQGLKIGNSLCEK 249

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              D    +   AK+  CEIIVP D +V +++ +     V + Q +  D IILD+G  T+
Sbjct: 250 LDEDPFVDVINFAKKYGCEIIVPEDYLVTKDLVSN-EAVVKNNQELAPDDIILDIGPHTI 308

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             I  +I + RTV+WNGP+G+FE EPF   T  +A  +A+ TK  ++ SI GGGD+I A+
Sbjct: 309 NIITSIIGKCRTVLWNGPMGMFEKEPFSHGTFSIARLLAEFTKAGKLKSIVGGGDSICAI 368

Query: 363 AHAG-ISNEFTYVSTAGGAFLEWL 385
             +G +S +FTY+ST GGA L +L
Sbjct: 369 KLSGLLSEDFTYISTGGGALLHFL 392


>gi|222529394|ref|YP_002573276.1| bifunctional phosphoglycerate kinase/triosephosphate isomerase
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222456241|gb|ACM60503.1| triosephosphate isomerase [Caldicellulosiruptor bescii DSM 6725]
          Length = 650

 Score =  325 bits (833), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 245/393 (62%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI   +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|312622371|ref|YP_004023984.1| triosephosphate isomerase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202838|gb|ADQ46165.1| triosephosphate isomerase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 650

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 245/393 (62%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI   +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMRKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|254424136|ref|ZP_05037854.1| phosphoglycerate kinase [Synechococcus sp. PCC 7335]
 gi|196191625|gb|EDX86589.1| phosphoglycerate kinase [Synechococcus sp. PCC 7335]
          Length = 401

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 166/387 (42%), Positives = 247/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+R D+NVP  D G + D TRI   +PTI +L  K AKV++ SH GRP+ K  
Sbjct: 13  DVSGKRVLVRADFNVPLDDAGNITDDTRIRAALPTIQDLTSKGAKVILASHFGRPKGKVV 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +     L ++++  +DCIG  ++  IA + +G + L ENVRFY  E  N+P
Sbjct: 73  ESMRLTPVAARLSEKLGQDVIKCDDCIGDEVAAKIAEMKDGDVALLENVRFYDGETNNEP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N D Y+NDAF  +HRAHAS  G++ +L P+  G  ++KEL  L+      ++
Sbjct: 133 EFAKQLAANADLYVNDAFGTAHRAHASTAGVTEYLSPAVAGSLIEKELKFLQETVDNPQR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI ++  L+ KVDKL IGGGM  +F  A+G+GVG SL + D  D   
Sbjct: 193 PLAAIVGGSKVSSKIGVIETLLDKVDKLFIGGGMIFTFFKARGIGVGSSLVEEDKLDLAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E ++P DV+VA +      TQ VS +++P   + LD+G  +V+  +  +
Sbjct: 253 KLEAKAKEKGVEFLLPTDVIVADKFAADANTQTVSVENIPDGWMGLDIGPDSVKTFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  ++V+WNGP+GVFE+E F + T  +A  +A LT ++  I+I GGGD++ A+  AG+++
Sbjct: 313 ADCKSVIWNGPMGVFEMEAFAKGTTGIATTLAGLT-DKGCITIIGGGDSVAAVEQAGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 KMSHISTGGGASLELLEGKTLPGIAAL 398


>gi|312793583|ref|YP_004026506.1| triosephosphate isomerase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180723|gb|ADQ40893.1| triosephosphate isomerase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 650

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 245/393 (62%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI   +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|312875920|ref|ZP_07735910.1| triosephosphate isomerase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797401|gb|EFR13740.1| triosephosphate isomerase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 650

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 245/393 (62%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI   +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|302871797|ref|YP_003840433.1| triosephosphate isomerase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574656|gb|ADL42447.1| triosephosphate isomerase [Caldicellulosiruptor obsidiansis OB47]
          Length = 650

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 245/393 (62%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI   +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|300863560|ref|ZP_07108506.1| Phosphoglycerate kinase [Oscillatoria sp. PCC 6506]
 gi|300338427|emb|CBN53648.1| Phosphoglycerate kinase [Oscillatoria sp. PCC 6506]
          Length = 399

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 166/386 (43%), Positives = 245/386 (63%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R L+R D+NVP  +G + D TRI   +PTI +L  K AKV++ SH GRP+  SDK
Sbjct: 13  DLSGKRVLVRADFNVPLDNGNITDDTRIRAALPTIEDLTSKGAKVILCSHFGRPKGVSDK 72

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V +    +L K +   +DCIG  ++  +A++ +G +IL ENVRFY EEE NDP+
Sbjct: 73  -LRLTPVAARLSELLGKEVKKPSDCIGEEVAGVVAAMQDGDVILLENVRFYPEEEANDPE 131

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKKP 190
           F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G+ ++KEL  L+      ++P
Sbjct: 132 FAKNLASVADLYVNDAFGTAHRAHASTEGVTKYLSPSVAGKLIEKELEYLQGAIENPQRP 191

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L AI+GGSKVS+KI ++  L++K DKL++GGGM  +F  A+G+ VG+SL + D  +    
Sbjct: 192 LAAIIGGSKVSSKIGVIEKLLEKCDKLILGGGMVFTFYKARGLNVGKSLVEDDKLELAKS 251

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK      ++P DVVVA +      TQ+VS +++P   + LD+G  +V+  +  +A
Sbjct: 252 LEAKAKERGVTFLLPTDVVVADKFAADANTQIVSVEAIPDGWMGLDIGPDSVKTFQDALA 311

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             +TV+WNGP+GVFE+E F   T  +A  +A LTK     +I GGGD++ A+    +  E
Sbjct: 312 DCKTVIWNGPMGVFEMEKFAAGTEGIARTLAGLTK-TGTSTIIGGGDSVAAVEMLDLGAE 370

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK+LPGI AL
Sbjct: 371 MSHISTGGGASLELLEGKELPGIAAL 396


>gi|159482940|ref|XP_001699523.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
 gi|158272790|gb|EDO98586.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
          Length = 462

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 169/397 (42%), Positives = 250/397 (62%), Gaps = 6/397 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVA--DVTRIERVVPTILELVEKKAKVVIFS 60
           +++ DL   D+ G R  +R D NVP     +A  D TRI   VPT+  L++  AKV++ S
Sbjct: 64  KSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVLLTS 123

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +    L  VV+    +L K +  V+DCIG  + +++ ++  G ++L ENVR
Sbjct: 124 HLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLENVR 183

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSM 179
           FY EEE+N+P+F + L+ N D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  
Sbjct: 184 FYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDY 243

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+   S  K+P VAIVGGSKVS+KIT++  L++K DK++IGGGM  +F  A+G+ VG SL
Sbjct: 244 LDGAVSNPKRPFVAIVGGSKVSSKITVIEALMEKCDKIIIGGGMIFTFYKARGLKVGSSL 303

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++   AK    ++++P DVVVA +      TQ V   ++P   + LD+G 
Sbjct: 304 VEDDKIELAKKLEEMAKAKGVQLLLPTDVVVADKFDANANTQTVPITAIPDGWMGLDIGP 363

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +V+     +A A+TV+WNGP+GVFE   F   TV +A+ +A LT  +  I+I GGGD++
Sbjct: 364 DSVKTFNDALADAKTVVWNGPMGVFEFPKFANGTVSIANTLAGLT-PKGCITIIGGGDSV 422

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 423 AAVEQAGVAEKMSHISTGGGASLELLEGKVLPGVAAL 459


>gi|297618011|ref|YP_003703170.1| phosphoglycerate kinase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145848|gb|ADI02605.1| Phosphoglycerate kinase [Syntrophothermus lipocalidus DSM 12680]
          Length = 396

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 164/397 (41%), Positives = 247/397 (62%), Gaps = 6/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +R + D+ D++G R L+RVD+NVP    G + D  RI+  +PTI  L+++ AKV++ SHL
Sbjct: 1   MRGLKDI-DVKGKRVLVRVDFNVPTDKQGNILDDARIKASLPTIRYLIDQGAKVILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP  K  +   L KV     ++L + +  + DC+G  +  ++A +  G ++L ENVRF+
Sbjct: 60  GRPDGKVVEAYRLDKVAQHLSTLLGQEVKKLPDCVGKEVEDAVAQMQPGQVVLLENVRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           + EE+NDP+F   L+  GD ++NDAF  +HRAHAS  G++  LPS  G  M+KE+ ML S
Sbjct: 120 AGEEKNDPEFAAQLAALGDVFVNDAFGTAHRAHASTAGVTRYLPSAAGFLMEKEVKMLRS 179

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
               S+ P VAI+GG+KVS K+ LL N++ KVD ++IGGGMAN+FL A+G  +G SLC+ 
Sbjct: 180 VMESSESPRVAIIGGAKVSDKMGLLQNMLDKVDAIIIGGGMANTFLKAEGYYIGNSLCED 239

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              D    +  +A+     +++P DVVVA  +     ++ V    VP   II+D+G +T 
Sbjct: 240 KLLDFARSLLKQAEEKRIRVLLPVDVVVADRLAADAQSREVKVDQVPEGWIIVDIGSETA 299

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
               + I  A  ++WNGP+GV+E E F R T EVA  VA        +S+ GGGD++  +
Sbjct: 300 RLFGETIKSAHNIIWNGPMGVYEYERFARGTEEVARAVAA----SGAVSVVGGGDSLAII 355

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A  G+ ++ T++ST GGA LE+LEGK LPG+ +  G+
Sbjct: 356 ARLGLEDKMTHISTGGGATLEFLEGKVLPGVASCEGY 392


>gi|320160732|ref|YP_004173956.1| phosphoglycerate kinase [Anaerolinea thermophila UNI-1]
 gi|319994585|dbj|BAJ63356.1| phosphoglycerate kinase [Anaerolinea thermophila UNI-1]
          Length = 391

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 167/397 (42%), Positives = 249/397 (62%), Gaps = 10/397 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +++ D+ D++G + L+RVD+NVP  +G V D TRI   +PTI  L+E+ A V++FS
Sbjct: 1   MFNKKSVRDI-DVKGKKVLVRVDFNVPIKEGVVQDDTRIRAALPTIEYLLEQGAAVILFS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   D   S+  V      ++ K + F  DC+G    ++ A+L  G +++ EN R
Sbjct: 60  HLGRPKGGPDPKYSMKPVAEYLAQLMGKPVAFAEDCVGEPAEKAAANLKPGEVLVLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+ND +  + ++   D Y+NDAF  +HRAH+S  G++  LP+  G  M+KE+  L
Sbjct: 120 FHPEEEKNDLELAKKMAALADIYVNDAFGSAHRAHSSTEGVARFLPAVAGFLMEKEIQYL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  K+P VAI+GG+KVS KI ++ NL+ K D ++IGGGMAN+F  AQG  VG+SL 
Sbjct: 180 SQAIENPKRPFVAILGGAKVSDKIGVIKNLLTKADTILIGGGMANTFFKAQGYPVGKSLV 239

Query: 241 QRDFSDNVHQIAWEA-KRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           +    D V  +A E   +   ++ +P DVV+A+ M+ G  T+VV    +P D +ILD+G 
Sbjct: 240 E----DEVLDLARELIAQGGTKLRLPVDVVIAQSMEEGAETKVVPVGPIPDDWMILDIGP 295

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TV    +VIA A TV+WNGP+GVFE+  F + T  +A  +AK       ISI GGGD+ 
Sbjct: 296 ETVASYGKVIANAATVVWNGPMGVFEVSTFAKGTFGIADALAK----SNAISIVGGGDSA 351

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+  +G++ + T++ST GGA LE LEG  LPG+ AL
Sbjct: 352 SAVQKSGLAEKITHISTGGGASLEMLEGLFLPGVAAL 388


>gi|129916|sp|P12783|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic
 gi|21835|emb|CAA33302.1| unnamed protein product [Triticum aestivum]
          Length = 401

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 170/400 (42%), Positives = 254/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D++G +  +R D NVP  D  K+ D TRI   +PTI  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V+    +L   ++   DCIG  + +  A+L +GG++L E
Sbjct: 61  LASHLGRPKGVTPK-FSLKPLVARLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L+ KVD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +   AK    ++++P DVVVA +      +++V A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG  +++   + +   +TV+WNGP+GVFE E F   T  +A  +A+LT  + + +I GGG
Sbjct: 300 VGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|114386666|gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
          Length = 402

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 243/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+RG +  +R D NVP  D  K+ D TRI   VPT+  L+EK AKV++ SHLGRP+  + 
Sbjct: 14  DLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILASHLGRPKGVTP 73

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K  SL  +V     +L  +++  NDCIG  + +  A+L EGG++L ENVRFY EEE+NDP
Sbjct: 74  K-YSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRFYKEEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++  L P+  G  MQKEL  L    +  KK
Sbjct: 133 EFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKELDYLVGAVANPKK 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG+SL + D  +   
Sbjct: 193 PFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVGKSLVEEDKLELAT 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVVVA +      ++ V+A ++P   + LDVG   ++   + +
Sbjct: 253 SLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDVGPDAIKTSSEAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
               T++WNGP+GVFE E     T  +A  +A LT  +   +I GGGD++ A+  AG+++
Sbjct: 313 DTCNTIIWNGPMGVFEFEKLAAGTDAIAKKLADLTTTKGATTIIGGGDSVAAVEKAGLAD 372

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG++AL
Sbjct: 373 KMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|326493522|dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 401

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 170/393 (43%), Positives = 250/393 (63%), Gaps = 5/393 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D +D+ G + LLR D NVP  DG ++AD  RI   VPTI  L+ K AKVV+ SHLGR
Sbjct: 9   TLGD-KDLGGKKVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGAKVVLASHLGR 67

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+  + K  SL  +V     +L  +++  NDCIG  +    A+L +GG++L ENVRFY E
Sbjct: 68  PKGVTPK-YSLKPLVPRLSELLGVDVVMANDCIGEEVENLAAALPDGGVLLLENVRFYKE 126

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESC 183
           EE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L P+  G  MQKEL  L   
Sbjct: 127 EEKNDPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKYLRPAVAGFLMQKELDYLVGA 186

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            ++ KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG+SL + D
Sbjct: 187 VADPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGHAVGKSLVEDD 246

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +  + +  +AK     +++P D+VVA        ++ V A ++P   + LD+G  ++ 
Sbjct: 247 KLELANSLIEKAKSKGVSLLLPTDIVVANNFAADAESKTVPASAIPDGWMGLDIGPDSIR 306

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +   +TV+WNGP+GVFE E F   T  +A  +A +T +  + +I GGGD++ A+ 
Sbjct: 307 KFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAQ-GVTTIIGGGDSVAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 366 KAGLASKMSHISTGGGASLELLEGKTLPGVLAL 398


>gi|225552308|ref|ZP_03773248.1| phosphoglycerate kinase [Borrelia sp. SV1]
 gi|225371306|gb|EEH00736.1| phosphoglycerate kinase [Borrelia sp. SV1]
          Length = 393

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 254/394 (64%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  +++CIGS ++ S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSNCIGSEVANSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP  + S  +VP + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEHIDSF-NVPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGKILPGIKVL 391


>gi|119952859|ref|YP_945068.1| phosphoglycerate kinase [Borrelia turicatae 91E135]
 gi|254782190|sp|A1QYK6|PGK_BORT9 RecName: Full=Phosphoglycerate kinase
 gi|119861630|gb|AAX17398.1| phosphoglycerate kinase [Borrelia turicatae 91E135]
          Length = 392

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 245/393 (62%), Gaps = 5/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D  D  G R L+R D+NVP  +G + D TRI   +PTI  L  + A+V++ SHLG
Sbjct: 3   IKTIKDC-DFAGKRALVRCDFNVPLKEGNITDDTRIRAALPTIEYLKSQGARVILMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + +   SL  V      +L +++  + DCIG  ++ +++ +  G I+L EN+RFY 
Sbjct: 62  RPKGEKNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATTVSCMKNGDIVLLENLRFYK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE N   FVR LS+NGD ++NDAF  +HRAHAS  GL+  LP+  G  M+KE   L   
Sbjct: 122 EEEENCDAFVRKLSQNGDIFVNDAFGTAHRAHASTAGLAAYLPAVGGFLMEKEDEFLGKI 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P VAI+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL + +
Sbjct: 182 LRNPESPFVAIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGYSIGQSLLENE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D VVA E +     + V +  +P D + +D+G KT+ 
Sbjct: 242 YIDVASSFLKKAKELDVKVILPLDHVVASEFREDSIPEYVDSVDIPNDKVGMDIGEKTLR 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++V+  A+TV+WNGPLGVFE   F + T +VA YVA  +     I++ GGGD++ A+ 
Sbjct: 302 KIEEVLVSAKTVIWNGPLGVFEFNSFSKGTAKVAEYVASCSG----ITVVGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S + T+VST GGA LE+LEGK LPGI  L
Sbjct: 358 KFNLSEKITHVSTGGGASLEYLEGKVLPGIKVL 390


>gi|114565838|ref|YP_752992.1| phosphoglycerate kinase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114336773|gb|ABI67621.1| phosphoglycerate kinase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 443

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 157/393 (39%), Positives = 251/393 (63%), Gaps = 6/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           LR++ +L +++G R L+RVD+NVP   +G + D T++   +P+I  ++ +  ++++ SHL
Sbjct: 33  LRSLKEL-ELKGQRVLMRVDFNVPTDKEGNIIDDTKMRAALPSIEHVLAQGGRLILMSHL 91

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP  K D+  SL  + S    +L   +   +DCIG  ++Q+   L +G ++L EN+RF+
Sbjct: 92  GRPNGKIDEKYSLKNLASRLGQLLAAPVYMAHDCIGPEVAQAARGLQDGEVLLLENLRFH 151

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           +EEE+NDP F R L+  GD ++NDAF  +HRAH+S  G++  LP Y G  M+KE+ MLE 
Sbjct: 152 AEEEKNDPAFSRELASLGDIFVNDAFGTAHRAHSSTAGIADYLPCYAGFLMEKEVEMLEK 211

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                + P +AI+GG+KV+ K+ L+ NL++K+D ++IGGGMAN+FL A G  +G+S+C+ 
Sbjct: 212 VLENPQSPRMAIMGGAKVADKLGLIGNLLQKMDVILIGGGMANTFLKALGKTIGKSICED 271

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +  +    +  EA++    +I+P D VVA E+    P Q+V    VP + +ILD+G +++
Sbjct: 272 NLLEQARGLVEEAEKKNVSLILPLDAVVAPELSAEAPGQIVDIDHVPAELMILDIGPQSI 331

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E  K+ I +A T++WNGPLGV+E   F R T E+   +A+ +     +S+ GGGDT   +
Sbjct: 332 ELFKKYIEKASTIVWNGPLGVYEYPNFARGTEEITRAIARSSA----VSVIGGGDTAVIV 387

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVA 395
              G+    T++ST GGA LE+LEG  LPG+ A
Sbjct: 388 HDMGLEEGITHISTGGGATLEFLEGIRLPGVAA 420


>gi|332711379|ref|ZP_08431311.1| phosphoglycerate kinase [Lyngbya majuscula 3L]
 gi|332349928|gb|EGJ29536.1| phosphoglycerate kinase [Lyngbya majuscula 3L]
          Length = 401

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 161/388 (41%), Positives = 248/388 (63%), Gaps = 3/388 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G   L+R D NVP  D G + D TRI   +PT+ +L++K AKV++ SHLGRP+ +  
Sbjct: 13  DLAGKTVLVRADLNVPLDDNGTITDDTRIRAALPTVQDLLKKGAKVILCSHLGRPKGQVK 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V      +L + +    DC+G  ++  + +L  G + L EN+RF++ EE+NDP
Sbjct: 73  ESLRLTPVAERLSELLGQPVTMCKDCVGDEVAAQVGALENGQVALLENLRFHAGEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL  L++     +K
Sbjct: 133 EFTKQLASLADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKELQYLQNAVENPEK 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L++KVDKL+IGGGM  +F  A+GM VG+SL + D  D   
Sbjct: 193 PLAAIIGGSKVSSKIGVIDTLLEKVDKLLIGGGMIFTFYKARGMSVGKSLVEDDKLDLAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK    E+++P DVV+A        +Q VS +++P   + LD+G  +V+  ++ +
Sbjct: 253 SLEAKAKERGVELLLPTDVVIADNFAPDANSQTVSIEAIPDGWMGLDIGPDSVKVFQEAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F + T  +A+ +A+LTK     +I GGGD++ A+   G+++
Sbjct: 313 ADCKTVIWNGPMGVFEFDQFAKGTEAIANSMAELTK-TGASTIIGGGDSVAAVEKVGVAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + +++ST GGA LE LEGK LPGI AL+
Sbjct: 372 QMSHISTGGGASLELLEGKVLPGIAALN 399


>gi|115469436|ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 gi|52075828|dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica
           Group]
 gi|52076544|dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica
           Group]
 gi|113596357|dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gi|125556411|gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gi|125598169|gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 gi|215678721|dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215697936|dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 401

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 170/401 (42%), Positives = 252/401 (62%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D++G +  LR D NVP  D  K+ D TRI   VPTI  L+ K AKV+
Sbjct: 1   MASKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  +++  NDCIG  + +  A+L +GG++L E
Sbjct: 61  LASHLGRPKGVTPK-YSLKPLVPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F   L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHASTEGVTKYLRPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P D+VVA +      ++ V A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE E F   T  +A  +A +T  + + +I GGG
Sbjct: 300 IGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADIT-AKGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL+
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALN 399


>gi|22299811|ref|NP_683058.1| phosphoglycerate kinase [Thermosynechococcus elongatus BP-1]
 gi|30172993|sp|Q8DGP7|PGK_THEEB RecName: Full=Phosphoglycerate kinase
 gi|22295995|dbj|BAC09820.1| phosphoglycerate kinase [Thermosynechococcus elongatus BP-1]
          Length = 400

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 248/387 (64%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV++ SH GRP+   D
Sbjct: 13  DLEGKRVLVRVDFNVPVDEKGVITDETRIRAALPTIQDLISKGAKVILVSHFGRPKG-VD 71

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V      +LHK +  ++DCIG  +     +++ G + L ENVRF+  EE+NDP
Sbjct: 72  EKLRLTPVAQRLSELLHKPVAKLDDCIGDAVIAHTQAMANGDVCLLENVRFHPGEEKNDP 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   + Y+NDAF  +HRAHAS  G++  L P   G  M+KEL  L++     ++
Sbjct: 132 EFAKQLAACAEVYVNDAFGTAHRAHASTAGVTQYLSPCVAGFLMEKELEYLQNAIEHPRR 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI ++  L++KVDKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 192 PLAAIVGGSKVSSKIGVIEALLEKVDKLLIGGGMIFTFYKARGLNVGKSLVEEDKLELAK 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +A+    E+++P DVVVA        +QVVS +++P D + LD+G  +V+  ++ +
Sbjct: 252 HLETKAQEKGVELLLPTDVVVADNFANDANSQVVSIEAIPDDWMGLDIGPASVKRFQEAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              +TV+WNGP+GVFE + F + T  +A Y+A+LT +  + +I GGGD++ A+   G+++
Sbjct: 312 QDCKTVIWNGPMGVFEFDQFAKGTEAIARYLAELTSQ-GVCTIIGGGDSVAAVEKVGVAD 370

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             +++ST GGA LE LEGK LPGI AL
Sbjct: 371 RMSHISTGGGASLELLEGKQLPGIAAL 397


>gi|218249062|ref|YP_002374433.1| phosphoglycerate kinase [Cyanothece sp. PCC 8801]
 gi|257062149|ref|YP_003140037.1| phosphoglycerate kinase [Cyanothece sp. PCC 8802]
 gi|226699799|sp|B7JVE4|PGK_CYAP8 RecName: Full=Phosphoglycerate kinase
 gi|218169540|gb|ACK68277.1| Phosphoglycerate kinase [Cyanothece sp. PCC 8801]
 gi|256592315|gb|ACV03202.1| Phosphoglycerate kinase [Cyanothece sp. PCC 8802]
          Length = 400

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 159/386 (41%), Positives = 250/386 (64%), Gaps = 2/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R L+RVD+NVP     + D TRI   +PTI +L+EK AKV++ SH GRP+ +  +
Sbjct: 13  DVAGKRVLVRVDFNVPLDGATITDDTRIRAALPTIKDLIEKGAKVILCSHFGRPKGQVVE 72

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V +    +L + ++  +DCIG +++ +I  L  G + L EN+RF++EEE NDP+
Sbjct: 73  SMRLTPVATRLSELLGQPVVMCDDCIGDSVTAAINQLQNGQVALLENLRFHAEEEANDPE 132

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKKP 190
           F + L+ N D Y+NDAF  +HRAHAS  G++H L P+  G  ++KEL+ L++     ++P
Sbjct: 133 FAQKLAANADLYVNDAFGTAHRAHASTEGVTHYLSPNVAGYLIEKELNYLQAAIENPQRP 192

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           LVAI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +    
Sbjct: 193 LVAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVGKSLVEDDKLELAKS 252

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    + ++P DVV+A         + VS  ++    + LD+G ++V+  +  +A
Sbjct: 253 LEAKAKEKGVDFLLPTDVVLADNFAPDANAKTVSIDAIEDGWMGLDIGPESVKVFQAALA 312

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             ++V+WNGP+GVFE + F + T  +AH +A+LT  +  I+I GGGD++ A+   G++++
Sbjct: 313 DCKSVIWNGPMGVFEFDKFAKGTEAIAHTLAELTG-KGTITIIGGGDSVAAVEKVGVADK 371

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPGI AL
Sbjct: 372 MSHISTGGGASLELLEGKVLPGIAAL 397


>gi|146296957|ref|YP_001180728.1| phosphoglycerate kinase., Triose-phosphate isomerase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410533|gb|ABP67537.1| phosphoglycerate kinase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 650

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 162/399 (40%), Positives = 247/399 (61%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M RL  +T+ D+ D+ G + L+RVD+NVP  + G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPRLNKKTIRDI-DVSGKKVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + E  ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLSKEVILAKDVIGEDAKKCVEQMKEKDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDIAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEYMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|211906450|gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
          Length = 401

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 170/401 (42%), Positives = 253/401 (63%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  +++ DL+  D++G +  +RVD NVP  D   + D TRI   VPTI  L+   +KV+
Sbjct: 1   MATKKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   +   NDCIG  + + +A+L +GG++L E
Sbjct: 61  LSSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAALPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGHAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVVVA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVVADKFAADANSKVVPASGIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL+
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALN 399


>gi|298492592|ref|YP_003722769.1| phosphoglycerate kinase ['Nostoc azollae' 0708]
 gi|298234510|gb|ADI65646.1| Phosphoglycerate kinase ['Nostoc azollae' 0708]
          Length = 400

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 245/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           DI G R L+RVD+NVP  D G + D TRI   VPTI +L +K AKV++ SH GRP+   D
Sbjct: 13  DISGKRALVRVDFNVPVDDQGSITDDTRIRAAVPTIQDLTKKGAKVILASHFGRPKGVDD 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K   L  V      +L + ++  +DCIG  ++  + +L  G ++L ENVRFY EEE+NDP
Sbjct: 73  K-LRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVGALQNGQVLLLENVRFYKEEEKNDP 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N DFY+NDAF  +HRAHAS  G++  L PS  G  ++KEL  L+S   E K+
Sbjct: 132 EFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQSAIEEPKR 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PLVAI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 192 PLVAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P D+V A +         VS  ++P D + LD+G  +V+  +  +
Sbjct: 252 ALEAKAKERGVALLLPTDIVAADKFAPDANATTVSIDNIPADGMGLDIGPDSVKVFQAAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +AH +A++ K      I  GGD++ A+   G+++
Sbjct: 312 ADCKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKIGTTTIIG-GGDSVAAVEKVGLAD 370

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 371 QMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|134300822|ref|YP_001114318.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
 gi|134053522|gb|ABO51493.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
          Length = 393

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 242/386 (62%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R  +RVD+NVP    K+ D TRI++ +PTI  L+ + A+V++ SHLGRP+ +  +
Sbjct: 10  DVKGKRVFVRVDFNVPLDREKITDDTRIQKALPTIQYLMGQGARVILASHLGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V      +L + ++ VN+ +G+   Q+IA + +G ++L ENVRF+ EE +ND  
Sbjct: 70  KYRLNPVAKRLSELLGQEVVKVNESVGTEPQQAIAQMKDGDVLLLENVRFHGEETKNDEK 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           + R L++  D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL  L    +  ++P 
Sbjct: 130 YARQLAQLADLFVNDAFGAAHRAHASTAGIAEYLPAVAGFLMEKELENLGKAVTNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL + D  +   ++
Sbjct: 190 VAIIGGAKVSDKIGVIENLLSKVDTLIIGGGMANTFLKAQGYDIGKSLIEPDKVELAKEL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              +K    E+++P D VVA  M+      VV    VP D +ILD+G  T E       +
Sbjct: 250 LERSKAQKVELLLPNDAVVALAMEPNAQQGVVPVSGVPADWMILDIGPDTAECYAAAAKK 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A TV+WNGP+GVFE++ F + T      VAK   E   I+I GGGD++ A+   G+++  
Sbjct: 310 AATVVWNGPMGVFEMDAFAKGT----EAVAKALAESNAITIVGGGDSVAAVNKVGVADRI 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE+LEGK LPG+ AL 
Sbjct: 366 SHISTGGGASLEFLEGKVLPGVAALQ 391


>gi|323141817|ref|ZP_08076683.1| triose-phosphate isomerase [Phascolarctobacterium sp. YIT 12067]
 gi|322413709|gb|EFY04562.1| triose-phosphate isomerase [Phascolarctobacterium sp. YIT 12067]
          Length = 641

 Score =  322 bits (824), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 246/393 (62%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ DL D+ G + L+RVD+NVP  D G++ D TRI   +PTI  L+E+KA V++ +HLG
Sbjct: 4   KTVRDL-DVAGKKVLVRVDFNVPLNDKGEITDDTRITASLPTIQYLLEQKAAVILMAHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      +L K ILF  DC+G     + + L  G I+L EN+RF+ 
Sbjct: 63  RPKGQVKPELSLAPVAKHLGKLLGKKILFAPDCVGEAAQAAASKLKPGHILLLENLRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F   L+   D Y+ND F VSHRAHAS+ G++H LP+  G  ++KE+  +   
Sbjct: 123 EEEKNDMEFAEKLASLADLYVNDGFGVSHRAHASVEGVTHFLPAAAGFLLEKEIQYVGQA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +    P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL + D
Sbjct: 183 VTNPLHPFVAIIGGAKVSDKIGVISNLLDKVDTLLIGGGMANTFLAAQGYKMGKSLVEED 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   ++  +AK++   +++P D+V+A              +++    + LD+G +T +
Sbjct: 243 KLDLAKELLAKAKKNKVNMLLPTDLVMAAAFAPDAEHVTEKVKNLNQAYMALDIGAETSK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +A A+ ++WNGP+GVFE++ F + T  VA  VAK     R  SI GGGD++ A+ 
Sbjct: 303 AYAEALADAKMIVWNGPMGVFEMDAFCKGTEAVAKAVAK----SRATSIVGGGDSVAAIE 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G++   T++ST GGA LE+LEGK LPG+ AL
Sbjct: 359 KLGLAKRITHISTGGGASLEYLEGKVLPGVAAL 391


>gi|187917935|ref|YP_001883498.1| phosphoglycerate kinase [Borrelia hermsii DAH]
 gi|226699796|sp|B2S1P1|PGK_BORHD RecName: Full=Phosphoglycerate kinase
 gi|119860783|gb|AAX16578.1| phosphoglycerate kinase [Borrelia hermsii DAH]
          Length = 392

 Score =  322 bits (824), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 246/393 (62%), Gaps = 5/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D  D  G R L+R D+NVP  +G + D TRI   +PTI  L  + A+VV+ SHLG
Sbjct: 3   IKTIKDF-DFSGKRALVRCDFNVPLREGNITDDTRIRAALPTIEYLKSQGARVVLMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + +   SL  V      +L +++  + DCIG  ++ +++++  G ++L EN+RFY 
Sbjct: 62  RPKGERNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATAVSNMKNGDVVLLENIRFYR 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           +EE N  DF + LS+NGD ++NDAF  +HRAHAS  GL+  LP+  G  M+KE   L   
Sbjct: 122 QEEENCNDFAKKLSQNGDIFVNDAFGTAHRAHASTAGLAAYLPAVGGFLMEKEDEFLGKI 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL + +
Sbjct: 182 LKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGHSIGKSLLENE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK    ++I+P D +VA E K     + V A  +P   I +D+G KT+ 
Sbjct: 242 YIDVAASFLKKAKELDVKVILPLDHIVASEFKEDSIPEYVDAIDIPDGKIGMDIGEKTLR 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I++V+  A+TV+WNGPLGVFE + F + T +VA YVA  +     I++ GGGD++ A+ 
Sbjct: 302 KIEEVLVSAKTVIWNGPLGVFEFDSFSKGTAKVAEYVASCSG----ITVVGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S + T+VST GGA LE+LEGK LPGI  L
Sbjct: 358 KFNLSEKITHVSTGGGASLEYLEGKILPGIKVL 390


>gi|296134199|ref|YP_003641446.1| Phosphoglycerate kinase [Thermincola sp. JR]
 gi|296032777|gb|ADG83545.1| Phosphoglycerate kinase [Thermincola potens JR]
          Length = 399

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 162/386 (41%), Positives = 243/386 (62%), Gaps = 5/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+RG R  LRVD+N P  +   V+D T+I   +PTI  L+E+ AKV+I SHLGRP+ +  
Sbjct: 10  DVRGKRVFLRVDFNTPLDEQNNVSDDTKIRASLPTINYLLEQGAKVIIASHLGRPKGQFK 69

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
            + SL  V      +L++ +    DCIG    +++A +  G I++ ENVRF+ EE +NDP
Sbjct: 70  PEFSLKPVAERLMQLLNRPVKLAEDCIGEKALKAVAGMQPGDIVMLENVRFHEEETKNDP 129

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
            F R L++  D Y+NDAF  +HRAHAS  G++  LP   G  M+KE++ +       ++P
Sbjct: 130 SFARQLAQLADVYVNDAFGTAHRAHASTAGITEYLPGAAGFLMEKEINYMSKALESPERP 189

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L+AI+GGSKVS KI +L NL+ KVD ++IGGGMAN+F  A G  +G SL + D  D    
Sbjct: 190 LLAIIGGSKVSDKILVLENLIGKVDTILIGGGMANTFFRAMGYSMGNSLVEEDKLDVAKN 249

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
              +A+ +  + ++P D+++A +++     Q+V    VP     +D+G KT E   + IA
Sbjct: 250 TMDKARAAGVKFMLPVDLMMADKIEKNARHQLVPVDKVPDGWAAVDIGPKTAELYGREIA 309

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
           +A+T++WNGP+GVFEI+ F + T  +AH VA    E   ++I GGG ++ A+   G+++ 
Sbjct: 310 RAKTIIWNGPMGVFEIDDFAKGTNYIAHAVA----EADALTIVGGGQSVQAIRKLGLTDR 365

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            ++VST GGA LE+LEGK+LPGI AL
Sbjct: 366 ISHVSTGGGASLEFLEGKELPGIKAL 391


>gi|312127544|ref|YP_003992418.1| triosephosphate isomerase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777563|gb|ADQ07049.1| triosephosphate isomerase [Caldicellulosiruptor hydrothermalis 108]
          Length = 650

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 244/393 (62%), Gaps = 2/393 (0%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + G + D  RI   +PTI  L++  AKV++ SHLG
Sbjct: 7   KTIRDI-DVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVILVSHLG 65

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   S+  V      +L K ++   D IG    + +  + E  ++L ENVRF+ 
Sbjct: 66  RPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKERDVVLLENVRFHK 125

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+ ML + 
Sbjct: 126 EEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIEMLGNA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+S C+ D
Sbjct: 186 LANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKSKCEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+G  T+E
Sbjct: 246 KLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIGNTTIE 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD+  A+ 
Sbjct: 306 LFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDSAAAVE 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 366 KLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|282897370|ref|ZP_06305372.1| Phosphoglycerate kinase [Raphidiopsis brookii D9]
 gi|281198022|gb|EFA72916.1| Phosphoglycerate kinase [Raphidiopsis brookii D9]
          Length = 400

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 162/390 (41%), Positives = 251/390 (64%), Gaps = 10/390 (2%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           DI   R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ SH GRP+   +
Sbjct: 13  DISDKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLISKGAKVILASHFGRPKGVDE 72

Query: 71  KDCSLFKVVSIAE---SILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
           K    F++  +A+    +L + ++  NDCIG  ++  +A+L +G ++L ENVRF+ EEE+
Sbjct: 73  K----FRLTPVAKRLSELLGQEVIKTNDCIGDDVTARVAALEQGQVLLLENVRFHKEEEK 128

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSE 186
           NDP+F R L+ N DFY+NDAF  +HRAHAS  G++ +L PS  G  ++KEL  L++    
Sbjct: 129 NDPEFARQLAANADFYVNDAFGTAHRAHASTEGVTKYLSPSVAGYLVEKELQYLQAAIEF 188

Query: 187 SKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSD 246
            ++PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL ++D  +
Sbjct: 189 PQRPLAAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVGKSLVEQDKLE 248

Query: 247 NVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIK 306
               +  +A      +++P D+V A +         VS +++P D + LD+G K+V+  +
Sbjct: 249 LASSLEKKAAERGVTLLLPTDIVAADKFAPDADAVTVSIENIPDDRMGLDIGPKSVKLFQ 308

Query: 307 QVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAG 366
             +A  +TV+WNGP+GVFE + F   T  +A  +A++ K     +I GGGD++ A+   G
Sbjct: 309 DALADCKTVIWNGPMGVFEFDKFAVGTEAIAQTLAEIGK-TGATTIIGGGDSVAAVEKVG 367

Query: 367 ISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++++ +++ST GGA LE LEG  LPGI AL
Sbjct: 368 LADQMSHISTGGGASLELLEGTVLPGIAAL 397


>gi|257066259|ref|YP_003152515.1| Phosphoglycerate kinase [Anaerococcus prevotii DSM 20548]
 gi|256798139|gb|ACV28794.1| Phosphoglycerate kinase [Anaerococcus prevotii DSM 20548]
          Length = 398

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 254/398 (63%), Gaps = 10/398 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI---DGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ DL D++G + L+RVD+NVP     + ++AD TRI   +PTI  L+E  AKV++ SH
Sbjct: 4   KTVKDL-DVKGKKVLVRVDFNVPLSKENNEEIADDTRIRAALPTIDYLLENDAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVN--DCIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ ++  + +L  V    E+       F    + +   + + +A+L EG + L EN 
Sbjct: 63  LGRPKGEAKPEFALKPVADWLENHYKDKFHFFPSPEVVDDKVKEEVANLKEGEVCLIENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE+ +
Sbjct: 123 RYVAGETKNDPEFAKKLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKEIEV 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G+SL
Sbjct: 183 MGKALEAPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+ +  EI++P DVV+A E+K G  T++V   S+P D   LD+G 
Sbjct: 243 LEEDKMDLSLELIKKAEANNVEILLPVDVVIADEIKAGAETEIVDIDSIPEDKEALDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT E     I +A+TV+WNGP+GVFEI+ F   T +VA  +A    E   I+I GGGD+ 
Sbjct: 303 KTAELFASKIKEAKTVVWNGPMGVFEIKEFADGTNKVAAALA----ESDAITIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+  AG+ ++ T+VST GGA LE+LEGKDLPGI ++ 
Sbjct: 359 LAIELAGLKDKITHVSTGGGASLEFLEGKDLPGISSIE 396


>gi|332882203|ref|ZP_08449833.1| phosphoglycerate kinase [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332679826|gb|EGJ52793.1| phosphoglycerate kinase [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 396

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/397 (42%), Positives = 251/397 (63%), Gaps = 5/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +RT+++  +  G + L+RVD+NVP  +  KV D TRIE   PTI +++     VV+ SHL
Sbjct: 1   MRTIDNF-NFAGKKALIRVDFNVPLDENFKVTDNTRIEAAKPTISKILNDGGTVVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ + +   SL  +V   E +L K ++FV DC+G    +++A+   G +IL EN+R++
Sbjct: 60  GRPKGERNDKYSLRHIVGEVEKVLGKKVIFVEDCVGEVAEKAVAAAPAGSVILLENLRYH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
            EEE+ D  F + L++ GD Y+NDAF  +HRAHAS T ++   P     G  + KE+  +
Sbjct: 120 KEEEKGDEGFSKELAKLGDIYVNDAFGTAHRAHASTTIVAKFFPERKCFGYLLAKEIESI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP+ AI+GGSKVS+KIT++ N++ KV+ L+IGGGMA +F+ AQG  +G S+C
Sbjct: 180 DKVMKSGEKPVTAILGGSKVSSKITIIENILDKVNHLIIGGGMAYTFIKAQGGKIGNSIC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    I  +AK    E+ +P DVV A        TQVV   +VP     LD G K
Sbjct: 240 EDDKQELALDILAKAKAKGVEVHLPIDVVAADAFDNNAKTQVVPVNAVPDGWEGLDAGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E IKQV+ +++T++WNGP+GVFE+  F + T+EV ++VA+ TK     S+ GGGD++ 
Sbjct: 300 TLENIKQVLLKSKTILWNGPVGVFELPTFAKGTIEVGNFVAEATK-NGAFSLVGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  N+ +YVST GGA LE LEG  LPGI A++
Sbjct: 359 AVKQFGFENKVSYVSTGGGAMLESLEGLVLPGIQAIN 395


>gi|227485035|ref|ZP_03915351.1| phosphoglycerate kinase [Anaerococcus lactolyticus ATCC 51172]
 gi|227237032|gb|EEI87047.1| phosphoglycerate kinase [Anaerococcus lactolyticus ATCC 51172]
          Length = 398

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 165/397 (41%), Positives = 251/397 (63%), Gaps = 10/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID---GKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ DL D+RG + L+RVD+NVP      GK+AD  RI+  +PTI  L E  AKV++ SH
Sbjct: 4   KTVKDL-DVRGKKVLVRVDFNVPLSKEEKGKIADDARIKAALPTINYLSENGAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFV--NDCIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ +++ D SL  V    ++       F+  ++ +   + + +  L++G I L EN 
Sbjct: 63  LGRPKGEANPDFSLKPVADYLKNEYKDKFAFIPSDEVVDEKVKEEVNKLADGQIALLENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+  EE +N  DF + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE+ +
Sbjct: 123 RYRKEETKNGEDFAKELASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKEIEV 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +         P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL A G  +G+SL
Sbjct: 183 MGKALEAPDHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAMGKEIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +AK +  EI++P DVV+A +++ G+ T++V    +P+D   LD+G 
Sbjct: 243 LEEDKMDLSLELIEKAKANGVEILLPVDVVIADKIEAGVDTEIVDIDDIPVDKEALDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +   + I  A+TV+WNGP+GVFEI+ F   T EVA  +A    +   ++I GGGD+ 
Sbjct: 303 KTAKLFAEKIKAAKTVVWNGPMGVFEIKEFSNGTNEVAKALA----DSDAVTIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  AG+ ++ T+VST GGA LE+LEGK LPGI A+
Sbjct: 359 LAIEMAGLKDKITHVSTGGGASLEFLEGKALPGITAI 395


>gi|315225573|ref|ZP_07867383.1| phosphoglycerate kinase [Capnocytophaga ochracea F0287]
 gi|314944517|gb|EFS96556.1| phosphoglycerate kinase [Capnocytophaga ochracea F0287]
          Length = 396

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 166/397 (41%), Positives = 254/397 (63%), Gaps = 5/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+++  +  G + L+RVD+NVP  +  KV D TRIE   PTI ++++     V+ SHL
Sbjct: 1   MKTIDNF-NFAGKKALIRVDFNVPLDENFKVTDNTRIEAAKPTIEKILKDGGTAVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ + +   SL  +VS  E +L K ++FV+DC+G    +++A+   G ++L EN+RF+
Sbjct: 60  GRPKGERNDKYSLRHIVSEVEKVLGKKVIFVDDCVGEVAEKAVAAAPAGSVVLLENLRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
           +EEE+ D  F + L++ GD Y+NDAF  +HRAHAS T ++   P++   G  + KE+  +
Sbjct: 120 NEEEKGDEAFSKQLAKLGDIYVNDAFGTAHRAHASTTIVAKFFPNHKCFGYLLAKEIESI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP+ AI+GGSKVS+KIT++ N++ KV+ L+IGGGMA +F+ AQG  VG S+C
Sbjct: 180 DKVMKNGEKPVTAILGGSKVSSKITIIENILDKVNHLIIGGGMAYTFIKAQGGKVGSSIC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK    E+ +P DVV A        TQVV   ++P     LD G K
Sbjct: 240 EDDKLDLALDILAKAKAKGVEVHLPIDVVAADAFDNNAKTQVVPVNAIPDGWEGLDAGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E IK V+ +++T++WNGP+GVFE+  F + T+ V  YVA+ TK +   S+ GGGD++ 
Sbjct: 300 TLENIKSVLLKSKTILWNGPIGVFEMPNFAKGTIAVGDYVAEATK-KGAFSLVGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  ++ +YVST GGA LE LEG  LPGI A++
Sbjct: 359 AVKQFGFEHKVSYVSTGGGAMLESLEGLVLPGIAAIN 395


>gi|21675031|ref|NP_663096.1| phosphoglycerate kinase [Chlorobium tepidum TLS]
 gi|30173004|sp|Q8KAE1|PGK_CHLTE RecName: Full=Phosphoglycerate kinase
 gi|21648266|gb|AAM73438.1| phosphoglycerate kinase [Chlorobium tepidum TLS]
          Length = 397

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/395 (41%), Positives = 255/395 (64%), Gaps = 4/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T++D+  ++G R L+RVD+NVP   D  + D  RI   +P+I ++++   ++++ SHLG
Sbjct: 4   KTLSDIS-LQGKRVLMRVDFNVPLDQDRNITDEKRIVEALPSIRKVIDNGGRLILMSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL  V      +L   +    DCIG+ + Q + +L +G +++ EN+RF+ 
Sbjct: 63  RPKGKVNPAFSLSPVAKRLSELLDCPVTMAGDCIGTEVMQQVLALQDGDVLMLENLRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLES 182
           EEE NDPDF R L+  G+ Y+NDAF  +HRAHAS  G++H + + + G  ++KEL  L +
Sbjct: 123 EEEANDPDFARELASLGEIYVNDAFGTAHRAHASTEGITHFMQTAVAGYLIEKELRYLGT 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             +++++P VAI+GG+K+S KI +L +L +KVD +++GG M  +F  AQG+ VG SL + 
Sbjct: 183 ALNDAQRPFVAILGGAKISGKIDVLESLFEKVDTVLVGGAMVFTFFKAQGLDVGNSLVEE 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +  +    +  +AK     +++P DVVVA E+    P++V    ++    I LD+G  T+
Sbjct: 243 NKLELAVSLLEKAKAKNVRLLLPEDVVVAGEISADAPSRVEPVSAISAGMIGLDIGPATI 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E  ++ I  A+TV+WNGP+GVFEI+ F R T  VA  +A  T E   I+I GGGD+  A+
Sbjct: 303 ETYRKEILDAKTVLWNGPMGVFEIDQFARGTFAVAQALADATAE-GAITIIGGGDSAAAI 361

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A AG+S++ T+VST GGA LE+LEGK+LPGI AL+
Sbjct: 362 AKAGLSDKVTHVSTGGGASLEFLEGKELPGIAALN 396


>gi|71083290|ref|YP_266009.1| phosphoglycerate kinase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062403|gb|AAZ21406.1| phosphoglycerate kinase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 392

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 155/394 (39%), Positives = 249/394 (63%), Gaps = 2/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +R + D  ++   + LLR+D NVP  +GK+ D TRI++++PTI  L++ +AK++I SH+G
Sbjct: 1   MRNIQDETNLNQKKVLLRLDLNVPLDNGKITDTTRIDKILPTINFLLKNEAKIIILSHVG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  +    ++ L++NI  ++  I    S  + +  +  I+  EN+RFY 
Sbjct: 61  RPKGKVVSELSLKPICEDLKNKLNENIRLISKNIKEINSNDLFNEQDEKIVTLENLRFYE 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAFS SHRAHASI  ++  +PSY G  +  E+  L   
Sbjct: 121 EEEKNDNGFAKHLASLADIYVNDAFSCSHRAHASIFEITKFIPSYAGLQLNLEIDALTKI 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            SE ++P+  I+GGSK+S+KI ++ NL+ K D ++I GGMAN+ L  +   +G+S+ + +
Sbjct: 181 TSEIQRPITCIIGGSKISSKINIIKNLITKFDNIIIVGGMANNILKYKECEIGKSIQEDN 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
               + +I   +K+  C+II P DV V + ++     ++    ++  D +ILD+G KT++
Sbjct: 241 CDKIIEEIFSLSKKENCKIIYPEDVAVGKSLEGS--AEIKELNNISKDELILDIGPKTIK 298

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I  +I ++ T++WNGP G FE   F + ++E+A  + +  K   I S+AGGGDT++ L 
Sbjct: 299 AINLLIEESSTILWNGPAGYFENPNFAKGSIEIAKKIIEKNKNNTIYSVAGGGDTVSLLN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G +N F +VSTAGGAFLE+LEGK+LPGI AL+
Sbjct: 359 GIGATNNFNFVSTAGGAFLEYLEGKELPGIKALN 392


>gi|227499731|ref|ZP_03929831.1| phosphoglycerate kinase [Anaerococcus tetradius ATCC 35098]
 gi|227218198|gb|EEI83461.1| phosphoglycerate kinase [Anaerococcus tetradius ATCC 35098]
          Length = 398

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 169/397 (42%), Positives = 256/397 (64%), Gaps = 10/397 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI---DGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ DL D++G + L+RVD+NVP     + ++AD TRI   +PTI  L+E +AKV++ SH
Sbjct: 4   KTVKDL-DVKGKKVLVRVDFNVPLSKENNEEIADDTRIRAALPTIDYLLENEAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILH-KNILFVNDCI-GSTLSQSIASLSEGGIILAENV 119
           LGRP+ ++  + SL  V    E+  + K   F +D +    + + +  L +G + L EN 
Sbjct: 63  LGRPKGEAKPEFSLKPVAKWLENHYNGKFHFFPSDVVVDEKVKEEVNGLKDGELCLIENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE+S+
Sbjct: 123 RYVAGETKNDPEFAKQLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKEISV 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G+SL
Sbjct: 183 MGKALEAPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+ +  EI++P DVV+A E+K G  T++V   S+P D   LD+G 
Sbjct: 243 LEEDKMDLSLELIKKAEANNVEILLPIDVVIADEIKAGAETEIVDIDSIPEDKEALDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT E     I  A+TV+WNGP+GVFEI+ F   T +VA  +A    E   ++I GGGD+ 
Sbjct: 303 KTAELFASKIKDAKTVVWNGPMGVFEIKEFANGTNKVAEALA----ESNAVTIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  AG+ ++ T+VST GGA LE+LEGKDLPGI ++
Sbjct: 359 LAIELAGLKDKITHVSTGGGASLEFLEGKDLPGITSI 395


>gi|254416717|ref|ZP_05030467.1| phosphoglycerate kinase [Microcoleus chthonoplastes PCC 7420]
 gi|196176457|gb|EDX71471.1| phosphoglycerate kinase [Microcoleus chthonoplastes PCC 7420]
          Length = 401

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 162/387 (41%), Positives = 243/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+R D NVP  + G + D TRI   +PTI +L++K AKVV+ SHLGRP+ +  
Sbjct: 13  DLAGKRVLVRADLNVPLDENGTITDDTRIRAALPTIQDLIKKNAKVVMCSHLGRPKGQVK 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L + ++  +DCIG  +   I SL  G + L EN+RF+  EE+NDP
Sbjct: 73  DSLRLTPVANRLSELLGQTVVKCDDCIGDAVKSQIDSLDNGQVALLENLRFHPGEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSH-LLPSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL  L++     + 
Sbjct: 133 EFTKKLAALADVYVNDAFGTAHRAHASTEGVTHHLQPSVAGYLIEKELQYLQNAIENPQN 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L+ KVDKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIIGGSKVSSKIGVIETLLDKVDKLLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK    ++++P DVVVA        +Q VS +S+P   + LD+G  +V++ +  +
Sbjct: 253 SLEAKAKEKGVDLLLPTDVVVADNFAADANSQTVSVESIPDGWMGLDIGPDSVKFFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              ++V+WNGP+GVFE + F   T  +A  +A LTK +   +I GGGD++ A+   G+++
Sbjct: 313 GDCKSVIWNGPMGVFEFDKFAAGTEAIARTLADLTK-KGTTTIIGGGDSVAAVEKVGVAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 QMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|304569549|ref|NP_441843.2| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
          Length = 400

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 165/386 (42%), Positives = 238/386 (61%), Gaps = 2/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  +RVD+NVP  +G + D TRI   +PTI +L+ K AKV++ SH GRP+ K   
Sbjct: 13  DLAGKRVFVRVDFNVPLDNGSITDDTRIRAALPTIKDLLSKGAKVILGSHFGRPKGKVVD 72

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V      +L + ++  +DCIG+ ++  IASL  GG+ L EN+RF++ EE ND +
Sbjct: 73  SMRLTPVGDRLGELLGQPVVKCDDCIGAEVTAKIASLPNGGVALLENLRFHAGEEGNDAE 132

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKKP 190
           F + L+ N D Y+NDAF  +HRAHAS  G++H L P+  G  ++KEL  L+      K+P
Sbjct: 133 FAKALAANADLYVNDAFGTAHRAHASTEGVTHFLSPNVAGYLIEKELQFLQGAIEAPKRP 192

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           LVAIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+  G+SL + D  D    
Sbjct: 193 LVAIVGGSKVSSKIGVIETLLDKCDKLIIGGGMIFTFYKAQGLNTGKSLVEEDKLDLAKS 252

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    E ++P DVVVA         Q V   ++P   + LD+G  +V+  +  +A
Sbjct: 253 LMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDIGPDSVKTFQDALA 312

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
              TV+WNGP+GVFE + F   T  +A  +A+LT     ++I GGGD++ A+   G++ +
Sbjct: 313 GCGTVIWNGPMGVFEFDKFAVGTEAIACSLAELTAS-GTVTIIGGGDSVAAVEKVGVAEK 371

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPGI AL
Sbjct: 372 MSHISTGGGASLELLEGKVLPGIAAL 397


>gi|256820152|ref|YP_003141431.1| phosphoglycerate kinase [Capnocytophaga ochracea DSM 7271]
 gi|256581735|gb|ACU92870.1| Phosphoglycerate kinase [Capnocytophaga ochracea DSM 7271]
          Length = 396

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 167/397 (42%), Positives = 252/397 (63%), Gaps = 5/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+++  +  G + L+RVD+NVP  +  KV D TRIE   PTI ++++     V+ SHL
Sbjct: 1   MKTIDNF-NFAGKKALIRVDFNVPLDENFKVTDNTRIEAAKPTIEKILKDGGTAVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ + +   SL  +VS  E +L K ++FV+DC+G    +++A+   G ++L EN+RF+
Sbjct: 60  GRPKGERNDKYSLRHIVSEVEKVLGKKVIFVDDCVGEVAEKAVAAAPAGSVVLLENLRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
            EEE+ D  F + L++ GD Y+NDAF  +HRAHAS T ++   P+    G  + KE+  +
Sbjct: 120 KEEEKGDEAFSKQLAKLGDIYVNDAFGTAHRAHASTTIVAKFFPNQKCFGYLLAKEIESI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E      +KP+ AI+GGSKVS+KIT++ N++ KV+ L+IGGGMA +F+ AQG  VG S+C
Sbjct: 180 EKVMKTGEKPVTAILGGSKVSSKITIIENILDKVNHLIIGGGMAYTFIKAQGGKVGSSIC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK    E+ +P DVV A        TQVV   ++P     LD G K
Sbjct: 240 EDDKLDLALDILAKAKAKGVEVHLPIDVVAADAFDNNAKTQVVPVNAIPDGWEGLDAGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E IK V+ +++T++WNGP+GVFE+  F + T+ V  YVA+ TK +   S+ GGGD++ 
Sbjct: 300 TLENIKSVLLKSKTILWNGPIGVFEMPNFAKGTIAVGDYVAEATK-KGAFSLVGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  ++ +YVST GGA LE LEG  LPGI A++
Sbjct: 359 AVKQFGFEHKVSYVSTGGGAMLESLEGLVLPGIAAIN 395


>gi|218438562|ref|YP_002376891.1| phosphoglycerate kinase [Cyanothece sp. PCC 7424]
 gi|226699798|sp|B7K9Q5|PGK_CYAP7 RecName: Full=Phosphoglycerate kinase
 gi|218171290|gb|ACK70023.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7424]
          Length = 401

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 247/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ SH GRP+ K  
Sbjct: 13  DVEGKRVLVRVDFNVPLDDAGNITDDTRIRAALPTIQDLISKGAKVILCSHFGRPKGKVV 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L         +L ++++  +DC+G+++++++  L  G + L EN+RF++EEE NDP
Sbjct: 73  ESMRLTPTAKRLSELLGQDVVMCDDCVGASVTEAVNKLENGQVALLENLRFHAEEEGNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL+ L+S     ++
Sbjct: 133 EFSKQLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKELNYLQSAIENPQR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIIGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +A     ++++P DVVVA         + V  + +P   + LD+G  +V+  +  +
Sbjct: 253 SLEAKASEKGVQLLLPTDVVVADAFDANANDKTVKIEEIPDGWMGLDIGPDSVKLFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  ++V+WNGP+GVFE + F + T  +A+ +  LT  +   +I GGGD++ A+   G+++
Sbjct: 313 ADCKSVIWNGPMGVFEFDKFAKGTEAIAYTLETLTG-KGATTIIGGGDSVAAVEKVGVAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|239618381|ref|YP_002941703.1| Phosphoglycerate kinase [Kosmotoga olearia TBF 19.5.1]
 gi|239507212|gb|ACR80699.1| Phosphoglycerate kinase [Kosmotoga olearia TBF 19.5.1]
          Length = 405

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 169/401 (42%), Positives = 254/401 (63%), Gaps = 9/401 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID---GKVADVTRIERVVPTILELVEKKAKVV 57
           M +  T+ D+ D++  + LLRVD+NVP ID   G+VAD TRI+  +PTI  ++E   K +
Sbjct: 1   MLKKLTVKDV-DLKDKKVLLRVDFNVP-IDKETGEVADDTRIKAALPTIKYVLENGGKAI 58

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   SL  V    E +L + + FV+DCIG    + I ++ EG ++L E
Sbjct: 59  LVSHLGRPKGKKDPKYSLKPVAKRLEQLLGRTVSFVDDCIGEGAKKVIEAMKEGEVVLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRFY EE++NDP+F   L+   D ++NDAF  +HRAHAS  G++  L S  G  M+KE+
Sbjct: 119 NVRFYPEEKKNDPEFAEKLASLADIHVNDAFGTAHRAHASNVGVAQYLTSVAGFLMEKEI 178

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
           +ML    +  + P V I+GG+KVS KI ++ NL+KK D+++IGG M  +FL A G  VG 
Sbjct: 179 AMLGKAVANPEHPYVVILGGAKVSDKIGVITNLLKKADRILIGGAMMFTFLKALGKQVGD 238

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILD 296
           SL + D  +   +I  EA +   E ++P D V+A+E++ G  ++VV     +P     LD
Sbjct: 239 SLVEEDKLELAKEIMEEASKRGVEFVLPIDTVIAKEIEAGAESKVVRIDDGIPEGWKGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G +T+E  K  +  A+TV+WNGP+GVFEI+ F + T E+A  +A+L       +I GGG
Sbjct: 299 IGPETIELFKSKLKGAKTVVWNGPMGVFEIDDFAKGTEEIAKALAEL---EDATTIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+  A+    ++++ ++VST GGA LE LEGK+LPGI +++
Sbjct: 356 DSAAAINKFNLADKVSHVSTGGGASLEMLEGKELPGIASIA 396


>gi|218249895|ref|YP_002374587.1| phosphoglycerate kinase [Borrelia burgdorferi ZS7]
 gi|225549763|ref|ZP_03770728.1| phosphoglycerate kinase [Borrelia burgdorferi 118a]
 gi|226322032|ref|ZP_03797557.1| phosphoglycerate kinase [Borrelia burgdorferi Bol26]
 gi|226699794|sp|B7J0Z2|PGK_BORBZ RecName: Full=Phosphoglycerate kinase
 gi|218165083|gb|ACK75144.1| phosphoglycerate kinase [Borrelia burgdorferi ZS7]
 gi|225369723|gb|EEG99171.1| phosphoglycerate kinase [Borrelia burgdorferi 118a]
 gi|226232622|gb|EEH31376.1| phosphoglycerate kinase [Borrelia burgdorferi Bol26]
          Length = 393

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 253/394 (64%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNSKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + +++ ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYINSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|158333828|ref|YP_001515000.1| phosphoglycerate kinase [Acaryochloris marina MBIC11017]
 gi|189036805|sp|B0CD95|PGK_ACAM1 RecName: Full=Phosphoglycerate kinase
 gi|158304069|gb|ABW25686.1| phosphoglycerate kinase [Acaryochloris marina MBIC11017]
          Length = 401

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 166/387 (42%), Positives = 241/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+R D+NVP   DGK+ D TRI   +PTI +L  K AKV++ SH GRP+ + +
Sbjct: 13  DLSGKRVLVRADFNVPLDGDGKITDDTRIRAALPTIQDLTSKGAKVILASHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L + +   +DCIG  ++  + +L  G + L ENVRF+S EE NDP
Sbjct: 73  ESMRLTPVAARLSELLGQAVTKCDDCIGDEVAAKVGALQNGQVALLENVRFHSGEEANDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSH-LLPSYIGRAMQKELSMLESCFSESKK 189
           +F R L+   D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL  L++     ++
Sbjct: 133 EFARQLASVADLYVNDAFGTAHRAHASTEGVTHHLSPSVAGYLIEKELKYLQAAIEGPQR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI ++  L+ KVDKL+IGGGM  +F  A+G+ VG+SL + D  D   
Sbjct: 193 PLAAIVGGSKVSSKIGVIETLLDKVDKLLIGGGMIFTFYKARGLAVGKSLVEEDKLDLAR 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVVVA         Q VS  ++P   + LD+G  +V+  +  +
Sbjct: 253 TLEAKAKEKGVALLLPSDVVVADNFAADANAQTVSINNIPDGWMGLDIGPNSVKEFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           +  +TV+WNGP+GVFE + F   T  VAH +A +T E    +I GGGD++ A+   G++ 
Sbjct: 313 SDCKTVIWNGPMGVFEFDKFAAGTDAVAHSLAAIT-ETGADTIIGGGDSVAAVEKVGVAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|2499503|sp|P74421|PGK_SYNY3 RecName: Full=Phosphoglycerate kinase
          Length = 401

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 165/386 (42%), Positives = 238/386 (61%), Gaps = 2/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  +RVD+NVP  +G + D TRI   +PTI +L+ K AKV++ SH GRP+ K   
Sbjct: 14  DLAGKRVFVRVDFNVPLDNGSITDDTRIRAALPTIKDLLSKGAKVILGSHFGRPKGKVVD 73

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V      +L + ++  +DCIG+ ++  IASL  GG+ L EN+RF++ EE ND +
Sbjct: 74  SMRLTPVGDRLGELLGQPVVKCDDCIGAEVTAKIASLPNGGVALLENLRFHAGEEGNDAE 133

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKKP 190
           F + L+ N D Y+NDAF  +HRAHAS  G++H L P+  G  ++KEL  L+      K+P
Sbjct: 134 FAKALAANADLYVNDAFGTAHRAHASTEGVTHFLSPNVAGYLIEKELQFLQGAIEAPKRP 193

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           LVAIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+  G+SL + D  D    
Sbjct: 194 LVAIVGGSKVSSKIGVIETLLDKCDKLIIGGGMIFTFYKAQGLNTGKSLVEEDKLDLAKS 253

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    E ++P DVVVA         Q V   ++P   + LD+G  +V+  +  +A
Sbjct: 254 LMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDIGPDSVKTFQDALA 313

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
              TV+WNGP+GVFE + F   T  +A  +A+LT     ++I GGGD++ A+   G++ +
Sbjct: 314 GCGTVIWNGPMGVFEFDKFAVGTEAIACSLAELTAS-GTVTIIGGGDSVAAVEKVGVAEK 372

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPGI AL
Sbjct: 373 MSHISTGGGASLELLEGKVLPGIAAL 398


>gi|332591479|emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
          Length = 507

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 165/396 (41%), Positives = 254/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           R++ DL+  D++G +  +R D NVP  + + + D TRI   VPTI  L+   AKV++ SH
Sbjct: 106 RSVGDLKESDLKGKKVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTSH 165

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L  N++  +DCIG+ + +++ASL  GG++L ENVRF
Sbjct: 166 LGRPKGVTPK-YSLKPLVPRLTELLGVNVVKADDCIGAEVEKAVASLPNGGVLLLENVRF 224

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSML 180
           Y EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L P+  G  +QKEL  L
Sbjct: 225 YKEEEKNDPEFAKKLASIADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLLQKELDYL 284

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  KKP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG+ VG SL 
Sbjct: 285 VGAVSNPKKPFAAIVGGSKVSSKIGVIESLLEKVDILLLGGGMIFTFYKAQGLKVGSSLV 344

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      ++VV A  +P   + LD+G  
Sbjct: 345 EDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGAD 404

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + +I+I GGGD++ 
Sbjct: 405 SIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESIAKKLAELSG-KGVITIIGGGDSVA 463

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 464 AVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLAL 499


>gi|328953654|ref|YP_004370988.1| Phosphoglycerate kinase [Desulfobacca acetoxidans DSM 11109]
 gi|328453978|gb|AEB09807.1| Phosphoglycerate kinase [Desulfobacca acetoxidans DSM 11109]
          Length = 399

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 169/395 (42%), Positives = 240/395 (60%), Gaps = 8/395 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ + D+ DIR     +RVD+NVP    + + D TRI  V+PTI   +++ A+V++ SHL
Sbjct: 1   MKYLQDV-DIREKTVFIRVDFNVPLDRNRNITDDTRIRAVLPTINHCLDEHARVILASHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   D + SL  V      ++HK + FV DCIG  + +    +  G ++L EN+RFY
Sbjct: 60  GRPKG-PDPNKSLEPVSRRLSRLIHKTVEFVPDCIGPEVQKIKQKMQPGDVLLLENLRFY 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSMLE 181
            EEE+ND DF R L    D YINDAF+V HRAHAS+  ++   P    G  ++ E+    
Sbjct: 119 PEEEKNDQDFARQLMEGVDVYINDAFAVGHRAHASVHAVTLFAPICAAGFLLRDEILYFH 178

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               +  +PLVAI+GG+K+S+K+T LINL+K VDKL+IGG MAN+F+ A G  VG+SL  
Sbjct: 179 KSMEDPARPLVAIIGGAKISSKLTALINLLKHVDKLIIGGAMANTFIKAMGYQVGKSLVD 238

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D   ++   A +   +  +P DV+VA  +      +V + Q VP D II D+G  +
Sbjct: 239 DSLLDEAKELMSTALQKGVKFYLPVDVIVADSLDNRAENRVTTIQEVPADWIIADIGPAS 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +    + +  ARTV+WNGP+G FEIE F R T+ + H VA        ++I GGGDT  A
Sbjct: 299 ITLFNEALQDARTVVWNGPMGAFEIEAFSRGTLAMVHNVAN----SFALTIVGGGDTDVA 354

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG  N+F+Y+ST GGAFLE LEGK LPGI+AL
Sbjct: 355 IHKAGEVNKFSYISTGGGAFLELLEGKKLPGILAL 389


>gi|224533955|ref|ZP_03674540.1| phosphoglycerate kinase [Borrelia burgdorferi CA-11.2a]
 gi|224512958|gb|EEF83324.1| phosphoglycerate kinase [Borrelia burgdorferi CA-11.2a]
          Length = 393

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 161/394 (40%), Positives = 252/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + V + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYVDSFNIPENKIGMDIGVNTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|221217503|ref|ZP_03588974.1| phosphoglycerate kinase [Borrelia burgdorferi 72a]
 gi|221192781|gb|EEE18997.1| phosphoglycerate kinase [Borrelia burgdorferi 72a]
          Length = 393

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 253/394 (64%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + +++ ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYINSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|326336012|ref|ZP_08202188.1| phosphoglycerate kinase [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691809|gb|EGD33772.1| phosphoglycerate kinase [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 395

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 169/397 (42%), Positives = 242/397 (60%), Gaps = 6/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND+   +G R L+RVD+NVP  +  ++ D TRIE   PTIL++V      ++ SH 
Sbjct: 1   MKTINDIS-CKGKRVLVRVDFNVPVNEQYEITDTTRIEAAKPTILKIVNDGGSAILLSHF 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K DK      V  I E +L     F  DCIG     +  +L  G ++L ENVRF+
Sbjct: 60  GRPKGKDDKYSFAHLVKQIGE-VLGVPTHFCPDCIGEVAENTAKNLPAGQVLLLENVRFH 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS--YIGRAMQKELSML 180
            EEE+ D  F   L++ GD Y+NDAF  +HRAHAS T L+   P   Y G  + KE+  +
Sbjct: 119 PEEEKGDEAFAAKLAKLGDVYVNDAFGTAHRAHASTTVLAKFFPKDKYFGYLLAKEIESI 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E      ++P+ AI+GGSKVS+KIT++ N++ K+D L+IGGGMA +F+ AQG  +G S+C
Sbjct: 179 EKVMKTGERPVTAILGGSKVSSKITIIENILDKIDHLIIGGGMAFTFIKAQGGQIGNSIC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK    ++ +P DVV A +      TQVV+   +P     LD G K
Sbjct: 239 EDDKLDLALDILKKAKEKGVQVHLPVDVVAANDFNNNASTQVVAIDQIPNGWQGLDAGEK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++E  K+VI  +RT++WNGP+GVFE+  F + T+ V  YVA+ T  +   S+ GGGD++ 
Sbjct: 299 SLENFKKVILASRTILWNGPVGVFEMPRFAKGTIAVGEYVAEATA-KGAFSLVGGGDSVA 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  N+ +YVST GGA LE LEGK LPGI A++
Sbjct: 358 AVKQFGFENKVSYVSTGGGAMLESLEGKILPGIRAIN 394


>gi|116327981|ref|YP_797701.1| phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|122284227|sp|Q052H7|PGK_LEPBL RecName: Full=Phosphoglycerate kinase
 gi|116120725|gb|ABJ78768.1| Phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 396

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 157/385 (40%), Positives = 246/385 (63%), Gaps = 4/385 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  LRVD+NVP  +GKV D TRIE+ +PTI  L++K A+++I SHLGRP+ +++ 
Sbjct: 10  DLSGKRVFLRVDFNVPIENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQTNP 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  VV + + ++  N+ F    IG    +    L +G I++ ENVRF+ EEE N+P 
Sbjct: 70  EFSLAPVVEVFKGLVKSNVYFSKTVIGDEPIKLSKELRDGEILVIENVRFHKEEEENEPG 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + L+   D Y+NDAF  +HRAHAS  G++HLLP+Y G  M KE+  L +  ++  +P 
Sbjct: 130 FSKKLAALADVYVNDAFGAAHRAHASTEGIAHLLPAYAGLLMHKEIVELSALLAKPARPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GGSKVS+KI +L NL  KV+ L+IGGGMA +FL ++ + VG SL ++DF     Q+
Sbjct: 190 VAIIGGSKVSSKIKVLNNLFDKVNHLLIGGGMAYTFLKSRAVPVGNSLVEKDFEVQAFQL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A  +  ++ +P D ++  +      T+ V    +    + +D+G KTV   +++I  
Sbjct: 250 IEKAGVAGVDLQLPVDHIIGDQFNEKAKTKSVDKMGILDGWMGMDIGSKTVSNYEKIIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A T+ WNGP+GVFE++ F   T+ +A  ++K     +  ++ GGGD+I A+  A ++++ 
Sbjct: 310 AGTIFWNGPMGVFEMDKFTGGTMAIAKAISK----SKAKTVVGGGDSIAAINKAKVADKI 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T++ST GGA LE++EG+ LPG+ AL
Sbjct: 366 THISTGGGASLEFMEGRKLPGVEAL 390


>gi|213964317|ref|ZP_03392542.1| phosphoglycerate kinase [Capnocytophaga sputigena Capno]
 gi|213953040|gb|EEB64397.1| phosphoglycerate kinase [Capnocytophaga sputigena Capno]
          Length = 396

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 167/397 (42%), Positives = 252/397 (63%), Gaps = 5/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+++  +  G + L+RVD+NVP  +  KV D TRIE   PTI ++++     V+ SHL
Sbjct: 1   MKTIDNF-NFAGKKALIRVDFNVPLDENFKVTDNTRIEAAKPTIEKILKDGGTAVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ + +   SL  +VS  E +L K ++FV+DC+G    +++A+   G ++L EN+R++
Sbjct: 60  GRPKGERNDKYSLRHIVSEVEKVLGKKVIFVDDCVGEVAEKAVAAAPAGSVVLLENLRYH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
           +EEE+ D +F + L++ GD Y+NDAF  +HRAHAS T ++   P+    G  + KE+  +
Sbjct: 120 NEEEKGDENFSKQLAKLGDIYVNDAFGTAHRAHASTTIVAKFFPNNKCFGYLLAKEIESI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP+ AI+GGSKVS+KIT++ N++ KV+ L+IGGGMA +F  AQG  VG S+C
Sbjct: 180 DKVMRTGEKPVTAILGGSKVSSKITIIENILDKVNHLIIGGGMAYTFAKAQGGKVGNSIC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK    E+ +P DVV A        TQVV   +VP     LD G K
Sbjct: 240 EDDKLDLALDILAKAKAKGVEVHLPIDVVAADAFDNNAKTQVVPVNAVPDGWEGLDAGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E IK V+  ++T++WNGP+GVFE+  F + T+ V  YVA+ TK +   S+ GGGD++ 
Sbjct: 300 TLENIKSVLLASKTILWNGPVGVFEMPNFAKGTIAVGDYVAEATK-KGAFSLVGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  N+ +YVST GGA LE LEG  LPGI A++
Sbjct: 359 AVKQFGFENKVSYVSTGGGAMLESLEGLVLPGIAAIN 395


>gi|172039132|ref|YP_001805633.1| phosphoglycerate kinase [Cyanothece sp. ATCC 51142]
 gi|171700586|gb|ACB53567.1| phosphoglycerate kinase [Cyanothece sp. ATCC 51142]
          Length = 409

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 250/386 (64%), Gaps = 2/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R L+RVD+NVP  +G + D TRI   +PTI EL+   AKV++ SH+GRP+ +  +
Sbjct: 22  DLAGKRVLVRVDFNVPLDNGTITDDTRIRAALPTIKELITNGAKVILCSHMGRPKGQVVE 81

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
             SL  V +    +L ++++  +DC+G +++ +IA+L  G + L EN+RF++EEE NDP+
Sbjct: 82  SMSLSPVATRLSELLGQDVIMCDDCVGDSVTAAIANLENGQVALLENLRFHAEEEANDPE 141

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKKP 190
           F + L+ N D Y+NDAF  +HRAHAS  G++ HL PS  G  ++KEL  L++     ++P
Sbjct: 142 FAKQLAANADLYVNDAFGTAHRAHASTEGVTHHLSPSVAGYLIEKELQYLQAAIENPQRP 201

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L AI+GGSKVS+KI ++  L+ K DKL+IGGGM  +F  A+G+ VG+SL + D  +    
Sbjct: 202 LAAIIGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKARGLNVGKSLVEEDKLELAKS 261

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    E+++P DVV+A        +++ S +S+    + LD+G  +VE  K+ +A
Sbjct: 262 LEAKAKEKGVELLLPTDVVLADNFAKDANSKISSVESIEDGWMGLDIGPDSVEVFKKALA 321

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             + V+WNGP+GVFE E F + T  +A+ +A+LT       I  GGD++ A+   G++++
Sbjct: 322 DCKAVIWNGPMGVFEFEKFAKGTEAIANTLAELTGTGTTTIIG-GGDSVAAVEKVGVADK 380

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPGI AL
Sbjct: 381 MSHISTGGGASLELLEGKTLPGIAAL 406


>gi|219124224|ref|XP_002182409.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217406370|gb|EEC46310.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 441

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 165/395 (41%), Positives = 244/395 (61%), Gaps = 3/395 (0%)

Query: 6   TMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ DL D  ++G + L+R D NVP    K+ D TRI   +PTI  L  K A V + SHLG
Sbjct: 45  SIEDLSDAELKGKKVLVRCDVNVPLDGKKITDDTRIRSSIPTIEYLKNKGAIVSVCSHLG 104

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL         +L + +    DCIG  +++ +    EG +I+ EN RFY 
Sbjct: 105 RPKDGPEDKFSLGPCAERMGELLGQTVTLAPDCIGEEVAKIVNDAKEGDVIMLENTRFYK 164

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLES 182
           EE +NDP+FV  L+   D Y+NDAF  +HRAHAS  G++  L PS  G  + KEL  L+ 
Sbjct: 165 EETKNDPEFVEKLAAPFDLYVNDAFGTAHRAHASTEGVTKFLKPSVGGFLLAKELEYLDG 224

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S  KKP+ AIVGGSKVS+KIT+L  L+ K DK++IGGGM  +FL A+G  VG SL + 
Sbjct: 225 AISNGKKPMAAIVGGSKVSSKITVLEALLDKCDKVIIGGGMVFTFLKAKGFNVGTSLVED 284

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           DF D   ++  +A++   EI++P D+V+A +      T+VVSA+ +P   + LD G +T 
Sbjct: 285 DFVDTAKEVLAKAEKLGKEILLPIDIVIADKFDAEAETKVVSAEEIPDGWMGLDNGPETT 344

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              K+ ++  +T++ NGP+GVFE E F + T ++ + +A L+K++  I+I GGGD++ A 
Sbjct: 345 AQQKEALSDCKTIIMNGPMGVFEFEKFAKGTFDLVNILADLSKDKGAITIIGGGDSVAAT 404

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             +G + + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 405 EQSGRAGDMSHISTGGGASLELLEGKVLPGVAALN 439


>gi|294501762|ref|YP_003565462.1| phosphoglycerate kinase [Bacillus megaterium QM B1551]
 gi|295707112|ref|YP_003600187.1| phosphoglycerate kinase [Bacillus megaterium DSM 319]
 gi|129918|sp|P24269|PGK_BACMD RecName: Full=Phosphoglycerate kinase
 gi|39643|emb|CAA38375.1| unnamed protein product [Bacillus megaterium DSM 319]
 gi|143318|gb|AAA73203.1| phosphoglycerate kinase [Bacillus megaterium]
 gi|294351699|gb|ADE72028.1| phosphoglycerate kinase [Bacillus megaterium QM B1551]
 gi|294804771|gb|ADF41837.1| phosphoglycerate kinase [Bacillus megaterium DSM 319]
          Length = 394

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 246/393 (62%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R   RVD+NVP  DGKV D TRI   +PTI  LVE+ AKV++ SHLGR
Sbjct: 4   KTLKDI-DVKGKRVFCRVDFNVPMKDGKVTDETRIRAAIPTIQYLVEQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +  ++  L  V    +++L K++   ++  G  + ++I  +SEG +++ ENVRFY  
Sbjct: 63  PKGEVVEELRLNAVAERLQALLGKDVAKADEAFGEEVKKTIDGMSEGDVLVLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAQHIPAVAGFLMEKELDVLSKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P  AIVGG+KV  KI ++ +L+ KVD L+IGGG++ +F+ A G  VG+SL + D 
Sbjct: 183 SNPERPFTAIVGGAKVKDKIGVIDHLLDKVDNLIIGGGLSYTFIKALGHEVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK++     +P DVVVA +       QVVS + +P D   LD G KT E 
Sbjct: 243 IELAKSFMEKAKKNGVNFYMPVDVVVADDFSNDANIQVVSIEDIPSDWEGLDAGPKTREI 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
              VI  ++ V+WNGP+GVFE++ F   T  VA  +A+ T    +I   GGGD+  A+  
Sbjct: 303 YADVIKNSKLVIWNGPMGVFELDAFANGTKAVAEALAEATDTYSVI---GGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             ++++ +++ST GGA LE++EGK+LPG+VAL+
Sbjct: 360 FNLADKMSHISTGGGASLEFMEGKELPGVVALN 392


>gi|7288201|gb|AAF45020.1|AF108451_1 phosphoglycerate kinase precursor [Phaeodactylum tricornutum]
          Length = 441

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 165/395 (41%), Positives = 244/395 (61%), Gaps = 3/395 (0%)

Query: 6   TMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ DL D  ++G + L+R D NVP    K+ D TRI   +PTI  L  K A V + SHLG
Sbjct: 45  SIEDLSDAELKGKKVLVRCDVNVPLDGKKITDDTRIRSSIPTIEYLKNKGAIVSVCSHLG 104

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL         +L + +    DCIG  +++ +    EG +I+ EN RFY 
Sbjct: 105 RPKDGPEDKFSLGPCAERMGELLGQTVTLAPDCIGEEVAKIVNDAKEGDVIMLENTRFYK 164

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLES 182
           EE +NDP+FV  L+   D Y+NDAF  +HRAHAS  G++  L PS  G  + KEL  L+ 
Sbjct: 165 EETKNDPEFVEKLAAPFDLYVNDAFGTAHRAHASTEGVTKFLKPSVGGFLLAKELEYLDG 224

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S  KKP+ AIVGGSKVS+KIT+L  L+ K DK++IGGGM  +FL A+G  VG SL + 
Sbjct: 225 AISNGKKPMAAIVGGSKVSSKITVLEALLDKCDKVIIGGGMVFTFLKAKGFNVGTSLVED 284

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           DF D   ++  +A++   EI++P D+V+A +      T+VVSA+ +P   + LD G +T 
Sbjct: 285 DFVDTAKEVLAKAEKLGKEILLPIDIVIADKFDAEAETKVVSAEEIPDGWMGLDNGPETT 344

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              K+ ++  +T++ NGP+GVFE E F + T ++ + +A L+K++  I+I GGGD++ A 
Sbjct: 345 AQQKEALSDCKTIIMNGPMGVFEFEKFAKGTFDLVNILADLSKDKGAITIIGGGDSVAAT 404

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             +G + + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 405 EQSGRAGDMSHISTGGGASLELLEGKVLPGVAALN 439


>gi|282882178|ref|ZP_06290817.1| phosphoglycerate kinase [Peptoniphilus lacrimalis 315-B]
 gi|281297943|gb|EFA90400.1| phosphoglycerate kinase [Peptoniphilus lacrimalis 315-B]
          Length = 397

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 163/395 (41%), Positives = 245/395 (62%), Gaps = 7/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ + D  +  G   L+RVD+NVP  DGKV    RI++ +PTI  + E+  K+++ SHLG
Sbjct: 2   IKKLEDF-NFNGKTVLVRVDFNVPIKDGKVKGDDRIKKSLPTIKYIKEQGGKIILMSHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRF 121
           RP+ K +KD SL  V      IL ++ILF+++   +   +   + +L    I L EN+RF
Sbjct: 61  RPKGKYNKDLSLRPVAQRLSEILGEDILFIDEKEVVNKEVKDKVKNLKNAEIALLENLRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EEE+N+  F + L+   D Y+NDAF  +HRAHAS  G+S  LPS  G  ++KE+  L+
Sbjct: 121 RPEEEKNEESFSKDLASLADIYVNDAFGTAHRAHASNVGVSKFLPSAAGFLLEKEIKYLK 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 K+P VAI+GG+KVS KI L+ NL+ K+D +VI G MAN+F+ + G  VG+SL +
Sbjct: 181 ESLENPKRPFVAILGGAKVSDKINLIKNLLDKIDSIVIVGAMANTFIKSMGKEVGKSLVE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   QI  +A +    +I+P D + ARE+      QVV A S+  D ++LD+G  +
Sbjct: 241 DDKLDLARQIIDQASKKGVNLILPEDFIEAREISDDAKGQVVDASSIDKDKMVLDIGPNS 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ IK V+  ART++WNGP GVFE++ F + TV +A  +A    +   ++I GGGD++ A
Sbjct: 301 LKKIKMVLKDARTIVWNGPAGVFEVDEFSKGTVGIAKILA----DSDALTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG+ ++ +++ST GGA LE LEGK LP I AL
Sbjct: 357 VEKAGVEDKISHISTGGGASLELLEGKVLPAIKAL 391


>gi|116330861|ref|YP_800579.1| phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122281385|sp|Q04TE9|PGK_LEPBJ RecName: Full=Phosphoglycerate kinase
 gi|116124550|gb|ABJ75821.1| Phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 396

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 157/385 (40%), Positives = 246/385 (63%), Gaps = 4/385 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  LRVD+NVP  +GKV D TRIE+ +PTI  L++K A+++I SHLGRP+ +++ 
Sbjct: 10  DLSGKRVFLRVDFNVPIENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQTNP 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  VV + + ++  N+ F    IG    +    L +G I++ ENVRF+ EEE N+P 
Sbjct: 70  EFSLAPVVEVFKGLVKSNVYFSKTVIGDEPIKLSKELRDGEILVIENVRFHKEEEENEPG 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + L+   D Y+NDAF  +HRAHAS  G++HLLP+Y G  M KE+  L +  ++  +P 
Sbjct: 130 FSKKLAALADVYVNDAFGAAHRAHASTEGIAHLLPAYAGLLMHKEIVELSALLAKPARPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GGSKVS+KI +L NL  KV+ L+IGGGMA +FL ++ + VG SL ++DF     Q+
Sbjct: 190 VAIIGGSKVSSKIKVLNNLFDKVNHLLIGGGMAYTFLKSRAVPVGNSLVEKDFEVQAFQL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A  +  ++ +P D ++  +      T+ V    +    + +D+G KTV   +++I  
Sbjct: 250 IEKAGVAGVDLQLPVDHIIGDQFNEKAKTKSVDKMGILDGWMGMDIGSKTVSNYEKIIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A T+ WNGP+GVFE++ F   T+ +A  ++K     +  ++ GGGD+I A+  A ++++ 
Sbjct: 310 AGTIFWNGPMGVFEMDKFAGGTMAIAKAISK----SKAKTVVGGGDSIAAINKAKVADKI 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T++ST GGA LE++EG+ LPG+ AL
Sbjct: 366 THISTGGGASLEFMEGRKLPGVEAL 390


>gi|223889216|ref|ZP_03623805.1| phosphoglycerate kinase [Borrelia burgdorferi 64b]
 gi|224533043|ref|ZP_03673649.1| phosphoglycerate kinase [Borrelia burgdorferi WI91-23]
 gi|223885465|gb|EEF56566.1| phosphoglycerate kinase [Borrelia burgdorferi 64b]
 gi|224512037|gb|EEF82432.1| phosphoglycerate kinase [Borrelia burgdorferi WI91-23]
          Length = 393

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 252/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + + + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYIDSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|189501440|ref|YP_001960910.1| phosphoglycerate kinase [Chlorobium phaeobacteroides BS1]
 gi|238692299|sp|B3EQD1|PGK_CHLPB RecName: Full=Phosphoglycerate kinase
 gi|189496881|gb|ACE05429.1| Phosphoglycerate kinase [Chlorobium phaeobacteroides BS1]
          Length = 397

 Score =  318 bits (815), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 163/392 (41%), Positives = 244/392 (62%), Gaps = 5/392 (1%)

Query: 10  LRDI--RGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQ 66
           L DI  +G R L+RVD+NVP  +   + +  RI   +P+I +++E   ++++ SHLGRP+
Sbjct: 6   LYDISCKGSRVLMRVDFNVPLDEHAHITNDKRIIEALPSIHKIIEDGGRLILMSHLGRPK 65

Query: 67  SKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEE 126
            K   + SL  V      +L  +++   DCIG+   Q   +L +G I+L EN+RF+ EEE
Sbjct: 66  GKVVPELSLEPVAKRLSELLDTSVVMAGDCIGTEAMQQALALQDGEIMLLENLRFHPEEE 125

Query: 127 RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFS 185
           +NDP+F R L+  G+ Y+NDAF  +HRAHAS  G+ H + PS  G  ++KEL  L    +
Sbjct: 126 KNDPEFARELASMGEIYVNDAFGTAHRAHASTEGICHYVQPSVAGFLIEKELKYLGQALN 185

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             ++P VAI+GG+K+S KI +L NL  KVD ++IGG M  +F  AQG+ VG+SL + D  
Sbjct: 186 NPERPFVAILGGAKISGKIDVLENLFNKVDTVLIGGAMIFTFFKAQGLSVGKSLVEDDKV 245

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
           +    +   AK     +++P DV+ A E      T  V    +P + + LD+G KT++  
Sbjct: 246 ELARHLLQTAKERKINMLLPEDVIAASEFSGDAETMAVPVGGIPENMMGLDIGPKTIDTF 305

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
            + I  A+TV+WNGP+GVFEIEPF + T+ +A  +A  T  +  ISI GGGD+  A+  A
Sbjct: 306 SREILAAKTVVWNGPMGVFEIEPFAKGTIAIAQALADATA-KGTISIVGGGDSAAAVMKA 364

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           G+++  T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 365 GLASGITHISTGGGASLEFLEGKELPGITALN 396


>gi|203283982|ref|YP_002221722.1| phosphoglycerate kinase [Borrelia duttonii Ly]
 gi|226699795|sp|B5RKV5|PGK_BORDL RecName: Full=Phosphoglycerate kinase
 gi|201083425|gb|ACH93016.1| phosphoglycerate kinase [Borrelia duttonii Ly]
          Length = 392

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 247/393 (62%), Gaps = 5/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ D  D  G R L+R D+NVP  +G + D TRI+  +PTI  L  + A+VV+ SHLG
Sbjct: 3   IRTIKDC-DFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIEYLKSQGARVVLMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + +   SL  +      +L +N+  ++DCIG  +  +++ +  G ++L ENVRFY 
Sbjct: 62  RPKGEKNLRYSLMPIARRLSELLGQNVKMLSDCIGDEVVTAVSCMQNGDVVLLENVRFYK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE N   F   LS++GD ++NDAF  +HRAHAS +G++  LP+  G  M++E   L   
Sbjct: 122 EEEENSDAFAMQLSKSGDIFVNDAFGTAHRAHASTSGVASYLPAVGGFLMEREDEFLGKI 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL + +
Sbjct: 182 LKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGYSIGKSLLENE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK  + E+I+P D VVA E +     + V + ++P   I +D+G KT++
Sbjct: 242 YIDVASSFLKKAKELSVEVILPIDHVVASEFQEYSMPEYVDSVNIPDSKIGMDIGEKTLK 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I+ V++ A+TV+WNGPLGVFE + F + T +VA YVA        I++ GGGD++ A+ 
Sbjct: 302 KIEGVLSSAKTVIWNGPLGVFEFDSFAKGTAKVAEYVANCPG----ITVVGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S + T+VST GGA LE+LEGK LPGI  L
Sbjct: 358 KFNLSGKITHVSTGGGASLEYLEGKVLPGIKVL 390


>gi|225464999|ref|XP_002263950.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147843754|emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
          Length = 401

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 169/400 (42%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++ DL+  D++G R  +RVD NVP  +  K+ D TR+   VPTI  L+   AKV+
Sbjct: 1   MATKRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   +   NDCIG  +   +A + EGG++L E
Sbjct: 61  LASHLGRPKGVTPK-YSLKPLVPRLSELLGVEVKMANDCIGEEVKILVAKIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L+ KVD L++GGGM  +F  AQG GVG
Sbjct: 180 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLGKVDVLLLGGGMIFTFYKAQGYGVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASCIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE + F   T  +A  +A L+ E+ + +I GGG
Sbjct: 300 IGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAIAKKLADLS-EKGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLAL 398


>gi|282901400|ref|ZP_06309325.1| Phosphoglycerate kinase [Cylindrospermopsis raciborskii CS-505]
 gi|281193679|gb|EFA68651.1| Phosphoglycerate kinase [Cylindrospermopsis raciborskii CS-505]
          Length = 400

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 244/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           DI   R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV++ SH GRP+   D
Sbjct: 13  DISDKRALVRVDFNVPVDNQGNITDDTRIRAALPTIQDLISKGAKVILASHFGRPKG-VD 71

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V      +L + ++  +DCIG  ++  +A+L +G ++L ENVRFY EEE+NDP
Sbjct: 72  EKLRLTPVAKRLSELLGQEVIKTDDCIGDDVTTQVAALEKGQVLLLENVRFYKEEEKNDP 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
           +F R L+ N DFY+NDAF  +HRAHAS  G++ +L PS  G  ++KEL  L+      ++
Sbjct: 132 EFARQLAANADFYVNDAFGTAHRAHASTEGVTKYLSPSVAGYLVEKELQYLQGAIEVPQR 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PLVAI+GGSKVS+KIT++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D      
Sbjct: 192 PLVAIIGGSKVSSKITVIETLLEKCDKLIIGGGMIFTFYKARGLNVGKSLVEDDKLVLAS 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +A      +++P D+V A           VS   +P D + LD+G  +V+  +  +
Sbjct: 252 SLEKKAAERGVTLLLPTDIVAANTFAPDADAVTVSIDHIPDDRMGLDIGPDSVKVFQAAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A+++K     +I GGGD++ A+   G+++
Sbjct: 312 ADCKTVIWNGPMGVFEFDKFAVGTEAIAQTLAEISK-NGATTIIGGGDSVAAVEKVGLAD 370

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 371 QMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|226320772|ref|ZP_03796328.1| phosphoglycerate kinase [Borrelia burgdorferi 29805]
 gi|226233827|gb|EEH32552.1| phosphoglycerate kinase [Borrelia burgdorferi 29805]
          Length = 393

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 252/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVNMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + +++ ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYINSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I+ V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIENVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|91762280|ref|ZP_01264245.1| phosphoglycerate kinase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718082|gb|EAS84732.1| phosphoglycerate kinase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 392

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 156/394 (39%), Positives = 248/394 (62%), Gaps = 2/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +R + D  ++   + LLR+D NVP  +GK+ D TRI++++PTI  L++ +AK++I SH+G
Sbjct: 1   MRNIQDETNLNQKKVLLRLDLNVPLDNGKITDTTRIDKILPTINFLLKNEAKIIILSHVG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  +    ++ L++NI  ++  I    S  + +  +  I+  EN+RFY 
Sbjct: 61  RPKGKVVSELSLKPICEDLKNKLNENIRLISKNIKEINSNDLFNEQDEKIVTLENLRFYE 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAFS SHRAHASI  ++  +PSY G  +  E+  L   
Sbjct: 121 EEEKNDNGFAKHLASLADIYVNDAFSCSHRAHASIFEITKFIPSYAGLQLNLEIDALTKI 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            SE ++P+  I+GGSK+S+KI ++ NL+ K D +VI GGMAN+ L  +   +G+S+ + +
Sbjct: 181 TSEIQRPITCIIGGSKISSKINIIKNLITKFDNIVIVGGMANNILKYKECEIGKSIQEDN 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
               + +I   +K+  C+II P DV V + ++     ++    ++  D +ILD+G KT++
Sbjct: 241 CDKIIEEIFSLSKKENCKIIYPEDVAVGKSLEGS--AEIKELNNISKDELILDIGPKTIK 298

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I  +I ++ T++WNGP G FE   F + ++E+A  + +  K   I S+AGGGDT++ L 
Sbjct: 299 AINLLIEESSTILWNGPAGYFENPNFAKGSIEIAKKIIEKNKNNTIYSVAGGGDTVSLLN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G  N F +VSTAGGAFLE+LEGK+LPGI AL+
Sbjct: 359 GIGAINNFNFVSTAGGAFLEYLEGKELPGIKALN 392


>gi|305665793|ref|YP_003862080.1| phosphoglycerate kinase [Maribacter sp. HTCC2170]
 gi|88710559|gb|EAR02791.1| phosphoglycerate kinase [Maribacter sp. HTCC2170]
          Length = 397

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 243/397 (61%), Gaps = 7/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKVVIFSH 61
           + T++D  +    + L+RVD+NVP +DG+  V D  RIE   PTI++++E     V+ SH
Sbjct: 1   MMTIDDF-NFENKKALIRVDFNVP-LDGEFNVTDTNRIEAAKPTIIKVLEDGGSAVLMSH 58

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + ++D SL  +      I+   + FV DC+G  + +++A L EG ++L EN+RF
Sbjct: 59  LGRPKGQKNQDMSLKHICGKVSEIIGVQVKFVEDCVGEMVEKAVAELQEGEVLLLENLRF 118

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSM 179
           Y EE   D DF   LS+ GD Y+NDAF  +HRAHAS T ++         G  + KE+  
Sbjct: 119 YDEETSGDVDFAEKLSKLGDIYVNDAFGTAHRAHASTTIVAQFFSGQKCFGNLLAKEIKS 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +E      +KP++AI+GG+KVS+KIT++ N++ KVD L++GGGM  +F+ AQG  +G S+
Sbjct: 179 IEKVMRTGEKPVLAILGGAKVSSKITIIENILDKVDHLIVGGGMTYTFVKAQGGKIGDSI 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ D  D    I  +AK    ++ +P DV+ A +      TQVV    +P     LD G 
Sbjct: 239 CEDDKMDLAMSILAQAKEKGVQVHIPVDVLAANDFSNDADTQVVDVDKIPDGWQGLDAGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++  K+VI +++T++WNGP+GVFE+E F   T+ V  ++ + T +    S+ GGGD++
Sbjct: 299 KTLDIFKEVILKSKTILWNGPVGVFEMENFSNGTISVGDFIDEAT-QNGAFSLVGGGDSV 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G   + +YVST GGA LE LEGK LPGI A+
Sbjct: 358 AAVKQFGFQEKVSYVSTGGGAMLESLEGKTLPGIAAI 394


>gi|23099892|ref|NP_693358.1| phosphoglycerate kinase [Oceanobacillus iheyensis HTE831]
 gi|30172999|sp|Q8ENP3|PGK_OCEIH RecName: Full=Phosphoglycerate kinase
 gi|22778123|dbj|BAC14393.1| phosphoglycerate kinase [Oceanobacillus iheyensis HTE831]
          Length = 393

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 237/393 (60%), Gaps = 5/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+NDL+ + G R   RVD+NVP  DG++ D TRI   +PTI +L  + AKV++ SHLGR
Sbjct: 4   KTINDLQ-VEGKRVFTRVDFNVPLKDGEITDDTRIRAALPTIEQLTAQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+    ++  L  V      +L K +L  +   G  + Q+I+ L  GG++L ENVRF + 
Sbjct: 63  PKGTVVEELRLDPVADRLSDLLGKEVLKTDQVYGEEVDQAISELENGGVLLIENVRFEAG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+ V   +   D Y+NDAF  +HRAHAS TG++  LP+  G+ M+KE+  L +  
Sbjct: 123 EEKNDPELVEAFANMADLYVNDAFGAAHRAHASTTGVAEKLPAAAGKLMEKEIEALGNAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              ++P  AIVGG+KV  KI+++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL + D 
Sbjct: 183 ENPERPFTAIVGGAKVKDKISVIDNLLDKVDNLIIGGGLAYTFIKAQGHEIGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +   +AK      ++P D +VA +      T++V    +P D   LD+G KT E 
Sbjct: 243 IDLAKEFMNKAKEKGVNFVLPVDAIVADDFSEEANTKIVDIDKIPSDWEALDIGTKTREK 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
              ++  ++ V+WNGP+GVFE+  F   T  VA  +A         SI GGGD+  A+  
Sbjct: 303 YSSIVKDSKLVIWNGPMGVFELNAFAGGTKAVAEALASTEG----YSIIGGGDSAAAVEK 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++ E  +VST GGA LE++EGK LPG+ AL+
Sbjct: 359 FGLAEEMDHVSTGGGASLEFMEGKVLPGLAALN 391


>gi|15594402|ref|NP_212190.1| phosphoglycerate kinase [Borrelia burgdorferi B31]
 gi|195941795|ref|ZP_03087177.1| phosphoglycerate kinase [Borrelia burgdorferi 80a]
 gi|3915792|sp|Q59181|PGK_BORBU RecName: Full=Phosphoglycerate kinase
 gi|2687944|gb|AAC66451.1| phosphoglycerate kinase (pgk) [Borrelia burgdorferi B31]
 gi|312149223|gb|ADQ29294.1| phosphoglycerate kinase [Borrelia burgdorferi N40]
          Length = 393

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 251/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + + + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYIDSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I+ V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIENVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|225549329|ref|ZP_03770302.1| phosphoglycerate kinase [Borrelia burgdorferi 94a]
 gi|225370187|gb|EEG99627.1| phosphoglycerate kinase [Borrelia burgdorferi 94a]
          Length = 393

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 252/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRVLVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + + + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYIDSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|102139814|gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
          Length = 401

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 244/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G +  +RVD NVP  +  KV D TRI   VPTI  L+E+ A++++ SHLGRP+  + 
Sbjct: 14  DLKGKKVFVRVDLNVPLDENLKVTDDTRIRASVPTIKYLMERGARIILASHLGRPKGVTP 73

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K  SL  VV     +L  N+   NDCIG  + + I++L +GG++L ENVRFY EEE+NDP
Sbjct: 74  K-YSLKPVVPRLSELLGVNVAMANDCIGVEVEKLISALPDGGVLLLENVRFYKEEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKEL  L    S  KK
Sbjct: 133 EFAKKLASLADLYVNDAFGTAHRAHASTEGVTKYLKPSVAGFLMQKELDYLVGAVSNPKK 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  AIVGGSKVSTKI ++ +L++KVD L++GGGM  +F  AQG  VG SL + D  +   
Sbjct: 193 PFAAIVGGSKVSTKIGVMESLLEKVDILILGGGMIFTFYKAQGYSVGSSLVEEDKLNLAT 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVVVA +      +++V A  +P   + LD+G  +++     +
Sbjct: 253 SLLEKAKSKGVSLLLPTDVVVADKFAADAESKIVPASGIPDGWMGLDIGPDSIKSFSGTL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              +T++WNGP+GVFE E F   T  +A  +A L+    + +I GGGD++ A+   G++ 
Sbjct: 313 ESTKTIIWNGPMGVFEYEKFAVGTEAIAKKLADLSGS-GVTTIIGGGDSVAAVEKVGLAA 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG++AL
Sbjct: 372 KMSHISTGGGASLELLEGKTLPGVLAL 398


>gi|56964784|ref|YP_176515.1| phosphoglycerate kinase [Bacillus clausii KSM-K16]
 gi|81678804|sp|Q5WDK6|PGK_BACSK RecName: Full=Phosphoglycerate kinase
 gi|56911027|dbj|BAD65554.1| 3-phosphoglycerate kinase [Bacillus clausii KSM-K16]
          Length = 394

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 159/393 (40%), Positives = 243/393 (61%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D  D  G     RVD+NVP  DGK+ D TRI+  +PTI  L E+ A+V++ SHLGR
Sbjct: 4   KTLYDY-DFAGKTVFCRVDFNVPMKDGKITDETRIQAALPTIKYLSEQGARVLLASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +  +   L  V +    +L K +  V +  G    Q++  L +GG++L ENVRFY  
Sbjct: 63  PKGEVVESLRLAPVATRLSELLGKEVQAVQEAHGPVAKQAVEGLEDGGVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LPS  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFASLADIFVNDAFGAAHRAHASTEGIAHYLPSAAGFLMEKELDVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P  A++GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  VG+SL + D 
Sbjct: 183 SNPERPFTAVIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFVKAQGYEVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   Q   +A++   +  +P DV+VA +       + V+   +P D   LD+G KT + 
Sbjct: 243 LDLAKQFMEKAEQKGVKFYMPEDVIVADDFSDDANKKEVAISGIPADWEALDIGPKTRKT 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + V+  ++ V+WNGP+GVFE+E F   T  VA+ +A+ +    +I   GGGD+  A+  
Sbjct: 303 YEAVLKASKLVIWNGPMGVFELESFAGGTKAVANALAEASDTYSVI---GGGDSAAAVEQ 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++ +++ST GGA LE++EGK+LPG+VALS
Sbjct: 360 FGLADKMSHISTGGGASLEFMEGKELPGVVALS 392


>gi|315185803|gb|EFU19569.1| phosphoglycerate kinase [Spirochaeta thermophila DSM 6578]
          Length = 392

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/394 (40%), Positives = 241/394 (61%), Gaps = 5/394 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
            L+T+ D+ ++RG + L+RVD+NVP  DG + D TRI   +PT+  L+++ A +++ SHL
Sbjct: 2   ELKTVKDI-EVRGKKVLVRVDFNVPLKDGVITDDTRIRAALPTLQYLLDQGAALIVMSHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + SL  V      +L + +    DC+G  + +   +L+ G ++L ENVRF+
Sbjct: 61  GRPKGERKPEYSLSPVAERLGELLGREVKMAPDCVGPEVERMAEALTPGEVLLLENVRFH 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EE  NDPDF + L+  G+ Y+NDAF  +HRAHAS  G++HLLP+  G  M+KE+  L  
Sbjct: 121 KEETSNDPDFAKKLASLGEVYVNDAFGSAHRAHASTEGVAHLLPAAAGFLMEKEVKFLSY 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                +KP VA++GG+KVSTKI +L +L+ K   +VIGGGMA +FL  QG  +G SL + 
Sbjct: 181 VLENPEKPFVAVIGGAKVSTKIGVLESLLSKCTAMVIGGGMAYTFLKVQGHSIGNSLYEE 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           + +D       +A     E+I+P D +VA E       + V A  +P   + +D+G +TV
Sbjct: 241 ESADTARSFLEKAGELGVEVILPEDHLVASEFSEQAKAEYVDAVDIPEGKVGMDIGPRTV 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E     I  A+TV+WNGP+GVFE   F   T +VA  +A    E +  ++ GGGD++ A 
Sbjct: 301 EKACARIRGAKTVVWNGPMGVFEFPAFAEGTRKVAEAIA----ECKGTTVVGGGDSVAAA 356

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              G++++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 357 NAFGVADKMTHVSTGGGASLEFLEGKPLPGIEVL 390


>gi|300813408|ref|ZP_07093759.1| phosphoglycerate kinase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512551|gb|EFK39700.1| phosphoglycerate kinase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 397

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 162/395 (41%), Positives = 245/395 (62%), Gaps = 7/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ + D  +  G   L+RVD+NVP  DGKV    RI++ +PTI  + E+  K+++ SHLG
Sbjct: 2   IKKLEDF-NFNGKTVLVRVDFNVPIKDGKVKGDDRIKKSLPTIKYIKEQGGKIILMSHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRF 121
           RP+ K +KD SL  V      IL ++ILF+++   +   +   + +L    I L EN+RF
Sbjct: 61  RPKGKYNKDLSLRPVAQRLSEILGEDILFIDEKEVVNKEVKDKVKNLKNAEIALLENLRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EEE+N+  F + L+   D Y+NDAF  +HRAHAS  G+S  LPS  G  ++KE+  L+
Sbjct: 121 RPEEEKNEESFSKDLASLADIYVNDAFGTAHRAHASNVGVSKFLPSAAGFLLEKEIKYLK 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 K+P VAI+GG+KVS KI L+ NL+ K+D +VI G MAN+F+ + G  VG+SL +
Sbjct: 181 ESLENPKRPFVAILGGAKVSDKINLIKNLLDKIDSIVIVGAMANTFIKSMGKEVGKSLVE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   QI  +A +    +I+P D + ARE+      QVV A S+  D ++LD+G  +
Sbjct: 241 DDKLDLARQIIDQASKKGVNLILPEDFIEAREISDDAKGQVVDASSIDKDKMVLDIGPNS 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ IK V+  A+T++WNGP GVFE++ F + TV +A  +A    +   ++I GGGD++ A
Sbjct: 301 LKKIKMVLKDAKTIVWNGPAGVFEVDEFSKGTVGIAKILA----DSDALTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG+ ++ +++ST GGA LE LEGK LP I AL
Sbjct: 357 VEKAGVEDKISHISTGGGASLELLEGKVLPAIKAL 391


>gi|261420493|ref|YP_003254175.1| phosphoglycerate kinase [Geobacillus sp. Y412MC61]
 gi|319768164|ref|YP_004133665.1| phosphoglycerate kinase [Geobacillus sp. Y412MC52]
 gi|261376950|gb|ACX79693.1| Phosphoglycerate kinase [Geobacillus sp. Y412MC61]
 gi|317113030|gb|ADU95522.1| Phosphoglycerate kinase [Geobacillus sp. Y412MC52]
          Length = 394

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 240/393 (61%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ ++RG R   RVD+NVP  +G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-EVRGKRVFCRVDFNVPMEEGAITDDTRIRAALPTIRYLIENGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV+  ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVAIDAIPSDWEALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE+E F   T  VA  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRESKLVVWNGPMGVFEMEAFAHGTKAVAQALAEAPD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>gi|148269387|ref|YP_001243847.1| phosphoglycerate kinase [Thermotoga petrophila RKU-1]
 gi|166987820|sp|A5IJ98|PGK_THEP1 RecName: Full=Phosphoglycerate kinase
 gi|147734931|gb|ABQ46271.1| Phosphoglycerate kinase [Thermotoga petrophila RKU-1]
          Length = 399

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 249/393 (63%), Gaps = 3/393 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 5   TIKDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 64  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +TVE 
Sbjct: 244 DLAKELLEKAKEKGVEIVLPVDTVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETVEL 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G+ + F++VST GGA LE+LEGK+LPGI +++
Sbjct: 363 FGLEDRFSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|126658259|ref|ZP_01729409.1| phosphoglycerate kinase [Cyanothece sp. CCY0110]
 gi|126620408|gb|EAZ91127.1| phosphoglycerate kinase [Cyanothece sp. CCY0110]
          Length = 400

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 247/386 (63%), Gaps = 2/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R L+RVD+NVP  +G ++D TRI   +PTI EL+   AKVV+ SH+GRP+ K  +
Sbjct: 13  DLAGKRVLVRVDFNVPLDNGTISDDTRIRAALPTIKELITNGAKVVLCSHMGRPKGKVVE 72

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
             SL  V +    +L +++   +DC+G +++ ++A L  G + L EN+RF++EEE NDP+
Sbjct: 73  SMSLKPVATRLSELLGQDVTMCDDCVGDSVAAAVAKLENGQVALLENLRFHAEEEANDPE 132

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKKP 190
           F + L+ N D Y+NDAF  +HRAHAS  G++ HL PS  G  ++KEL  L++     ++P
Sbjct: 133 FAKQLAANADLYVNDAFGTAHRAHASTEGVTHHLSPSVAGYLIEKELQYLQAAIENPQRP 192

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L AI+GGSKVS+KI ++  L+ K DKL+IGGGM  +F  A+G+ VG+SL + D  +    
Sbjct: 193 LAAIIGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKARGLNVGKSLVEEDKLELAKS 252

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    E+++P DVV+A +       +  S +++    + LD+G  +VE  K+ +A
Sbjct: 253 LEAKAKEKGVELLLPTDVVLADDFNKDANAKTASIENIEDGWMGLDIGPDSVEVFKKALA 312

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             + V+WNGP+GVFE E F + T  +A+ +A+LT       I  GGD++ A+   G++ +
Sbjct: 313 DCKAVIWNGPMGVFEFEKFAKGTEAIANTLAELTGTGTTTIIG-GGDSVAAVEKVGVAEK 371

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPGI AL
Sbjct: 372 MSHISTGGGASLELLEGKTLPGIAAL 397


>gi|157834149|pdb|1VPE|A Chain A, Crystallographic Analysis Of Phosphoglycerate Kinase From
           The Hyperthermophilic Bacterium Thermotoga Maritima
          Length = 398

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/392 (40%), Positives = 249/392 (63%), Gaps = 3/392 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 4   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 62

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 63  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 122

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 123 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 182

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 183 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 242

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +T+E 
Sbjct: 243 DLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 303 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 361

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            G+ ++F++VST GGA LE+LEGK+LPGI ++
Sbjct: 362 FGLEDKFSHVSTGGGASLEFLEGKELPGIASM 393


>gi|118488917|gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gi|118489457|gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 481

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/396 (41%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  +  K+ D TRI   VPTI  L+ K AKV++ SH
Sbjct: 80  KSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSSH 139

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  + + +ASL EGG++L ENVRF
Sbjct: 140 LGRPKGVTPK-FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF 198

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 199 YKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 258

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 259 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLAVGSSLV 318

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +  +AK     +++P DVV+A +      ++ V A ++P   + LD+G +
Sbjct: 319 EEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLDIGPE 378

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE E F   T  +A  +A+L+  + + +I GGGD++ 
Sbjct: 379 SVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKKLAELSG-KGVTTIIGGGDSVA 437

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK+LPG++AL
Sbjct: 438 AVEKVGVADVMSHISTGGGASLELLEGKELPGVLAL 473


>gi|56421592|ref|YP_148910.1| phosphoglycerate kinase [Geobacillus kaustophilus HTA426]
 gi|81675701|sp|Q5KVE4|PGK_GEOKA RecName: Full=Phosphoglycerate kinase
 gi|56381434|dbj|BAD77342.1| 3-phosphoglycerate kinase [Geobacillus kaustophilus HTA426]
          Length = 394

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 239/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ ++RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-EVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV+  ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVAIDAIPSDWEALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI Q++ V+WNGP+GVFE+E F   T  +A  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRQSKLVVWNGPMGVFEMEAFAHGTKAIAEALAEAPD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>gi|224101335|ref|XP_002312238.1| predicted protein [Populus trichocarpa]
 gi|3738261|dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gi|222852058|gb|EEE89605.1| predicted protein [Populus trichocarpa]
          Length = 481

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/396 (41%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  +  K+ D TRI   VPTI  L+ K AKV++ SH
Sbjct: 80  KSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSSH 139

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  + + +ASL EGG++L ENVRF
Sbjct: 140 LGRPKGVTPK-FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF 198

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 199 YKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 258

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 259 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLAVGSSLV 318

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +  +AK     +++P DVV+A +      ++ V A ++P   + LD+G +
Sbjct: 319 EEDKLDLATTLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLDIGPE 378

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE E F   T  +A  +A+L+  + + +I GGGD++ 
Sbjct: 379 SVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKKLAELSG-KGVTTIIGGGDSVA 437

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK+LPG++AL
Sbjct: 438 AVEKVGVADVMSHISTGGGASLELLEGKELPGVLAL 473


>gi|297531310|ref|YP_003672585.1| phosphoglycerate kinase [Geobacillus sp. C56-T3]
 gi|297254562|gb|ADI28008.1| Phosphoglycerate kinase [Geobacillus sp. C56-T3]
          Length = 394

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 239/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ ++RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-EVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV+  ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMKKAKEKGVRFYMPVDVVVADRFANDANTKVVAIDAIPSDWEALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI Q++ V+WNGP+GVFE+E F   T  +A  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRQSKLVVWNGPMGVFEMEAFAHGTRAIAEALAEAPD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>gi|281411916|ref|YP_003345995.1| phosphoglycerate kinase [Thermotoga naphthophila RKU-10]
 gi|281373019|gb|ADA66581.1| Phosphoglycerate kinase [Thermotoga naphthophila RKU-10]
          Length = 399

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 249/393 (63%), Gaps = 3/393 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 5   TIKDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 64  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  +G S  + D  
Sbjct: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEIGSSRVEEDKI 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +TVE 
Sbjct: 244 DLAKELLEKAKEKGVEIVLPVDTVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETVEL 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G+ + F++VST GGA LE+LEGK+LPGI +++
Sbjct: 363 FGLEDRFSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|302036469|ref|YP_003796791.1| phosphoglycerate kinase [Candidatus Nitrospira defluvii]
 gi|300604533|emb|CBK40865.1| Phosphoglycerate kinase [Candidatus Nitrospira defluvii]
          Length = 399

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 165/396 (41%), Positives = 244/396 (61%), Gaps = 7/396 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSH 61
           R R + D++ +RG R ++R D+NVP  D  ++ D TRI   +PTI   V++ AKV++ SH
Sbjct: 4   RKRIIEDVQ-LRGKRVIIRADYNVPLDDSLQITDDTRIRSTLPTINRAVDEGAKVILCSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K D   SL  V    + +L K ++F  DCIG+ +   +A +  G ++L EN+RF
Sbjct: 63  LGRPKGKFDPKFSLAPVAKRLQRLLGKEVIFAPDCIGAAVEGLVAKMQPGDVMLLENLRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSML 180
           + EEE+ND  F + L+   D YINDAF  +HRAHAS  G++  +P +  G  ++KE+  L
Sbjct: 123 HPEEEKNDDGFSKALASLADVYINDAFGAAHRAHASTVGITKYIPEAAAGYLLKKEIEYL 182

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P VAI+GG+KVS KI ++ NL KKVDK++IGGGMA +FL A G+ +G+SL 
Sbjct: 183 EGAVENPVRPFVAILGGAKVSGKIGVIENLGKKVDKVIIGGGMAFTFLKAMGLEIGQSLV 242

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +   A  S  +  +P D VVA   + G  T++V  Q +P     LD+G  
Sbjct: 243 ENDMLDFAKGVQDHAFSSGVKFYLPVDCVVAASREPGAETKIVPVQEIPKGWYGLDIGPA 302

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +  A+T++WNGP+G+FE++ F R T+ +AH VA        ++I GGG+T  
Sbjct: 303 SVKLFSEAVQDAKTILWNGPMGMFEVDAFARGTLAMAHSVANAYA----LTIVGGGETAL 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG S   +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 AIHRAGESESISFISTGGGAALELLEGKTLPGLAAL 394


>gi|206889638|ref|YP_002248096.1| phosphoglycerate kinase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741576|gb|ACI20633.1| phosphoglycerate kinase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 404

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/393 (41%), Positives = 242/393 (61%), Gaps = 8/393 (2%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           T+ DL  I+  R  +R D+NVP +D    + D  RI   +PTI   +++ AK+++ SHLG
Sbjct: 12  TIEDL-PIKSKRVFIRADFNVP-LDANLVITDDRRIRSTLPTINYAIDEGAKIILASHLG 69

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K D   SL  V    + +L+K ++F  DCIG  + Q ++ + EG +IL EN+RF+ 
Sbjct: 70  RPKGKVDPKFSLSPVARRLQRLLNKEVIFAPDCIGPQVEQLVSKMKEGDVILLENLRFHM 129

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   DFY+NDAF  SHRAHASI G+   +PS  G  ++KE+  L+  
Sbjct: 130 EEEKNDEKFAKALASLADFYVNDAFGASHRAHASIVGIPKFIPSAAGFLLKKEIEYLKGA 189

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P V I+GG+KV  KI +L NL  K DK+++GGGMA +F+ A G  VG SL + D
Sbjct: 190 VESPIRPFVVILGGAKVGGKIGVLENLADKADKVIVGGGMAFTFIKAMGYEVGNSLVESD 249

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  + + +  +  +P DVV+A+ + TG  T++V  Q +P     LD+G  +V+
Sbjct: 250 MIDFAIKIMEKLRANRVKFYLPVDVVIAQSIDTGAETKIVPVQEIPQGWRGLDIGPASVK 309

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +  A+T++WNGP+GVFEI+ F R T  +AH VA    +    +I GGGDT  A+ 
Sbjct: 310 LFTEALHDAKTILWNGPMGVFEIDAFSRGTFAIAHAVA----DSYAFTIVGGGDTDYAVH 365

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG+S+  +++ST GGA L+ LEGK+LPG+  L
Sbjct: 366 KAGVSDSISFISTGGGAALQLLEGKELPGLAVL 398


>gi|319953048|ref|YP_004164315.1| phosphoglycerate kinase [Cellulophaga algicola DSM 14237]
 gi|319421708|gb|ADV48817.1| Phosphoglycerate kinase [Cellulophaga algicola DSM 14237]
          Length = 395

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 157/396 (39%), Positives = 247/396 (62%), Gaps = 5/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+++  + +G + L+RVD+NVP   +  V D +RIE   PTI++++E     ++ SHL
Sbjct: 1   MKTLDNF-NFKGKKALIRVDFNVPLDAELNVTDTSRIEAAKPTIIKILEDGGSAILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP  + + D SL  +       +  ++ FV++C+G     + ASL  G ++L EN+RF+
Sbjct: 60  GRPNGQVNPDLSLKHICDEVSKAIGVSVKFVDECVGEKAEAAAASLKSGEVLLLENLRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
            EEE+ D  F   LS+ GD Y+NDAF  +HRAHAS T ++   P     G  + KE+  +
Sbjct: 120 PEEEKGDKAFAEKLSKLGDIYVNDAFGTAHRAHASTTVVAEFFPENKCFGYLLAKEIEAI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +   +  +KP+ AI+GGSKVS+KIT++ N++ KVD L+IGGGM  +F+ AQG  VG S+C
Sbjct: 180 DKVMATGEKPVCAILGGSKVSSKITIIENILDKVDHLIIGGGMTYTFIKAQGGKVGDSIC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   +I  +AK    E+ +P DV+ A +      T++V    +P     LD G K
Sbjct: 240 EDDKQELALEILKKAKEKGVEVHIPVDVLAADDFSNDANTKIVPVTEIPDGWQGLDAGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E  K+VI +++T++WNGP+GVFE+  F + T+ + +Y+A+ T E+   S+ GGGD++ 
Sbjct: 300 TLEIFKEVILKSKTILWNGPIGVFEMPTFAKGTIAIGNYIAEAT-EKGAFSLVGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G  ++ +YVST GGA LE LEGK LPGI A+
Sbjct: 359 AVKQFGFEDKVSYVSTGGGAMLESLEGKTLPGIAAI 394


>gi|212696111|ref|ZP_03304239.1| hypothetical protein ANHYDRO_00647 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676740|gb|EEB36347.1| hypothetical protein ANHYDRO_00647 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 398

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 251/394 (63%), Gaps = 10/394 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI---DGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+NDL ++ G + L+RVD+NVP     + ++AD TRI   +PTI  L+E  AKV++ SH
Sbjct: 4   KTVNDL-NVNGKKVLVRVDFNVPLSKENNEEIADDTRIRAALPTIDYLLENDAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVN--DCIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ ++  + +L  V    E+       F    + +   + + +A+L EG + L EN 
Sbjct: 63  LGRPKGEAKPEFALKPVADWLENHYKDKFHFFPSPEVVDDKVKEEVANLKEGEVCLIENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE+ +
Sbjct: 123 RYVAGETKNDPEFAKKLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKEIDV 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G+SL
Sbjct: 183 MGKALEAPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+ +  EI++P DVV+A E+K G  T++V   S+P D   LD+G 
Sbjct: 243 LEEDKMDLSLELIKKAEANNVEILLPVDVVIADEIKAGAETEIVDIDSIPEDKEALDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT E     I +A+TV+WNGP+GVFEI+ F   T +VA  +A    E   I+I GGGD+ 
Sbjct: 303 KTAELFSSKIKEAKTVVWNGPMGVFEIKEFADGTNKVAAALA----ESDAITIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
            A+  AG+ ++ T+VST GGA LE+LEGK LPGI
Sbjct: 359 LAIELAGLKDKITHVSTGGGASLEFLEGKTLPGI 392


>gi|149369363|ref|ZP_01889215.1| phosphoglycerate kinase [unidentified eubacterium SCB49]
 gi|149356790|gb|EDM45345.1| phosphoglycerate kinase [unidentified eubacterium SCB49]
          Length = 395

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 161/396 (40%), Positives = 252/396 (63%), Gaps = 6/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND  + +G + L+RVD+NVP  +  +V D TRIE   PTI +++E     ++ SHL
Sbjct: 1   MKTVNDF-NFKGKKALIRVDFNVPLNENFEVTDATRIEAAKPTIYKILEDGGSCILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP++K +++ SL  +V  A  IL   I F  DC+G T   + ASL EG I+L EN+R++
Sbjct: 60  GRPKNK-EEEFSLKNIVKKASEILGVTIKFSEDCVGETAETAAASLGEGEILLLENLRYH 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
           +EE   + DF + LS  GD Y+NDAF  +HRAHAS + ++   P    +G  +  E+  +
Sbjct: 119 AEETEGNRDFAQALSTLGDVYVNDAFGTAHRAHASTSIIAEFFPDNKCLGLLLSSEIENV 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S+SKKP+ A++GG+KVS+KIT+L N++ K+D L+IGGGMA +F+ AQG  +G SL 
Sbjct: 179 NKVLSDSKKPVTAVIGGAKVSSKITVLENILDKIDHLIIGGGMAFTFIKAQGGKIGGSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   +I  +AK+   E+ +P D ++A        T++ S+  +P   + LD G  
Sbjct: 239 EDDKQNLALEILEKAKQKGVEVHLPIDALIADSFSVHASTEIASSSDIPEGWMGLDCGDA 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T    ++V+ +++T++WNGP+GVFE+EPF + T+ + + +A+ TK     S+ GGGD++ 
Sbjct: 299 TNRIFEEVLLKSQTILWNGPVGVFEMEPFAKGTIHLGNAIAEATK-NGAFSLVGGGDSVA 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+    +S + +YVST GGA LE LEGK LPGI A+
Sbjct: 358 AVKQFNLSKKVSYVSTGGGAMLEMLEGKTLPGIKAM 393


>gi|203287525|ref|YP_002222540.1| phosphoglycerate kinase [Borrelia recurrentis A1]
 gi|226699797|sp|B5RQN5|PGK_BORRA RecName: Full=Phosphoglycerate kinase
 gi|201084745|gb|ACH94319.1| phosphoglycerate kinase [Borrelia recurrentis A1]
          Length = 392

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/393 (41%), Positives = 247/393 (62%), Gaps = 5/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ D  D  G R L+R D+NVP  +G + D TRI+  +PTI  L  + A+VV+ SHLG
Sbjct: 3   IRTIKDC-DFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIEYLKSQGARVVLMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + +   SL  +      +L +++  ++DCIG  +  +++ +  G ++L ENVRFY 
Sbjct: 62  RPKGEKNLRYSLMPIARRLSELLGQDVKMLSDCIGDEVVTAVSCMQNGDVVLLENVRFYK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE N   F   LS++GD ++NDAF  +HRAHAS +G++  LP+  G  M++E   L   
Sbjct: 122 EEEENSDAFAMQLSKSGDIFVNDAFGTAHRAHASTSGVASYLPAVGGFLMEREDEFLGKI 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL + +
Sbjct: 182 LKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGYSIGKSLLENE 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + D       +AK  + E+I+P D VVA E +     + V + ++P   I +D+G KT++
Sbjct: 242 YIDVASSFLKKAKELSVEVILPIDHVVASEFQEYSMPEYVDSVNIPDSKIGMDIGEKTLK 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I+ V++ A+TV+WNGPLGVFE + F + T +VA YVA        I++ GGGD++ A+ 
Sbjct: 302 KIEGVLSSAKTVIWNGPLGVFEFDSFAKGTAKVAEYVANCPG----ITVVGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +S + T+VST GGA LE+LEGK LPGI  L
Sbjct: 358 KFNLSGKITHVSTGGGASLEYLEGKVLPGIKVL 390


>gi|332291822|ref|YP_004430431.1| Phosphoglycerate kinase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169908|gb|AEE19163.1| Phosphoglycerate kinase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 395

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/383 (42%), Positives = 242/383 (63%), Gaps = 5/383 (1%)

Query: 17  RCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSL 75
           + L+RVD+NVP   DG V D TRIE   PTIL+++E     ++ SHLGRP++K +++ SL
Sbjct: 13  KALIRVDFNVPLDEDGNVTDTTRIEAAKPTILKVLEDGGSAILMSHLGRPKNK-EEEFSL 71

Query: 76  FKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRM 135
            ++  I   ++   + FV DC+G+  +++ ++L  G I+L EN+R+YSEE   D DF + 
Sbjct: 72  SQICRIVSEVIGVEVNFVEDCVGAKATEAASNLEMGKILLLENLRYYSEETAGDVDFAKQ 131

Query: 136 LSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSMLESCFSESKKPLVA 193
           LS  GD Y+NDAF  +HRAHAS T ++   P     G  + KE+  L+   + S+KP++A
Sbjct: 132 LSELGDIYVNDAFGTAHRAHASTTIIAQFFPDAKCYGYLLAKEIESLDRVLNNSEKPVLA 191

Query: 194 IVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAW 253
           I+GGSKVS+KIT++ N++ KVD+++IGGGMA +F+ AQG  +G S+C+ D  +    I  
Sbjct: 192 ILGGSKVSSKITVIENILDKVDEMIIGGGMAFTFIKAQGGTIGDSICEDDKMELALDILK 251

Query: 254 EAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQAR 313
           +AK    +I +P DV+ A +      T+V    S+      LD G K+ E   +V  +A+
Sbjct: 252 QAKEKGVQIHIPVDVIAADDFSNDANTKVCDIMSIEDGWQGLDAGPKSRELFDEVAKRAK 311

Query: 314 TVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTY 373
           T++WNGPLGVFE+E F   T+ + H +A  TK+    S+ GGGD++ A+   G   + +Y
Sbjct: 312 TILWNGPLGVFEMETFAGGTIALGHSIAAATKDGA-FSLVGGGDSVAAVKQFGFDTKVSY 370

Query: 374 VSTAGGAFLEWLEGKDLPGIVAL 396
           VST GGA LE LEGK LPGI A+
Sbjct: 371 VSTGGGAMLEMLEGKTLPGIAAI 393


>gi|170288045|ref|YP_001738283.1| phosphoglycerate kinase [Thermotoga sp. RQ2]
 gi|238688811|sp|B1L8B8|PGK_THESQ RecName: Full=Phosphoglycerate kinase
 gi|170175548|gb|ACB08600.1| Phosphoglycerate kinase [Thermotoga sp. RQ2]
          Length = 399

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 161/393 (40%), Positives = 249/393 (63%), Gaps = 3/393 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV+  SHLGRP
Sbjct: 5   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVIFLSHLGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 64  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +TVE 
Sbjct: 244 DLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETVEL 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G+ ++F++VST GGA LE+LEGK+LPGI +++
Sbjct: 363 FGLEDKFSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|312148048|gb|ADQ30707.1| phosphoglycerate kinase [Borrelia burgdorferi JD1]
          Length = 393

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 159/394 (40%), Positives = 251/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D  RI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDARIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + + + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYIDSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|216264590|ref|ZP_03436582.1| phosphoglycerate kinase [Borrelia burgdorferi 156a]
 gi|215981063|gb|EEC21870.1| phosphoglycerate kinase [Borrelia burgdorferi 156a]
          Length = 393

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 251/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIG  +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGIEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + V + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYVDSFNIPENKIGMDIGVNTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|307111054|gb|EFN59289.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
          Length = 399

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 163/397 (41%), Positives = 246/397 (61%), Gaps = 7/397 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ DL   D+ G    +R D NVP    K+ D TRI   VPT+  LV+  AKV++ SHL
Sbjct: 4   KSVGDLSKADLEGKVVFVRADLNVPLDGDKITDDTRIRAAVPTLKYLVDNGAKVLLTSHL 63

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +    L  VV     ++   +    DCIG  ++  +A +S G ++L ENVRFY
Sbjct: 64  GRPKKGPEDKFRLTPVVGRLSELMGAAVEKAEDCIGEAVTSKLAKMSNGSVLLLENVRFY 123

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLE 181
            EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L+
Sbjct: 124 PEEEKNDPEFAKKLAAPADLYVNDAFGTAHRAHASTEGVTKFLSPSVAGFLLQKELDYLD 183

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  K+P VAIVGGSKVS+KI ++ +L+ K DK+++GGGM  +F  A+G+ VG SL +
Sbjct: 184 GAVTTPKRPFVAIVGGSKVSSKIGVIESLLAKCDKIILGGGMIFTFYKAKGLAVGGSLVE 243

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   ++  +AK    E ++P DV+VA +      TQVV   ++P   + LD+G K+
Sbjct: 244 EDKLELALELMEKAKAKGVEFVLPTDVIVADKFAPDAATQVVDVTAIPDGWMGLDIGPKS 303

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ +K  +  A+TV+WNGP+GVFE + F + T  +A+ +A +      I+I GGGD++ A
Sbjct: 304 IDLLKDTLKGAKTVIWNGPMGVFEFDAFAKGTFAIANELAAMDD---CITIIGGGDSVAA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLP-GIVALS 397
           +  AG++ + +++ST GGA LE LEGK LP G+ AL+
Sbjct: 361 VEKAGVAEKMSHISTGGGASLELLEGKVLPAGVAALN 397


>gi|1172455|sp|P41758|PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|642454|gb|AAA70082.1| phosphoglycerate kinase precursor [Chlamydomonas reinhardtii]
 gi|33339114|gb|AAQ14241.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
          Length = 461

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 166/397 (41%), Positives = 248/397 (62%), Gaps = 6/397 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVA--DVTRIERVVPTILELVEKKAKVVIFS 60
           +++ DL   D+ G R  +R D NVP     +A  D TRI   VPT+  L++  AKV++ S
Sbjct: 63  KSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVLLTS 122

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +    L  VV+    +L K +  V+DCIG  + +++ ++  G ++L EN R
Sbjct: 123 HLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLENCR 182

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSM 179
           FY EEE+N+P+F + L+ N D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  
Sbjct: 183 FYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDY 242

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+   S  K+P VAIVGGSKVS+KIT++  L++K DK++IGGGM  +F  A+ + VG SL
Sbjct: 243 LDGAVSNPKRPFVAIVGGSKVSSKITVIEALMEKCDKIIIGGGMIFTFYKARALKVGSSL 302

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++   AK    ++++P DVVVA +      TQ V   ++P   + LD+G 
Sbjct: 303 VEDDKIELAKKLEEMAKAKGVQLLLPTDVVVADKFDANANTQTVPITAIPDGWMGLDIGP 362

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +V+     +A A+TV+WNGP+GVFE     + TV +A+ +A LT  +  I+I GGGD++
Sbjct: 363 DSVKTFNDALADAKTVVWNGPMGVFEFPQVRQRTVSIANTLAGLT-PKGCITIIGGGDSV 421

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 422 AAVEQAGVAEKMSHISTGGGASLELLEGKVLPGVAAL 458


>gi|307718667|ref|YP_003874199.1| phosphoglycerate kinase [Spirochaeta thermophila DSM 6192]
 gi|306532392|gb|ADN01926.1| phosphoglycerate kinase [Spirochaeta thermophila DSM 6192]
          Length = 392

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 240/394 (60%), Gaps = 5/394 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
            L+T+ D+ ++RG + L+RVD+NVP  DG + D TRI   +PT+  L+++ A +++ SHL
Sbjct: 2   ELKTVKDI-EVRGKKVLVRVDFNVPLKDGVITDDTRIRAALPTLQYLLDQGAALIVMSHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + SL  V      +L + +    DC+G  + +   +L+ G ++L ENVRF+
Sbjct: 61  GRPKGERKPEYSLSPVAERLGELLGREVKMAPDCVGPEVERMAEALTPGEVLLLENVRFH 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EE  NDPDF + L+  G+ Y+NDAF  +HR HAS  G++HLLP+  G  M+KE+  L  
Sbjct: 121 KEETSNDPDFAKKLASLGEVYVNDAFGSAHRGHASTEGIAHLLPAAAGFLMEKEVKFLSY 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                +KP VA++GG+KVSTKI +L +L+ K   +VIGGGMA +FL  QG  +G SL + 
Sbjct: 181 VLENPEKPFVAVIGGAKVSTKIGVLESLLSKCTAMVIGGGMAYTFLKVQGHSIGNSLYEE 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           + +D       +A     E+I+P D +VA E       + V A  +P   + +D+G +TV
Sbjct: 241 ESADTARSFLEKAGELGVEVILPEDHLVASEFSEQAKAEYVDAVDIPEGKVGMDIGPRTV 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E     I  A+TV+WNGP+GVFE   F   T +VA  +A    E +  ++ GGGD++ A 
Sbjct: 301 EKACARIRGAKTVVWNGPMGVFEFPAFAEGTRKVAEAIA----ECKGTTVVGGGDSVAAA 356

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              G++++ T+VST GGA LE+LEGK LPGI  L
Sbjct: 357 NAFGVADKMTHVSTGGGASLEFLEGKPLPGIEVL 390


>gi|15643452|ref|NP_228498.1| bifunctional phosphoglycerate kinase/triosephosphate isomerase
           [Thermotoga maritima MSB8]
 gi|6226667|sp|P36204|PGKT_THEMA RecName: Full=Bifunctional PGK/TIM; Includes: RecName:
           Full=Phosphoglycerate kinase; Includes: RecName:
           Full=Triosephosphate isomerase; Short=TIM; AltName:
           Full=Triose-phosphate isomerase
 gi|4981212|gb|AAD35771.1|AE001741_4 phosphoglycerate kinase/triose-phosphate isomerase [Thermotoga
           maritima MSB8]
          Length = 654

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 250/393 (63%), Gaps = 3/393 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 5   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 64  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA-QSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +T+E 
Sbjct: 244 DLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G+ ++F++VST GGA LE+LEGK+LPGI +++
Sbjct: 363 FGLEDKFSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|116787582|gb|ABK24564.1| unknown [Picea sitchensis]
          Length = 507

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 253/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL+  D++G R  +R D NVP  + + + D TRI   VPTI  L+   AKV++ SH
Sbjct: 106 KSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNGAKVILASH 165

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L  N+L  +DCIG  + +++ASL +GG++L EN+RF
Sbjct: 166 LGRPKGVTPK-YSLKPLVPRLTELLGVNVLKTDDCIGEEVEKAVASLPDGGVLLLENLRF 224

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSML 180
           + EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L P+  G  MQKEL  L
Sbjct: 225 HKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLMQKELDYL 284

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG+ VG SL 
Sbjct: 285 VGAVSVPKRPFAAIVGGSKVSSKIGVIESLLEKVDILFLGGGMIFTFYKAQGLKVGSSLV 344

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      ++VV A  +P   + LD+G  
Sbjct: 345 EDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGAD 404

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGGD++ 
Sbjct: 405 SIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSIAKKLAELSG-KGVTTIIGGGDSVA 463

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 464 AVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLAL 499


>gi|121485004|gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
          Length = 401

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 165/387 (42%), Positives = 245/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G R  +RVD NVP  D  K+ D TRI   VPTI  L+   A+V++ SHLGRP+  + 
Sbjct: 14  DLKGKRVFVRVDLNVPLDDTFKITDDTRIRAAVPTIKYLMSHGARVILSSHLGRPKGVTP 73

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K  SL  +V     +L   +   +DCIG  + + +A + EGG++L ENVRFY EEE+NDP
Sbjct: 74  K-FSLKPLVPRLSELLGIEVKMADDCIGPDVEKLVAEIPEGGVLLLENVRFYKEEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++ HL P+  G  +QKEL  L    S  KK
Sbjct: 133 EFAKKLASLADLYVNDAFGTAHRAHASTEGVAKHLKPAVAGFLVQKELDYLVGAVSNPKK 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  AIVGGSKVS+KI ++ +L++KVD LV+GGGM  +F  AQG+ VG SL + D  D   
Sbjct: 193 PFAAIVGGSKVSSKIGVIESLLEKVDILVLGGGMIFTFYKAQGLAVGSSLVEEDKLDLAT 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVV+A +      +++V A S+P   + LD+G  +++   + +
Sbjct: 253 TLLEKAKSKGVSLLLPSDVVIADKFAADANSKIVPASSIPDGWMGLDIGPDSIKSFSEAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGGD++ A+   G+++
Sbjct: 313 DTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGGDSVAAVEKVGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKPLPGVPAL 398


>gi|212640337|ref|YP_002316857.1| phosphoglycerate kinase [Anoxybacillus flavithermus WK1]
 gi|226699789|sp|B7GL27|PGK_ANOFW RecName: Full=Phosphoglycerate kinase
 gi|212561817|gb|ACJ34872.1| 3-phosphoglycerate kinase [Anoxybacillus flavithermus WK1]
          Length = 394

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 241/393 (61%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R   RVD+NVP  +G V D TRI   +PTI  L+E+ AKV++ SHLGR
Sbjct: 4   KTVRDI-DVKGKRVFCRVDFNVPMQNGVVTDDTRIRAALPTIQYLMEQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L K ++  ++  G T+  +IA ++EG ++L ENVRFY  
Sbjct: 63  PKGKVVEEMRLNAVAERLSELLGKRVVKTDEAYGDTVKAAIAEMNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L    
Sbjct: 123 EEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAHHLPAVAGFLMEKEIEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  +G+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKALGHEIGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D       +AK       +P D VVA +       +VV+   +P D   LD+G KT E 
Sbjct: 243 IDLAKSFMEKAKEKGVNFYMPVDAVVADDFSNDANKKVVNIDEIPSDWEGLDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T  VA  +A     +   ++ GGGD+  A+  
Sbjct: 303 YRDVILKSKLVIWNGPMGVFEMDAFAEGTKAVAQALADA---KDTYTVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++N+  ++ST GGA LE++EGK LPG+VAL+
Sbjct: 360 FGLANKMDHISTGGGASLEFMEGKQLPGVVALN 392


>gi|193213710|ref|YP_001999663.1| phosphoglycerate kinase [Chlorobaculum parvum NCIB 8327]
 gi|238692615|sp|B3QLX7|PGK_CHLP8 RecName: Full=Phosphoglycerate kinase
 gi|193087187|gb|ACF12463.1| Phosphoglycerate kinase [Chlorobaculum parvum NCIB 8327]
          Length = 397

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 162/395 (41%), Positives = 253/395 (64%), Gaps = 4/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T++D+  ++G R L+RVD+NVP   D  + D  RI   +P+I +++E+  ++++ SHLG
Sbjct: 4   KTLSDIS-LQGKRVLMRVDFNVPLDQDRNITDDKRIVGALPSIRKVIEEGGRLILMSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   SL         +L   +   NDCIG+ + Q + +L +G +++ EN+RF+ 
Sbjct: 63  RPKGKVNPAFSLAPAAKRLSELLGMPVTMANDCIGTEVMQEVLALQDGEVMMLENLRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLES 182
           EEE NDPDF R L+  G+ Y+NDAF  +HRAHAS  G++H +P+ + G  ++KEL  L +
Sbjct: 123 EEEANDPDFARELASMGEIYVNDAFGTAHRAHASTEGITHYVPTAVAGYLIEKELRYLGT 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             +++K+P VAI+GG+K+S KI +L +L  KVD +++GG M  +F  AQG+ VG SL + 
Sbjct: 183 ALNDAKRPFVAILGGAKISGKIDVLEHLFDKVDTVLVGGAMVFTFFKAQGLPVGNSLVED 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +  +    +  +AK     +I+P DVVVA E+     ++V    ++      LD+G  T+
Sbjct: 243 NKIELAISLLEKAKEKGVRLILPEDVVVAAEISADAASRVEPVTTISDGMSGLDIGPATI 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E   + I  A+TV+WNGP+GVFEI+ F + T  VA  +A  T +   I+I GGGD+  A+
Sbjct: 303 ETYAKEILGAKTVLWNGPMGVFEIDQFAKGTFAVAQALADAT-DAGAITIIGGGDSAAAI 361

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A AG+S++ T+VST GGA LE+LEGK+LPGI AL+
Sbjct: 362 AKAGLSDKVTHVSTGGGASLEFLEGKELPGIAALN 396


>gi|123965459|ref|YP_001010540.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9515]
 gi|166987798|sp|A2BUH2|PGK_PROM5 RecName: Full=Phosphoglycerate kinase
 gi|123199825|gb|ABM71433.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9515]
          Length = 402

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 159/400 (39%), Positives = 248/400 (62%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D   + G + L+RVD+NVP  D G++ D TRI   +PTI  L+   AKV++
Sbjct: 1   MSKLSLSSLDKSKLEGKKVLVRVDFNVPLNDDGQITDDTRIRAAIPTIKYLINNSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ K ++   L  + +    IL K +     CIG    +   +L+ G ++L EN
Sbjct: 61  AAHFGRPKGKVNERMRLTPIAARLSEILGKKVNLTESCIGEEALEKSNNLNNGDVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRFY EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G++  L PS  G  ++KEL
Sbjct: 121 VRFYEEEEKNDLNFAKNLAAHADMYVNDAFGAAHRAHASTQGVTKFLEPSVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+       +PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAIDAPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIIIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DVV+A E      ++V    S+  D + LD+
Sbjct: 241 SLVEEDKLELARNLEEKAKTKGVELLLPSDVVLANEFSPTAESKVSQIDSISGDWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G ++++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPQSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNSIATTLADLSSFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK+LPG+ AL+
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKNLPGVAALN 400


>gi|15223484|ref|NP_176015.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|332278232|sp|P50318|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags:
           Precursor
 gi|12321760|gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|15810505|gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|20466264|gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|23198084|gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|332195235|gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 478

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 166/396 (41%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV++ +H
Sbjct: 77  KSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTH 136

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  +   +ASL EGG++L ENVRF
Sbjct: 137 LGRPKGVTPK-FSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENVRF 195

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+PDF + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 196 YKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 255

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 256 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 315

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 316 EEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 375

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE E F + T  VA+ +A+L+K + + +I GGGD++ 
Sbjct: 376 SVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK-KGVTTIIGGGDSVA 434

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   +++ST GGA LE LEGK LPG+VAL
Sbjct: 435 AVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVAL 470


>gi|186491325|ref|NP_001117503.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|332195236|gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 405

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 166/396 (41%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV++ +H
Sbjct: 4   KSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTH 63

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  +   +ASL EGG++L ENVRF
Sbjct: 64  LGRPKGVTPK-FSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENVRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+PDF + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 123 YKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 182

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 183 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 242

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 243 EEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 302

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE E F + T  VA+ +A+L+K + + +I GGGD++ 
Sbjct: 303 SVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK-KGVTTIIGGGDSVA 361

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   +++ST GGA LE LEGK LPG+VAL
Sbjct: 362 AVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVAL 397


>gi|255544584|ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gi|223547261|gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
          Length = 479

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 252/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D  K+ D TRI   +PT+  L++  AKV++ SH
Sbjct: 78  KSVGDLTAADLKGKKVFVRADLNVPLDDNQKITDDTRIRAAIPTVKHLIQNGAKVILSSH 137

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  + + +ASL EGG++L ENVRF
Sbjct: 138 LGRPKGVTPK-FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF 196

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 197 YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 256

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 257 VGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 316

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +  +AK     +++P DVV+A +      ++VV+A ++P   + LDVG +
Sbjct: 317 EEDKLDLATSLLAKAKLKGVSLLLPTDVVIADKFAPDANSKVVAASAIPDGWMGLDVGPE 376

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGGD++ 
Sbjct: 377 SVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGGDSVA 435

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   +++ST GGA LE LEGK+LPG++AL
Sbjct: 436 AVEKVGVAEVMSHISTGGGASLELLEGKELPGVLAL 471


>gi|205375131|ref|ZP_03227922.1| phosphoglycerate kinase [Bacillus coahuilensis m4-4]
          Length = 394

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 240/386 (62%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  DG + D TRI   +PTI  L ++ AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKRVFCRVDFNVPMKDGSITDETRIRAAIPTIQHLADQGAKVILASHLGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +    +++K++  V++  G  +   ++ + +G I+L ENVRFY  E +NDP+
Sbjct: 70  ELRLTPVAARLSELMNKDVKKVDEAYGDAVLAEVSKMEDGDILLLENVRFYPGETKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKNFAVLADVYVNDAFGAAHRAHASTEGIAKHIPAVAGLLMEKELDVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  VG+SL + D  D   Q 
Sbjct: 190 TAIIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFVKAQGHEVGKSLLEEDKIDLAKQF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A+    +  +P DV+VA +       +VVS + +P D   LD+G KT E    VI +
Sbjct: 250 MAKAEEKGVKFYMPVDVIVADDFSDSANQKVVSIEEIPADWEALDIGPKTTELYAGVIKE 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+E + + T  VA  +A  T    +I   GGGD+  A+   G++ + 
Sbjct: 310 SKLVIWNGPMGVFELESYAKGTKGVAEALADSTDTYSVI---GGGDSAAAVEKFGLAEKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+VAL+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVVALN 392


>gi|239828276|ref|YP_002950900.1| phosphoglycerate kinase [Geobacillus sp. WCH70]
 gi|259530762|sp|C5D7M4|PGK_GEOSW RecName: Full=Phosphoglycerate kinase
 gi|239808569|gb|ACS25634.1| Phosphoglycerate kinase [Geobacillus sp. WCH70]
          Length = 394

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 159/393 (40%), Positives = 241/393 (61%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R   RVD+NVP  +G + D TRI   +PTI  L+E+ AKV++ SHLGR
Sbjct: 4   KTVRDV-DVKGKRVFCRVDFNVPMENGAITDDTRIRAALPTIRYLMEQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L K++   ++  G  + ++I+ ++EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLNAVARRLSELLGKHVTKTDEAYGDAVKEAISKMNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L    
Sbjct: 123 EEKNDPELAKAFAELADIYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  +G+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLAYTFVKALGHEIGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VVS  ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVNFYMPVDVVVADRFANDANTKVVSIDAIPSDWEALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T  VA  +A         S+ GGGD+  A+  
Sbjct: 303 YRDVIMKSKLVVWNGPMGVFEMDAFAEGTKAVAQALADAVD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++ +  ++ST GGA LE++EGK LPG+VAL+
Sbjct: 360 FGLAEKMDHISTGGGASLEFMEGKQLPGVVALN 392


>gi|33860755|ref|NP_892316.1| phosphoglycerate kinase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|46576735|sp|Q7V390|PGK_PROMP RecName: Full=Phosphoglycerate kinase
 gi|33633697|emb|CAE18654.1| Phosphoglycerate kinase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 402

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 159/399 (39%), Positives = 246/399 (61%), Gaps = 3/399 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D   + G + L+RVD+NVP  D G++ D TRI   +PTI  L+   AKV++
Sbjct: 1   MSKLSLSSLDKSKLEGKKVLVRVDFNVPLNDSGQITDDTRIRAAIPTIKYLINNSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ K ++   L  V +    IL + +     CIG        SL+ G ++L EN
Sbjct: 61  AAHFGRPKGKVNEKMRLTPVAARLSDILEQKVNLTESCIGEEALAKSNSLNNGEVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRFY EEE+ND DF + L+ + D Y+NDAF  +HRAHAS  G++  L P+  G  ++KEL
Sbjct: 121 VRFYEEEEKNDLDFAKNLASHADMYVNDAFGAAHRAHASTQGVTKFLEPAVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAIDAPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIIIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DV++A E      ++V    ++  D + LD+
Sbjct: 241 SLVEEDKLELARNLEAKAKNKGVELLLPSDVLLANEFSPDAESKVSQIDAISGDWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G ++++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPQSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSSFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAAL 399


>gi|313887914|ref|ZP_07821593.1| phosphoglycerate kinase [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846080|gb|EFR33462.1| phosphoglycerate kinase [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 394

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 168/395 (42%), Positives = 247/395 (62%), Gaps = 7/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D  D      L+RVD+NVP  DG V    RI + +PTI  LVE  AKVV+ SHLGR
Sbjct: 3   KTIRDF-DFNDKTALVRVDFNVPLKDGVVTGDDRIVKAIPTIDYLVENGAKVVLVSHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFV--NDCIGSTLSQSIASLSEGGIILAENVRFY 122
           P+ +  ++ SL  V   A  +L K++ F+   + +   + + + +L  G I L EN+RF 
Sbjct: 62  PKGEYKEEFSLAPVAKRAAELLKKDVKFIPSKEVVDVKVIEEVKNLKSGEIALLENLRFV 121

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             EE+NDPDF + L+  GD ++NDAF  +HRAHAS  G++  LPS  G  ++KE+   E 
Sbjct: 122 KGEEKNDPDFAKKLASLGDIFVNDAFGTAHRAHASNVGVTEFLPSCAGLLVEKEIKYFED 181

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                +KP  AI+GGSKVS KI ++ NL++KVD LVI G MAN+FL ++G+ VG+SL + 
Sbjct: 182 ALKNPEKPFAAILGGSKVSDKIGVIENLLEKVDVLVIVGAMANTFLKSKGLEVGKSLVED 241

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  D   +I  +A  +  EII+P+DV+VA E+       +   + V  D +ILD+G +++
Sbjct: 242 DKLDLAREIMAKATENHVEIILPKDVIVAPELSDNAKGTLKKVEDVGQDDMILDIGKESL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I+  +++A+TV+ NGP GVFEIE F   T+E+   +AKL        I GGGD++ A+
Sbjct: 302 KDIEGSLSKAKTVVLNGPCGVFEIEEFSHGTIELVKILAKLD----ATVIVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             AG++++ T++ST GGA LE LEGK LPGI A+ 
Sbjct: 358 EKAGVADKLTHISTGGGASLEMLEGKKLPGIEAVE 392


>gi|168274229|dbj|BAG09537.1| phosphoglycerate kinase [Porphyra yezoensis]
          Length = 457

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 246/396 (62%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D+ G R L+R D NVP +DGK + D TRI   +PTI  L    AKV++ SH
Sbjct: 61  KSIKDLTAADLAGKRVLVRCDLNVP-LDGKTITDDTRIRASIPTIEYLTAAGAKVLLSSH 119

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+S  +   SL  V +    +L K++    DCIG  +++ ++ +S G + L ENVRF
Sbjct: 120 LGRPKSGPEDKFSLAPVATRLSELLKKDVKMAPDCIGDGVAEIVSGMSNGDVTLLENVRF 179

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EE  ND +F + L+ N D ++NDAF  +HRAH S  G++  L PS  G  ++KEL+ L
Sbjct: 180 YKEETANDTEFAKKLAANADMFVNDAFGTAHRAHGSTAGVTEFLRPSVAGLLLEKELAYL 239

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +++ KVDKLVI GGM  +FL A+G+  G SL 
Sbjct: 240 AGAVSNPKRPFAAIVGGSKVSSKIGVIESMLDKVDKLVIVGGMVFTFLKARGLSTGSSLV 299

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++   A +   +II+P DVV A +      TQ+VS  ++P D++ LD G K
Sbjct: 300 EDDKIELAKELEEIAAKKGVKIILPVDVVAADKFAPDAKTQLVSVDAIPDDTMGLDQGPK 359

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + E I   +A  +TV+WNGP GVFE + F   T  +A+ +A++T      +I GGGD++ 
Sbjct: 360 STELINAELADCKTVLWNGPAGVFEFDAFATGTYAIANTLAEVTA-NGATTIIGGGDSVA 418

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 419 AVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 454


>gi|222100871|ref|YP_002535439.1| Bifunctional PGK/TIM [Thermotoga neapolitana DSM 4359]
 gi|221573261|gb|ACM24073.1| Bifunctional PGK/TIM [Thermotoga neapolitana DSM 4359]
          Length = 405

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 252/393 (64%), Gaps = 3/393 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI+  +PTI  ++++ AKV++ SHLGRP
Sbjct: 7   TVRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIKAALPTIKYVLDQGAKVILLSHLGRP 65

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 66  KGQPSPEFSLEPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 125

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 126 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 185

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  +G S  + D  
Sbjct: 186 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKQIGSSKYEEDKL 245

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +TVE 
Sbjct: 246 DLAKELLDKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETVEL 305

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T ++A  +A LT E+  I++ GGGD+  A+  
Sbjct: 306 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQIALAIASLT-EKGAITVVGGGDSAAAVNK 364

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G+ ++F++VST GGA LE+LEGK+LPGI +++
Sbjct: 365 FGLEDKFSHVSTGGGASLEFLEGKELPGIASIA 397


>gi|299536227|ref|ZP_07049540.1| phosphoglycerate kinase [Lysinibacillus fusiformis ZC1]
 gi|298728213|gb|EFI68775.1| phosphoglycerate kinase [Lysinibacillus fusiformis ZC1]
          Length = 412

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/398 (39%), Positives = 250/398 (62%), Gaps = 7/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +TM D+ D++G R  +RVD+NVP  DG + D TRI   +PTI  LVE+ AKV++ S
Sbjct: 19  MLNKKTMKDI-DVKGQRVFIRVDFNVPMADGAITDETRIRAAIPTIEYLVEQGAKVILAS 77

Query: 61  HLGRPQSKSDKDCSLFKV-VSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLGRP+ +  +D  L  V + +AE ++ K +  +++ IG  + +++A++ +G I+L ENV
Sbjct: 78  HLGRPKGEVKEDMRLTAVGIRLAE-LMGKPVTKLDESIGQAVEEAVANMQDGDILLLENV 136

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF++ EE+NDP   +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  MQKEL +
Sbjct: 137 RFHAGEEKNDPTLAQQFAQLADIYVNDAFGAAHRAHASTEGIAKHIPAVSGFLMQKELDV 196

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L    S  + P  AI+GG+KV  KI ++ +L++KVD L+IGGG++ +F+ AQG  +G+SL
Sbjct: 197 LGKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGLSFTFIKAQGHDIGKSL 256

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +       +AK    ++ +P D VVA E      TQ+V   ++P D + LD+G 
Sbjct: 257 LEEDKIELAKSFIEKAKAKGVQLHMPVDAVVANEFSQDAETQIVDVDAIPADWMGLDIGP 316

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT     +VI  ++ ++WNGP+GVFE++ F   T  VA  +A         ++ GGGD+ 
Sbjct: 317 KTAANYAEVIKNSKLIIWNGPMGVFEMDKFSNGTKTVADAMATTAG----YTVIGGGDSA 372

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+    ++++  ++ST GGA LE +EGK+LPGIVAL+
Sbjct: 373 AAVEKFEVADKMDHISTGGGASLELMEGKELPGIVALN 410


>gi|317130209|ref|YP_004096491.1| phosphoglycerate kinase [Bacillus cellulosilyticus DSM 2522]
 gi|315475157|gb|ADU31760.1| Phosphoglycerate kinase [Bacillus cellulosilyticus DSM 2522]
          Length = 394

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 234/386 (60%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  DG V D TRI   +PTI  L E+ AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKRVFCRVDFNVPMSDGAVTDDTRIRAALPTIQHLAEQGAKVILASHLGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V      +L K ++  +   G    ++I++L+EG ++L ENVRF + EE+NDP+
Sbjct: 70  ELRLDAVAKRLSDLLGKTVVKTDTVYGDEPKEAISNLAEGDVLLLENVRFEAGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKELAALADVYVNDAFGAAHRAHASTEGIAQHLPAVGGFLMEKELEVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ NL+  VD L+IGGG+A +F+ A G  VG+SL + D  D   Q 
Sbjct: 190 TAIIGGAKVKDKIGVIDNLLDNVDNLIIGGGLAYTFVKALGHEVGKSLLEEDKIDLAKQF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK    +  +P D +VA +      TQVV   S+P D   LD+G KT++  + VI  
Sbjct: 250 MDKAKEKGVKFYMPLDAIVADDFGADATTQVVDIDSIPSDWEALDIGPKTIDAYRDVILN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+EPF   T+ VA  +A       +I   GGGD+  A+   G +   
Sbjct: 310 SKLVIWNGPMGVFELEPFANGTISVAKALADANDAYTVI---GGGDSAAAVEKFGFAENM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
            ++ST GGA LE++EGK LPG+ AL+
Sbjct: 367 DHISTGGGASLEFMEGKVLPGVAALN 392


>gi|78778583|ref|YP_396695.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9312]
 gi|123554732|sp|Q31CY6|PGK_PROM9 RecName: Full=Phosphoglycerate kinase
 gi|78712082|gb|ABB49259.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9312]
          Length = 402

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/400 (39%), Positives = 250/400 (62%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D  ++ G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV++
Sbjct: 1   MSKLSLSSLDKTNLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ + ++   L  V +    +L +N+   N CIG        SLS G ++L EN
Sbjct: 61  AAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAVAQSNSLSNGDVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRF+ EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G+++ L PS  G  ++KEL
Sbjct: 121 VRFFGEEEKNDLEFAKKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAIDSPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DVV+A E      +++    S+  + + LD+
Sbjct: 241 SLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISQIDSISGNWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPDSIKVFQNALAECKTIIWNGPMGVFEFDKFADGTNAIATTLADLSAFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|29124969|gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
          Length = 401

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/400 (41%), Positives = 254/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKGVTPK-YSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++ +L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVVVA +      ++VV+A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVAASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFNEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|15605702|ref|NP_213079.1| phosphoglycerate kinase [Aquifex aeolicus VF5]
 gi|3914328|sp|O66519|PGK_AQUAE RecName: Full=Phosphoglycerate kinase
 gi|2982854|gb|AAC06475.1| phosphoglycerate kinase [Aquifex aeolicus VF5]
          Length = 397

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/399 (41%), Positives = 252/399 (63%), Gaps = 8/399 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIF 59
           M R +T+ D+ D++G R L+RVD+NVP  + G + D TRI   +PT+  L++  AKV++ 
Sbjct: 1   MLRKKTLRDV-DVKGKRVLVRVDYNVPLDEQGNIVDDTRIRASLPTVEYLLDANAKVILM 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+++ D   SL  V       ++K +    DC+G  + + + S+ EG ++L EN+
Sbjct: 60  SHLGRPKNR-DPKYSLAPVAKRLSRYINKEVKLAPDCVGEEVKRIVNSMKEGDVVLLENL 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELS 178
           RF+ EE   D +F R L+  G+ Y+ DAF   HR HAS+  +   L P+ +G  ++KE++
Sbjct: 119 RFHKEETECDENFARELASLGEVYVADAFGTCHRKHASVYLVPKFLKPAVMGFLLEKEIT 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
             E      ++P+VAI+GG+KVS+K+ ++ NL+++VDKL IGG MA +FL A G  VG S
Sbjct: 179 YFEKAMVAPQRPVVAILGGAKVSSKLEVIKNLIRRVDKLFIGGAMAFTFLKAMGYKVGNS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  D    +   AK+   ++ +P D V+ +E+    PT+VV  Q +P   + LD+G
Sbjct: 239 LVEDDLQDVARDLIDVAKKLEIKLYLPVDFVIGQEVSENTPTKVVPWQEIPDGWMGLDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             +VE +K++I+ A+T++WNGP+GVFEI+ F   T+E    VAKL  +   ++IAGGGDT
Sbjct: 299 PVSVELVKEIISDAQTIVWNGPMGVFEIDKFKHGTIE----VAKLLAQSSALTIAGGGDT 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             A+  AG+ + F +VST GGAFLE L GK+LP +V L 
Sbjct: 355 DHAIHKAGVYHAFDFVSTGGGAFLELLAGKELPCLVNLD 393


>gi|326522650|dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 382

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 242/381 (63%), Gaps = 4/381 (1%)

Query: 18  CLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLF 76
             +R D NVP  D  K+ D TRI   +PTI  L+EK AKV++ SHLGRP+  + K  SL 
Sbjct: 1   VFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILASHLGRPKGVTPK-FSLK 59

Query: 77  KVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRML 136
            +V     +L   ++   DCIG  + +  A+L +GG++L ENVRFY EEE+N+P+F + L
Sbjct: 60  PLVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLENVRFYKEEEKNEPEFAKKL 119

Query: 137 SRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKKPLVAIV 195
           +   D Y+NDAF  +HRAHAS  G++  L PS  G  MQKEL  L    +  KKP  AIV
Sbjct: 120 ASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKELDYLVGAVANPKKPFAAIV 179

Query: 196 GGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEA 255
           GGSKVS+KI ++ +L+ KVD L++GGGM  +F  AQG+ VG+SL + D  +    +   A
Sbjct: 180 GGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETA 239

Query: 256 KRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTV 315
           K    ++++P DVVVA +      +++V A ++P   + LDVG  +++   + +   +TV
Sbjct: 240 KSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTV 299

Query: 316 MWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVS 375
           +WNGP+GVFE E F   T  +A  +A+LT  + + +I GGGD++ A+  AG++++ +++S
Sbjct: 300 IWNGPMGVFEFEKFAAGTDAIAKQLAELTG-KGVTTIIGGGDSVAAVEKAGLADKMSHIS 358

Query: 376 TAGGAFLEWLEGKDLPGIVAL 396
           T GGA LE LEGK LPG++AL
Sbjct: 359 TGGGASLELLEGKPLPGVLAL 379


>gi|183221463|ref|YP_001839459.1| phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911550|ref|YP_001963105.1| phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|238687778|sp|B0SB21|PGK_LEPBA RecName: Full=Phosphoglycerate kinase
 gi|238687850|sp|B0SSU3|PGK_LEPBP RecName: Full=Phosphoglycerate kinase
 gi|167776226|gb|ABZ94527.1| Phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779885|gb|ABZ98183.1| Phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 396

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 246/386 (63%), Gaps = 4/386 (1%)

Query: 11  RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           ++++G R  +RVD+NVP  +GK  D TRIE+ +PT+  L+ K AK+++ SHLGRP+   +
Sbjct: 9   QNLKGKRVFVRVDFNVPVENGKATDRTRIEKTLPTLELLISKGAKIILGSHLGRPKGGPE 68

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              S+  V  +   ++   + F    IGS + +   +L EG I+L EN+RF+ EEE N  
Sbjct: 69  PKYSMKPVFDVLSELVKTKVSFSESVIGSDVVKMTNALGEGEILLLENLRFHKEEEENVA 128

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
            F + L++  D Y+NDAF  +HRAHAS  G++HLLP++ G  M+KE+ +L    ++ ++P
Sbjct: 129 SFCKELAKLADVYVNDAFGTAHRAHASTEGVAHLLPAFAGLLMRKEIEVLSGLLAKPERP 188

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
            VAIVGGSKVS+K  +L NL++KVD L+IGGGMA +FL ++ + VG+SL + +F     Q
Sbjct: 189 FVAIVGGSKVSSKFAILKNLLEKVDHLLIGGGMAYTFLKSRAVPVGKSLVEPEFESQAFQ 248

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +   A     ++ +P D ++A        T+ V    +    + +D+G KT++   + I 
Sbjct: 249 LIDRAGIQGVDLQIPVDHIIADAFDPNAKTKSVDKMGIIDGWMGMDIGPKTIDNYVKAIK 308

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
            A+T++WNGP+GVFE++ F + T+E+A  ++K     +  ++ GGGD+I A+  AG++++
Sbjct: 309 DAKTILWNGPMGVFEMDKFSKGTIEIAKAISK----SKAKTVVGGGDSIAAVNKAGVADK 364

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            T++ST GGA LE+LEG+ LPG+  L
Sbjct: 365 ITHISTGGGASLEFLEGRTLPGVQCL 390


>gi|166367108|ref|YP_001659381.1| phosphoglycerate kinase [Microcystis aeruginosa NIES-843]
 gi|189036821|sp|B0JT86|PGK_MICAN RecName: Full=Phosphoglycerate kinase
 gi|166089481|dbj|BAG04189.1| phosphoglycerate kinase [Microcystis aeruginosa NIES-843]
          Length = 402

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/388 (40%), Positives = 248/388 (63%), Gaps = 4/388 (1%)

Query: 12  DIRGLRCLLRVDWNVPF--IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKS 69
           D+ G R L+RVD+NVP     G ++D TRI   +PTI +L++K AKV++ SH+GRP  + 
Sbjct: 13  DLAGKRVLVRVDFNVPMDKATGAISDDTRIRAALPTIEDLIKKGAKVILCSHMGRPDGQV 72

Query: 70  DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERND 129
            ++  L  V      +L + ++   DCIG  ++ +I+ +S G + L EN+RF+ EEE ND
Sbjct: 73  KENLRLTPVAKRLSELLGQEVIMCPDCIGEGVTAAISQMSNGQVALLENLRFHGEEEAND 132

Query: 130 PDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESK 188
           PDF + L+ N D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL+ L++     +
Sbjct: 133 PDFAKKLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKELNYLQAAIETPQ 192

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +  
Sbjct: 193 RPLAAIIGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKARGLSVGKSLVEEDKLELA 252

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             +  +AK    E ++P DVV+A +      +Q+V  +++P   + LD+G ++V+  ++ 
Sbjct: 253 KSLEAKAKEKGVEFLLPTDVVLADKFDKDAESQIVKVENIPDGWMGLDIGPESVKVFQEA 312

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           ++  ++V+WNGP+GVFE + F   T  +AH +A LT       I  GGD++ A+   G++
Sbjct: 313 LSNCKSVLWNGPMGVFEFDKFAAGTDAIAHTLADLTATGTTTIIG-GGDSVAAVEKVGVA 371

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 EKMSHISTGGGASLELLEGKVLPGIAAL 399


>gi|33864370|ref|NP_895930.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9313]
 gi|46576736|sp|Q7V461|PGK_PROMM RecName: Full=Phosphoglycerate kinase
 gi|33641150|emb|CAE22280.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9313]
          Length = 401

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 159/396 (40%), Positives = 251/396 (63%), Gaps = 5/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           R++++L   D+R  R L+RVD+NVP  + G + D TRI   +PTI +L++K A+V++ +H
Sbjct: 4   RSLSNLSAADLRSKRVLVRVDFNVPLNENGAITDDTRIRAALPTINDLIDKGARVILSAH 63

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ + ++   L  V      +L KN+     C+GS     + ++++G ++L ENVRF
Sbjct: 64  FGRPKGQINEGMRLTPVAKRLSELLGKNVTKTESCVGSDAEAKVNAMADGDVVLLENVRF 123

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           +SEEE+ND +F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L
Sbjct: 124 FSEEEKNDANFAQKLAALADAYVNDAFGAAHRAHASTEGVTKFLNPSVAGHLMEKELQYL 183

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +    + K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL 
Sbjct: 184 QGAIDDPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVGKSLV 243

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++  +AK    ++++P DVV+A +      +Q VS  ++P   + LD+G  
Sbjct: 244 EEDKLELAKELEAKAKAKGVQLLLPTDVVLADDFAPAANSQTVSIDAIPDGWMGLDIGPD 303

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++   +  +A  +TV+WNGP+GVFE + F   T  +A  +A L+  +   +I GGGD++ 
Sbjct: 304 SINLFQDALADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSG-KGCCTIIGGGDSVA 362

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 363 AVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|1314258|gb|AAB53931.1| phosphoglycerate kinase [Borrelia burgdorferi]
          Length = 393

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 159/394 (40%), Positives = 251/394 (63%), Gaps = 6/394 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SHLG
Sbjct: 3   IKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRFY+
Sbjct: 63  RPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRFYA 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++   PS  G  M+KE + L   
Sbjct: 123 EEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYSPSVGGFLMEKEDNSLGGI 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL + +
Sbjct: 183 LKNPERPSVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLEDE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREM-KTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +         +AK    ++I+P D +VA +  K  IP + + + ++P + I +D+G  T+
Sbjct: 243 YIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIP-EYIDSFNIPENKIGMDIGANTL 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I+ V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A+
Sbjct: 302 KEIENVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAAV 357

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
               +S++ T+VST GGA LE+LEG+ LPGI  L
Sbjct: 358 NKFNLSDKITHVSTGGGASLEYLEGRILPGIKVL 391


>gi|298207248|ref|YP_003715427.1| phosphoglycerate kinase [Croceibacter atlanticus HTCC2559]
 gi|83849884|gb|EAP87752.1| phosphoglycerate kinase [Croceibacter atlanticus HTCC2559]
          Length = 420

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 161/395 (40%), Positives = 248/395 (62%), Gaps = 5/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND  + +  + L+RVD+NVP  D  +V D TRIE    TI++++E     V+ SHL
Sbjct: 27  MKTLNDY-NFKNKKALIRVDFNVPLNDDFEVTDTTRIEAAKDTIIKVLEDGGSAVLMSHL 85

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ + + + SL  + S    IL     F ++C+G     +++ L  G ++L EN+R++
Sbjct: 86  GRPKGEQE-EYSLKHICSKVSEILGVQTKFASNCVGPVAEDAVSRLENGEVLLLENLRYH 144

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSMLE 181
            EE++ D  F + LS+ GD YINDAF  +HRAHAS T +++      +G  +QKE+  L 
Sbjct: 145 EEEKKGDQKFAKQLSKLGDVYINDAFGTAHRAHASTTVVANYFEDKCVGYLLQKEIESLN 204

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              + S KP+ AI+GG+KVSTKIT++ N++ K+D L+IGGGM  +F+ A+G  +G SL +
Sbjct: 205 KVLNNSTKPVTAILGGAKVSTKITVIENILDKIDHLIIGGGMTFTFIKAKGGKIGSSLVE 264

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   +I  +A+    +I +P D +VA        T + +  ++    + LDVG KT
Sbjct: 265 EDKLDLALEIIEKAEEKNVQIHLPSDAIVADSFSEFANTNIEAVDNISDGWMGLDVGPKT 324

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E  K V+ Q++T++WNGPLGVFE+EPF + T+E+ +Y+ + T E+   S+ GGGD++ A
Sbjct: 325 LEEFKGVVLQSKTILWNGPLGVFEMEPFAKGTIELGNYIEEAT-EKGAFSLVGGGDSVAA 383

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G  N+ +YVST GGA LE LEGK LPGI AL
Sbjct: 384 VKQFGFENKVSYVSTGGGAMLEMLEGKKLPGIAAL 418


>gi|312899149|ref|ZP_07758527.1| phosphoglycerate kinase [Megasphaera micronuciformis F0359]
 gi|310619816|gb|EFQ03398.1| phosphoglycerate kinase [Megasphaera micronuciformis F0359]
          Length = 392

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 245/394 (62%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+  + G +  +R D+NVP  D + + D TRI + +PTI  L++  + V++ SHLG
Sbjct: 3   KTIKDVS-LDGKKVFVRADFNVPLDDKQQITDDTRIVKTLPTIQYLLDHNSAVILASHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ ++  + SL  V +    +L + +    DC+G    +   SL  G ++L EN+R++ 
Sbjct: 62  RPKGEAKPEFSLRPVAARLSELLGRTVQMAPDCVGPETEKMAKSLKPGEVLLLENLRYHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L++  D  INDAF  SHRAHAS+ G++  LP   G  ++KE+  +   
Sbjct: 122 EEEKNDPAFSKALAQLADVGINDAFGCSHRAHASVAGITEFLPMAAGLLLEKEIRFIGGA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P  AI+GG+KVS KI ++ +L+ KVD ++IGGGMAN+FL AQG G+G+SL + D
Sbjct: 182 VEHPEHPFAAIIGGAKVSDKIEVISSLLPKVDLMIIGGGMANTFLAAQGYGIGKSLVEAD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  EAK+   E+++P DVVVA E       + V    VP D +ILD+G K+ E
Sbjct: 242 KIELASTLMEEAKKQNTELLLPVDVVVAAEFAAQALYKEVDVADVPADWMILDIGTKSRE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
                +   + ++WNGP+GVFE+E F + T  VA  VA    + + +S+ GGGD++ A+ 
Sbjct: 302 LFAHKLEPMKLIVWNGPMGVFEMEHFAKGTEAVAQAVA----DSKAVSVVGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG++++ T++ST GGA LE+LEGK LPGI +LS
Sbjct: 358 KAGLADKITHISTGGGASLEYLEGKILPGIASLS 391


>gi|186685976|ref|YP_001869172.1| phosphoglycerate kinase [Nostoc punctiforme PCC 73102]
 gi|229620374|sp|B2ITU1|PGK_NOSP7 RecName: Full=Phosphoglycerate kinase
 gi|186468428|gb|ACC84229.1| phosphoglycerate kinase [Nostoc punctiforme PCC 73102]
          Length = 400

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 247/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           DI G R L+RVD+NVP  D GK+ D TRI   +PTI +L +K AKV++ SH GRP+   D
Sbjct: 13  DISGKRALVRVDFNVPVDDQGKITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKGVDD 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K   L  V      +L + ++  +D IG  ++  +A+L  G ++L ENVRFY EEE+ND 
Sbjct: 73  K-LRLTPVAKRLSELLGQEVIKTDDSIGDEVAAKVAALQNGQVLLLENVRFYPEEEKNDA 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N DFY+NDAF  +HRAHAS  G++  L PS  G  ++KEL  L++     ++
Sbjct: 132 EFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQNAIENPQR 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 192 PLAAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVV+A        +Q VS +++P   + LD+G  +V++ ++ +
Sbjct: 252 SLEAKAKERGVALLLPTDVVLADNFAPDANSQTVSIENIPDGWMGLDIGPDSVKFFQEAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +AH +A++ K      I  GGD++ A+   G+++
Sbjct: 312 ADTKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIG-GGDSVAAVEKVGLAD 370

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 371 QMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|17231623|ref|NP_488171.1| phosphoglycerate kinase [Nostoc sp. PCC 7120]
 gi|21263807|sp|Q8YPR1|PGK_ANASP RecName: Full=Phosphoglycerate kinase
 gi|17133266|dbj|BAB75830.1| phosphoglycerate kinase [Nostoc sp. PCC 7120]
          Length = 400

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 245/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           DI G R L+RVD+NVP  D G + D TRI   +PTI +L +K AKV++ SH GRP+   D
Sbjct: 13  DISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKG-VD 71

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V      +L + ++  +D IG  ++  +A+L  G ++L ENVRFY EEE+NDP
Sbjct: 72  EKLRLTPVAKRLSELLGQEVIKTDDSIGDEVAAKVATLQNGQVLLLENVRFYKEEEKNDP 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N DFY+NDAF  +HRAHAS  G++  L PS  G  ++KEL  L+S     ++
Sbjct: 132 EFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQSAIENPQR 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 192 PLAAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVGKSLVEEDKLELAK 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVV+A        +Q VS +++P   + LD+G  +V+  +  +
Sbjct: 252 SLEAKAKERGVSLLLPTDVVLADNFAPDANSQTVSIENIPDGWMGLDIGPDSVKVFQAAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +AH +A++ K      I  GGD++ A+   G+++
Sbjct: 312 ADTKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIG-GGDSVAAVEKVGLAD 370

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 371 QMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|194335064|ref|YP_002016924.1| phosphoglycerate kinase [Prosthecochloris aestuarii DSM 271]
 gi|229620377|sp|B4S6S2|PGK_PROA2 RecName: Full=Phosphoglycerate kinase
 gi|194312882|gb|ACF47277.1| Phosphoglycerate kinase [Prosthecochloris aestuarii DSM 271]
          Length = 397

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/395 (40%), Positives = 247/395 (62%), Gaps = 4/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T++D+   +G R L+RVD+NVP  ++G + +  RI   +P+I +++E   ++++ SHLG
Sbjct: 4   KTLSDI-SCKGKRILMRVDFNVPLDLNGTITNDKRIIEALPSIRQVLETGGRLILMSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V      +L  +++  N+CIG+   Q   +L +G +++ EN+RF+ 
Sbjct: 63  RPKGKVTPELSLAPVARRLSELLDTDVVMANNCIGTEAMQQALALQDGEVMMLENLRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSMLES 182
           EEE+NDP+F R L+  G+ Y+NDAF  +HRAHAS  G+ H +P S  G  ++KEL  L +
Sbjct: 123 EEEKNDPEFARELASMGEIYVNDAFGTAHRAHASTEGICHYVPISVAGFLIEKELRYLGN 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             +  ++P +AI+GG+K+S KI +L NL  KVD ++IGG M  +F  AQG  VG SL + 
Sbjct: 183 ALANPERPFLAILGGAKISGKIDVLDNLFDKVDTILIGGAMIFTFFKAQGYQVGTSLVEE 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  +    +  +A      +++P DV+ A        T  V   S+P   + LD+G KT+
Sbjct: 243 DKIELAKHLLEKAAAKNIRMLLPEDVIAASAFSADAETATVPIDSIPETMMGLDIGPKTI 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           +   + I +ART++WNGP+GVFEI+ F   T+ +AH +A  T  +  ISI GGGD+  A+
Sbjct: 303 DTYSREILKARTIVWNGPMGVFEIDAFATGTIAIAHALADATA-KGAISIIGGGDSAAAV 361

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             AG+ +  T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 362 MKAGLESGITHISTGGGASLEFLEGKELPGIAALN 396


>gi|75906995|ref|YP_321291.1| phosphoglycerate kinase [Anabaena variabilis ATCC 29413]
 gi|123610525|sp|Q3MF40|PGK_ANAVT RecName: Full=Phosphoglycerate kinase
 gi|75700720|gb|ABA20396.1| phosphoglycerate kinase [Anabaena variabilis ATCC 29413]
          Length = 400

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 245/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           DI G R L+RVD+NVP  D G + D TRI   +PTI +L +K AKV++ SH GRP+   D
Sbjct: 13  DISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKG-VD 71

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V      +L + ++  +D IG  ++  +A+L  G ++L ENVRFY EEE+NDP
Sbjct: 72  EKLRLTPVAKRLSELLGQEVVKTDDSIGDEVAAKVAALQNGQVLLLENVRFYKEEEKNDP 131

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+ N DFY+NDAF  +HRAHAS  G++  L PS  G  ++KEL  L+S     ++
Sbjct: 132 EFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQSAIENPQR 191

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 192 PLAAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVGKSLVEEDKLELAK 251

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVV+A        +Q VS  ++P   + LD+G  +V+  ++ +
Sbjct: 252 SLEAKAKERGVSLLLPTDVVLADNFAPDANSQTVSIDNIPDGWMGLDIGPDSVKVFQEAL 311

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +AH +A++ K      I  GGD++ A+   G+++
Sbjct: 312 ADTKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIG-GGDSVAAVEKVGLAD 370

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPGI AL
Sbjct: 371 QMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|325286247|ref|YP_004262037.1| phosphoglycerate kinase [Cellulophaga lytica DSM 7489]
 gi|324321701|gb|ADY29166.1| Phosphoglycerate kinase [Cellulophaga lytica DSM 7489]
          Length = 396

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 159/397 (40%), Positives = 243/397 (61%), Gaps = 5/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND  +    R L+RVD+NVP  +   V D  RIE   PTI++++E    VV+ SHL
Sbjct: 1   MKTINDF-NFENKRALIRVDFNVPMDENFNVTDTNRIEAAKPTIIKVLEDGGSVVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   D SL  + S    +L   + FV+  +G    ++ A+L  G ++L EN+RF 
Sbjct: 60  GRPKGQVVPDLSLEHICSTVSDVLGVQVNFVSTSVGEEAEKAAANLENGQVLLIENLRFN 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
           +EEE+   DF   LS+ GD YINDAF  +HRAHAS T ++   P     G  + KE+  +
Sbjct: 120 AEEEKGGDDFAEQLSKLGDVYINDAFGTAHRAHASTTVVAKFFPENRCFGALLAKEIEAI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP+ AI+GG+KVS+KIT++ N++ KVD L+IGGGM  +F+ A+G  VG S+C
Sbjct: 180 DKVMQTGEKPVTAILGGAKVSSKITIIENILDKVDHLIIGGGMTYTFIKAKGGQVGDSIC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    I  +AK    E+ +P DV+ A E      T++     +      LD G K
Sbjct: 240 EDDKMELALDILKQAKEKGVEVHIPIDVIAADEFSNTANTKITDVDKIEEGWQGLDAGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E  K VI +++T++WNGP+GVFE+E + + T+E+ +Y+A+ T ++   S+ GGGD++ 
Sbjct: 300 TLEIFKDVILKSKTILWNGPIGVFEMESYAKGTIEIGNYIAEAT-QKGAFSLVGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  ++ +YVST GGA LE LEGK LPGI A++
Sbjct: 359 AVKQFGFQDKVSYVSTGGGAMLESLEGKSLPGIAAIT 395


>gi|94969569|ref|YP_591617.1| phosphoglycerate kinase [Candidatus Koribacter versatilis Ellin345]
 gi|166980483|sp|Q1INK7|PGK_ACIBL RecName: Full=Phosphoglycerate kinase
 gi|94551619|gb|ABF41543.1| phosphoglycerate kinase [Candidatus Koribacter versatilis Ellin345]
          Length = 403

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 173/406 (42%), Positives = 248/406 (61%), Gaps = 14/406 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIF 59
           MS+L ++ DL+ +   R  +RVD+NVP  + G+V D TRI   +PTI   +   AK+++ 
Sbjct: 1   MSKL-SIKDLQ-LSNKRVFMRVDFNVPLDENGRVTDDTRIRETLPTIEYALRHGAKLILC 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILH------KNILFVNDCIGSTLSQSIASLSEGGI 113
           SHLGRP+ K +   SL  V      +L       +N+ F  DCIG    +    L +G  
Sbjct: 59  SHLGRPKGKPNPKMSLKPVAERLRVMLDHAISPGQNVGFSPDCIGMQAQEMAKQLEKGQA 118

Query: 114 ILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRA 172
           +L ENVRF++EEE+NDP F + L+   + Y+NDAF  +HRAHAS  G++H +  S  G  
Sbjct: 119 LLLENVRFHAEEEKNDPAFAKELASLCELYVNDAFGSAHRAHASTEGITHYVEKSAAGLL 178

Query: 173 MQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQG 232
           MQKEL  L    S   KP VAI+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG
Sbjct: 179 MQKELDYLGKATSNPAKPFVAILGGAKVSDKIGVIQNLMAKVDAIIIGGGMAYTFLKAQG 238

Query: 233 MGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT-GIPTQVVSAQSVPLD 291
             +G+SL + D  D   QI  +A +   + ++P D V A +      P Q+   QS+P +
Sbjct: 239 QEIGKSLFEADKLDLAKQILADAHKRGLKFLLPVDHVTADKFDMHATPHQIGEGQSIPAE 298

Query: 292 SIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIIS 351
            + LD+G KTV    + IA+ART++WNGP+GVFE + F + T  +A  VA         S
Sbjct: 299 QMALDIGPKTVALFSEEIAKARTIVWNGPMGVFEFDNFAKGTRAIAKAVA---GNSGATS 355

Query: 352 IAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           I GGGD++ A+  AG++++ T++ST GGA LE+LEGK LPG+ AL+
Sbjct: 356 IVGGGDSVAAVHDAGVADKITHISTGGGASLEFLEGKKLPGVEALT 401


>gi|118481158|gb|ABK92531.1| unknown [Populus trichocarpa]
          Length = 401

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 253/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKGVTPK-YSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++ +L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DV+VA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|126649362|ref|ZP_01721603.1| phosphoglycerate kinase [Bacillus sp. B14905]
 gi|126593687|gb|EAZ87610.1| phosphoglycerate kinase [Bacillus sp. B14905]
          Length = 394

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 159/398 (39%), Positives = 250/398 (62%), Gaps = 7/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +TM D+ D++G R  +RVD+NVP  DG + D TRI   +PTI  LVE+ AKV++ S
Sbjct: 1   MLNKKTMKDI-DVKGKRVFVRVDFNVPMADGAITDETRIRAAIPTIEYLVEQGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKV-VSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLGRP+ +  +D  L  V + +AE ++ K +  +++ IG  + +++AS+ +G I+L ENV
Sbjct: 60  HLGRPKGEVKEDMRLTAVGIRLAE-LMSKPVTKLDESIGQAVEEAVASMQDGDILLLENV 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF++ EE+NDP   +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  MQ EL +
Sbjct: 119 RFHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGIAKHIPAVSGFLMQTELDV 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L    S  + P  AI+GG+KV  KI ++ +L++KVD L+IGGG++ +F+ AQG  +G+SL
Sbjct: 179 LGKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGLSFTFIKAQGYDIGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +       +AK    ++ +P D VVA E      T+VV   ++P D + LD+G 
Sbjct: 239 LEEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQDAETKVVDVDAIPADWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT  +  +VI  ++ ++WNGP+GVFE++ F   T  VA  +A  +      ++ GGGD+ 
Sbjct: 299 KTAAHYAEVIKNSKLIIWNGPMGVFEMDKFANGTKTVADAMATTSG----YTVIGGGDSA 354

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+    ++ +  ++ST GGA LE +EGK+LPGIVAL+
Sbjct: 355 AAVEKFEVATKMDHISTGGGASLELMEGKELPGIVALN 392


>gi|296126590|ref|YP_003633842.1| phosphoglycerate kinase [Brachyspira murdochii DSM 12563]
 gi|296018406|gb|ADG71643.1| Phosphoglycerate kinase [Brachyspira murdochii DSM 12563]
          Length = 399

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 158/399 (39%), Positives = 253/399 (63%), Gaps = 12/399 (3%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ D+ DI+G + ++RVD+NVP       K+ D TR++  +PTI  ++ + A +++ SH
Sbjct: 3   KTVKDI-DIKGKKVIMRVDFNVPLDKETSSKITDTTRVDAAMPTIEYILSQGACLILMSH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKN-ILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP+ + +   SL  V    ++ L  N + F  DCIG  + +  + L  G ++L EN+R
Sbjct: 62  LGRPKGEPNPKYSLKPVYDYLKTKLPNNKVEFAKDCIGEEVKKQASELKAGDVLLLENLR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL---LPSYIGRAMQKEL 177
           +++EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G+      +P+  G  M+KE+
Sbjct: 122 YHAEEEKNDPAFSKQLADLADVYVNDAFGTAHRAHASTAGIVSAKAGMPAVAGFLMEKEI 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L    +   +P VAI+GG+KVS+KI++L NL+ KVD L++ GGMA +FL AQG+ +G 
Sbjct: 182 KYLGDAVANPARPFVAIIGGAKVSSKISVLKNLLNKVDTLIVVGGMAYTFLKAQGLEIGS 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+     +I  +AK     + +P D V+A +       +VV + ++P   + +DV
Sbjct: 242 SLCEDDYISTAKEIMDKAKELNKTLYLPVDNVIADKFDNDANIKVVDSNAIPAGWMGMDV 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT++ ++ ++  A+TV+WNGPLGVFE+  F + T EVA ++A        +SI GGGD
Sbjct: 302 GPKTLKELEDILKNAKTVVWNGPLGVFEMSNFAKGTFEVAKFIA----NSDCVSIIGGGD 357

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +++A+  +G++++ T+VST GGA LE+LEG +LPGI  L
Sbjct: 358 SVSAVNKSGVADKMTHVSTGGGASLEFLEGIELPGIAVL 396


>gi|297842743|ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297335094|gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 401

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 166/400 (41%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   ++VV
Sbjct: 1   MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   ++  ND IG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY+EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+  VD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLSTVDILLLGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 240 SSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|323453579|gb|EGB09450.1| hypothetical protein AURANDRAFT_71305 [Aureococcus anophagefferens]
          Length = 978

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/378 (43%), Positives = 233/378 (61%), Gaps = 2/378 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G + L+R D NVP  DG + D TRI   VPT+  L+EK A V + SHLGRP+   + 
Sbjct: 268 DLKGKKVLIRCDLNVPLKDGVIGDDTRIRASVPTVKYLLEKGASVAMCSHLGRPKDGPED 327

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
             SL  V +     L K++    DCIG  ++  + SL EG  +L EN RFY EEE+N+  
Sbjct: 328 KFSLGPVSARMAECLGKDVKMAPDCIGDEVAAMVGSLGEGEAMLLENTRFYKEEEKNEAA 387

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKKP 190
           FV  L+   D ++NDAF  +HRAHAS  G++  L PS  G  + KEL  L     E  +P
Sbjct: 388 FVEKLAAPFDLFVNDAFGTAHRAHASTEGVTKFLSPSVSGYLLAKELKYLAGAVDEPVRP 447

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L AIVGGSKVS+KIT+L +L+ K DK++IGGGM  +FL A G  VG SL + DF D    
Sbjct: 448 LAAIVGGSKVSSKITVLESLINKCDKVIIGGGMTFTFLKAMGKPVGSSLVEDDFLDTAKA 507

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
               A+   CE+I P +++VA +      TQVV   S+P   + LD G K  + I++ +A
Sbjct: 508 AMKLAEEKGCELIFPSEILVADKFDAEANTQVVDQDSIPDGWMGLDNGPKATKEIQEKLA 567

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             +TV+WNGP+GVFEI+ F + T  +   +A+LT E+  ++I GGGD++ A+  AG++++
Sbjct: 568 DCKTVIWNGPMGVFEIDAFAKGTFAICDTLAELT-EKGCVTIIGGGDSVAAVEKAGLADK 626

Query: 371 FTYVSTAGGAFLEWLEGK 388
            +++ST GGA LE LEGK
Sbjct: 627 MSHISTGGGASLELLEGK 644


>gi|295697408|ref|YP_003590646.1| Phosphoglycerate kinase [Bacillus tusciae DSM 2912]
 gi|295413010|gb|ADG07502.1| Phosphoglycerate kinase [Bacillus tusciae DSM 2912]
          Length = 393

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 240/386 (62%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+   R  +RVD+NVP  DG++ D TRI   +PT+ +L+++ AK+++ SHLGRP+  +D 
Sbjct: 9   DVTHRRVFVRVDYNVPIKDGQITDDTRIRASLPTLEDLIQRGAKLILASHLGRPKGAADP 68

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
             SL  V +    +L + + F    +G  L++    +  G ++L ENVRF+  E RNDP+
Sbjct: 69  AYSLAPVAAHLSRLLRRPVAFPGRVVGPELAEFAQRMQPGEVLLLENVRFHPGETRNDPE 128

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             R  +   + Y++DAF  +HRAHAS  G++  LP+Y G  M KE+++L    +  ++P 
Sbjct: 129 LARSWADLAELYVSDAFGTAHRAHASTVGVAEHLPAYAGYLMDKEITVLSRVLTAPQRPF 188

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VA++GG+K+  KI ++  L++KVD L++GGG+AN+FL A+G  VG SL + D  D   ++
Sbjct: 189 VAVIGGAKIKDKIGVIERLLQKVDVLLLGGGLANTFLAAKGFDVGASLYEPDNVDVARRL 248

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A+    ++++P DVV A   +   P ++V   S+P  S  LD+G KTVE  ++ +  
Sbjct: 249 LEQAELQGTKLLLPVDVVTAPAPEPDAPREIVDISSIPDGSQALDIGPKTVEQYRRELLS 308

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           AR ++WNGP+GVFE+ PF   T  VA  VA    E    S+ GGGD++ A+  AG+++  
Sbjct: 309 ARLILWNGPMGVFEVPPFAEGTYAVARAVADSEAE----SVIGGGDSLAAIEGAGLAHRI 364

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE+LEGK LPG+  L 
Sbjct: 365 SHLSTGGGATLEFLEGKILPGVAVLQ 390


>gi|297583418|ref|YP_003699198.1| phosphoglycerate kinase [Bacillus selenitireducens MLS10]
 gi|297141875|gb|ADH98632.1| Phosphoglycerate kinase [Bacillus selenitireducens MLS10]
          Length = 394

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 242/386 (62%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  +G+V D TRI   +PTI  LVEK AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKRVFCRVDFNVPMSEGQVTDDTRIRAAIPTIELLVEKGAKVILASHLGRPKGQVAE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           D  L  V      ++ K +  V++ +GS   +++  L EG ++L ENVRF + EE+ND +
Sbjct: 70  DLRLDPVAKRLSDLMQKEVYKVDEVVGSDAEKAVNGLEEGDVVLLENVRFEAGEEKNDAE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             + ++   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L    +  ++P 
Sbjct: 130 LAKQMAALADVYVNDAFGAAHRAHASTEGIAKHIPAVAGLLMEKELEVLGKAMANPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A+G  +G SL + D  D   Q 
Sbjct: 190 TAIIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFIKAKGYEIGTSLLEEDKIDLAKQF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A+++     +P D V+A+E    +    V    +P D + LD+G KT+E  ++VI++
Sbjct: 250 MEKAEKNNVNFYMPVDAVIAKEFGADVEADTVDIDKIPADQMSLDIGPKTLETYRKVISE 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           +R V+WNGP+GVFE E F   T  VA  +A+      +I   GGGD+  A+    ++++ 
Sbjct: 310 SRLVIWNGPMGVFEFEKFAAGTKGVAEALAEAENAYSVI---GGGDSAAAVEKFHLADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+VAL+
Sbjct: 367 SHISTGGGASLEFIEGKELPGVVALN 392


>gi|33239673|ref|NP_874615.1| phosphoglycerate kinase [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|46576741|sp|Q7VDZ4|PGK_PROMA RecName: Full=Phosphoglycerate kinase
 gi|33237198|gb|AAP99267.1| 3-phosphoglycerate kinase [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 402

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 251/396 (63%), Gaps = 5/396 (1%)

Query: 5   RTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           R++++L   D+ G R L+RVD+NVP  + G + D TRI   +PTI  L+EK+A+V++ +H
Sbjct: 4   RSLSNLSVEDLCGKRVLVRVDFNVPLNEEGSITDDTRIRAALPTIQHLIEKEARVILSAH 63

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ K ++D  L  V      +L K ++    CIG    + +  +S G ++L ENVRF
Sbjct: 64  FGRPKGKVNEDMRLTPVSQRLSELLGKTVVKTESCIGPDAEKKVHEMSNGDVVLLENVRF 123

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
             EEE+ND +F + L+   + Y+NDAF  +HRAHAS  G+++ L PS  G  M+KEL  L
Sbjct: 124 IGEEEKNDSEFAKKLASLAEVYVNDAFGAAHRAHASTEGVTNYLSPSVAGYLMEKELKYL 183

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      ++PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+SL 
Sbjct: 184 QGAIDSPQRPLAAIVGGSKVSSKIGVLESLIDKCDKVLIGGGMIFTFYKARGLSVGKSLV 243

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +  +AK    ++++P DVV+A        +Q+V   S+P   + LD+G +
Sbjct: 244 EDDKLDLARALEKKAKEKGVQLLLPSDVVLADNFSPDASSQMVQIDSIPEGWMGLDIGKE 303

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+  +  +A  +TV+WNGP+GVFE + F   T  ++  +A+L+  +   +I GGGD++ 
Sbjct: 304 SVKLFQDALADCKTVIWNGPMGVFEFDKFANGTNSISTTLAELSA-KGCCTIIGGGDSVA 362

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 363 AVEKAGLASKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|224101333|ref|XP_002312237.1| predicted protein [Populus trichocarpa]
 gi|222852057|gb|EEE89604.1| predicted protein [Populus trichocarpa]
          Length = 401

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 252/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKGVTPK-YSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++ +L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DV+VA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  ++    + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSITTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|225464995|ref|XP_002263796.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
 gi|147843756|emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
          Length = 478

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/396 (40%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +RVD NVP  D  K+ D TR+   +PTI  L++  AKV++ SH
Sbjct: 77  KSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVILSSH 136

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   I+  +DCIG  + + + +L +GG++L ENVRF
Sbjct: 137 LGRPKGVTPK-FSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLENVRF 195

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 196 YKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 255

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 256 VGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 315

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D       +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 316 EEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 375

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE + F   TV VA  +A+L+  + + +I GGGD++ 
Sbjct: 376 SIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKKLAELSG-KDVTTIIGGGDSVA 434

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 435 AVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 470


>gi|228472847|ref|ZP_04057604.1| phosphoglycerate kinase [Capnocytophaga gingivalis ATCC 33624]
 gi|228275429|gb|EEK14206.1| phosphoglycerate kinase [Capnocytophaga gingivalis ATCC 33624]
          Length = 395

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 163/397 (41%), Positives = 241/397 (60%), Gaps = 6/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND+   +G + L+RVD+NVP  +  ++ D TRIE   PTI+++V      ++ SH 
Sbjct: 1   MKTINDIS-CKGKKVLVRVDFNVPVNEQFEITDTTRIEAAKPTIMKIVRDGGSAILLSHF 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K DK  S   +V     +L     F  DCIG     +  +L  G ++L ENVRFY
Sbjct: 60  GRPKGKDDK-YSFSHLVKQIGQVLGLPTHFSPDCIGDVAENTAKNLPVGEVLLLENVRFY 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP--SYIGRAMQKELSML 180
            EEE+ D  F   L++ GD Y+NDAF  +HRAHAS T L+   P   Y G  + KE+  +
Sbjct: 119 PEEEKGDEAFAAKLAKLGDIYVNDAFGTAHRAHASTTILAKFFPHDKYFGYLLAKEIESI 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP+ AI+GGSKVS+KIT++ N++ K+D L+IGGGMA +F+ AQG  +G S+C
Sbjct: 179 DKVMKSGEKPVTAILGGSKVSSKITIIENILDKIDHLIIGGGMAFTFVKAQGGQIGNSIC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK    ++ +P DV+ A +      TQ+V    +P     LD G K
Sbjct: 239 EEDKLDLALDILKKAKEKGVQVHLPVDVIAANDFNNNASTQLVPVDQIPNGWQGLDAGEK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++E  K+VI  ++T++WNGP+GVFE+  F + T+ V  +VA+ T  +   S+ GGGD++ 
Sbjct: 299 SLEIFKKVILASKTILWNGPVGVFEMPNFAKGTIAVGEFVAEAT-AKGAFSLVGGGDSVA 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G  N+ +YVST GGA LE LEGK LPGI A++
Sbjct: 358 AVKQFGFENKVSYVSTGGGAMLESLEGKILPGIKAIN 394


>gi|157412552|ref|YP_001483418.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9215]
 gi|166987796|sp|A8G2K1|PGK_PROM2 RecName: Full=Phosphoglycerate kinase
 gi|157387127|gb|ABV49832.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9215]
          Length = 402

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 160/400 (40%), Positives = 248/400 (62%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV++
Sbjct: 1   MSKLSLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ + ++   L  V +    +L +N+   N CIG        SLS G ++L EN
Sbjct: 61  AAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAIAQSNSLSNGDVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRF+ EEE+ND +F + L+ + D YINDAF  +HRAHAS  G+++ L PS  G  ++KEL
Sbjct: 121 VRFFGEEEKNDLEFAKKLASHADMYINDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAIDSPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D       +  +AK    E+++P DVV+A E      +++    S+  + + LD+
Sbjct: 241 SLVEEDKLKLAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISRIDSISGNWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPDSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSAFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|297736144|emb|CBI24182.3| unnamed protein product [Vitis vinifera]
          Length = 405

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/396 (40%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +RVD NVP  D  K+ D TR+   +PTI  L++  AKV++ SH
Sbjct: 4   KSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVILSSH 63

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   I+  +DCIG  + + + +L +GG++L ENVRF
Sbjct: 64  LGRPKGVTPK-FSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLENVRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 123 YKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 182

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 183 VGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 242

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D       +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 243 EEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 302

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE + F   TV VA  +A+L+  + + +I GGGD++ 
Sbjct: 303 SIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKKLAELSG-KDVTTIIGGGDSVA 361

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 362 AVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 397


>gi|323488682|ref|ZP_08093924.1| phosphoglycerate kinase [Planococcus donghaensis MPA1U2]
 gi|323397700|gb|EGA90504.1| phosphoglycerate kinase [Planococcus donghaensis MPA1U2]
          Length = 394

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 242/397 (60%), Gaps = 5/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +  TM DL D++G R   RVD+NVP  +GKV D TRI   VPTI  LVE+ AKV++ S
Sbjct: 1   MQQKMTMKDL-DLKGKRVFCRVDFNVPMSEGKVTDDTRIRAAVPTIEYLVEQGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + +++  +         +LHK +  +N+ IG  + + I+S+ EG I+L ENVR
Sbjct: 60  HLGRPKGEVNEEMRIAATGVRLGELLHKEVKSLNESIGEEVEKEISSMQEGDIVLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LPS  G  ++KEL +L
Sbjct: 120 FHAGEEKNDEELSKAFASLADVFVNDAFGAAHRAHASTAGIASHLPSVSGLLLEKELDVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               SE  +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG++ +F+ AQG  +G SL 
Sbjct: 180 GKALSEPDRPFTAIIGGAKVKDKIGVIDHLLDKVDNLIIGGGLSYTFIKAQGYEIGDSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D  +    +AK+   +  +P D  VA E      T+ V    +P D + LD+G +
Sbjct: 240 EEDKLDLANSFIEKAKQKGVKFYLPVDATVANEFSKDAETKSVKITEIPADWMGLDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV     VI  ++ ++WNGP+GVFE+  F+  T  VA  +A    E    ++ GGGD+  
Sbjct: 300 TVALYSDVIKNSKLIIWNGPMGVFEMPAFENGTKSVAKAMA----ETSGYTVIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+    ++ +  ++ST GGA LE++EGKDLPG+ AL+
Sbjct: 356 AVEKFDVAEKMDHISTGGGASLEFMEGKDLPGVSALT 392


>gi|1346698|sp|P29409|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|21272|emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
          Length = 433

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/397 (40%), Positives = 246/397 (61%), Gaps = 6/397 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV++ SH
Sbjct: 32  KSVGDLTSADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLINNGAKVILSSH 91

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  + + +A L EGG++L ENVRF
Sbjct: 92  LGRPKGVTPK-FSLAPLVPRLSELLGLQVVKADDCIGPDVEKLVAELPEGGVLLLENVRF 150

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 151 YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 210

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQGM VG SL 
Sbjct: 211 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGMSVGSSLV 270

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +  +AK     +++P DVV+A +      +++V A  +P   + LD+G  
Sbjct: 271 EEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAADADSKIVPASGIPDGWMGLDIGPD 330

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE E F   T  +A  + +++K +   +I GGGD++ 
Sbjct: 331 SIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKKLEEISK-KGATTIIGGGDSVA 389

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+   G++   +++ST GGA LE LEGK LPG++AL+
Sbjct: 390 AVEKVGVAEAMSHISTGGGASLELLEGKQLPGVLALN 426


>gi|160947584|ref|ZP_02094751.1| hypothetical protein PEPMIC_01519 [Parvimonas micra ATCC 33270]
 gi|158446718|gb|EDP23713.1| hypothetical protein PEPMIC_01519 [Parvimonas micra ATCC 33270]
          Length = 398

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 166/394 (42%), Positives = 248/394 (62%), Gaps = 10/394 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI---DGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           + + DL ++R  R ++RVD+NVP     +GK+ D  RI   +PTI  L+E  AKV++ SH
Sbjct: 4   KVITDL-EVRSKRVIVRVDFNVPMSKTEEGKITDNARIVAALPTIKYLIENNAKVILLSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFV--NDCIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ ++ K+ SL  V      +L+K++ F+  N  +   +   +  L +G + L EN 
Sbjct: 63  LGRPKGEAKKEFSLAPVAKELSKLLNKDVKFLQSNLVVDDNVKDEVLKLKDGEVALLENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF +EE +N  DF + L+  G+ YINDAF  SHRAH S  GL   LPS +G  ++KE+S+
Sbjct: 123 RFRNEETKNIDDFSKELAELGELYINDAFGTSHRAHCSNVGLCKFLPSAVGFLVEKEISI 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +    S  ++P VAI+GG+KVS KIT++ NL++KVD ++IGGGMA +FL + G  VG+SL
Sbjct: 183 MGKALSNPERPFVAILGGAKVSDKITVIENLIEKVDSIIIGGGMAFTFLKSLGYSVGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +AK    +I++P DVVV++E       ++V+  S+  D + LD+G 
Sbjct: 243 LEDDKVDFAKELIEKAKSKNVKILLPIDVVVSKEFSNDSEFKIVNIDSIGDDYMGLDIGE 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KTV+     I  A+TV+WNGP+GVFE+  F + T E+A  +A    E   ISI GGGD+ 
Sbjct: 303 KTVKLFSDEINNAKTVVWNGPMGVFEMSNFAKGTFEIAKAIA----ESEAISIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           +A   +G  ++ T++ST GGA LE+LEGK LPGI
Sbjct: 359 SAAEKSGYKDKITHISTGGGASLEFLEGKILPGI 392


>gi|217077667|ref|YP_002335385.1| phosphoglycerate kinase [Thermosipho africanus TCF52B]
 gi|226699807|sp|B7IDG7|PGK_THEAB RecName: Full=Phosphoglycerate kinase
 gi|217037522|gb|ACJ76044.1| pgk phosphoglycerate kinase [Thermosipho africanus TCF52B]
          Length = 402

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 249/398 (62%), Gaps = 4/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ D++G R ++RVD+NVP  DG++ D TRI   +PTI   +E  A V++ S
Sbjct: 1   MEKL-TIRDI-DLKGKRVIMRVDFNVPMKDGEITDDTRIVEALPTIKYAIENGAIVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + F+ +  G  +++ + +  EG +IL EN R
Sbjct: 59  HLGRPKGERKPEFSLLPVAKRLSELLGKEVTFIPELYGEIVNEKVKNAKEGDVILLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FDKGETKNDPELAKKWAELADIHVNDAFGTAHRAHASNVGIAQYIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  +KP V ++GG+KVS KI ++ NL+ K DK++IGG M  +FL + G  VG SL 
Sbjct: 179 SKATTNPEKPYVVVLGGAKVSDKIGVITNLLDKADKILIGGAMMFTFLKSLGYNVGSSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   +I  +AK    EI++P D V A++++ G+ T+ +  +  +P   + LD+G 
Sbjct: 239 EDDKLDLAKRILEQAKEKGTEIVLPVDTVCAQKIEAGVETKTIDIKDGLPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KTVE  +  I+ A+T++WNGP+GVFEIE F   T EVA  +A+ T  +   +I GGGD+ 
Sbjct: 299 KTVELFRNSISGAKTIVWNGPMGVFEIEDFSNGTKEVAIAIAEET-SKGATTIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+A  G+ ++ ++VST GGA LE+LEGK+LPGI +++
Sbjct: 358 AAIAKFGLKDKVSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|325294326|ref|YP_004280840.1| phosphoglycerate kinase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325064774|gb|ADY72781.1| Phosphoglycerate kinase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 404

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 244/394 (61%), Gaps = 10/394 (2%)

Query: 10  LRDI-----RGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           LRDI     +G +  +RVD+NVP  +G + +  RI   +PTI  L++ KAKV++ SHL R
Sbjct: 12  LRDISPEKLKGKKVFVRVDFNVPLENGVIQNDKRIRAALPTINYLIDHKAKVILCSHLDR 71

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+   D   SL  V      +L K + F+ DC+G  +   + +L EG + L ENVRFY E
Sbjct: 72  PEG-WDPKLSLKPVADRLSRLLEKEVKFIPDCVGEEVEWEVNNLKEGEVALLENVRFYKE 130

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSMLESC 183
           E +NDP+F + L++  D Y+NDAF  +HR HAS  G++  +  +  G  ++KE+  L+  
Sbjct: 131 ETKNDPEFAKKLAKLADIYVNDAFGTAHRKHASTYGIAQYVEIAVAGFLLEKEIKYLQKA 190

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++PLV I+GGSKVS K+ ++ NL+K VDK++IGGGMA +FL A G  VG+SL + +
Sbjct: 191 LDNPERPLVLIIGGSKVSGKLEVIENLLKVVDKMLIGGGMAYTFLKAAGYNVGKSLVEEE 250

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   +I  +A+++  +  +P D   A E       ++ + + +P D + LD+G  TVE
Sbjct: 251 LLDTAKEIMEKAEKNGIKFYLPVDSNNADEFSPTAHAKLTTYKEIPDDMMGLDIGPATVE 310

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
             K+ ++ A+T++WNGP+GVFE E F   T+E+   VA   +  RI+   GGGD++ A+ 
Sbjct: 311 LFKEALSDAKTILWNGPMGVFEFEKFGYGTMEIGRIVASHAEALRIV---GGGDSVAAVE 367

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G+ ++  +VST GGAFLE+L GK+LPG++AL+
Sbjct: 368 ALGLEHQIDHVSTGGGAFLEFLAGKELPGVMALT 401


>gi|196249344|ref|ZP_03148042.1| Phosphoglycerate kinase [Geobacillus sp. G11MC16]
 gi|196211101|gb|EDY05862.1| Phosphoglycerate kinase [Geobacillus sp. G11MC16]
          Length = 394

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 241/393 (61%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ ++RG R   RVD+NVP  DG + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-EVRGKRVFCRVDFNVPMEDGAITDDTRIRAALPTIQYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + ++  N+ IG  +  ++A+L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVVKTNEAIGDEVKAAVANLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  R  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L    
Sbjct: 123 EEKNDPELARAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV   ++P D   LD+G +T E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPSDWEALDIGPQTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI Q++ V+WNGP+GVFE+E F   T  VA  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRQSKLVVWNGPMGVFEMETFSHGTRAVAEALAEAAD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             ++++  ++ST GGA LE++EGK LPG+VAL+
Sbjct: 360 FDLADKMDHISTGGGASLEFMEGKQLPGVVALN 392


>gi|320106577|ref|YP_004182167.1| phosphoglycerate kinase [Terriglobus saanensis SP1PR4]
 gi|319925098|gb|ADV82173.1| Phosphoglycerate kinase [Terriglobus saanensis SP1PR4]
          Length = 406

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 252/407 (61%), Gaps = 15/407 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFI-DG-KVADVTRIERVVPTILELVEKKAKVVI 58
           M++L ++ DL D+   R L+RVD+NVP   DG ++ D TRI   +PTI   + ++AKV++
Sbjct: 1   MAKL-SIRDL-DLNNKRVLIRVDFNVPLSKDGTEILDDTRIRETLPTIEYAIRRRAKVIL 58

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHK------NILFVNDCIGSTLSQSIASLSEGG 112
            +HLGRP+ K   + SL  VV    +++        N+ F  DC+G   ++ +  L  G 
Sbjct: 59  AAHLGRPKGKPVAEMSLRPVVDRLRNLIDHEMGESFNVGFAPDCVGEIATELVRQLESGQ 118

Query: 113 IILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGR 171
           ++L EN+RF+ EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++H +  S  G 
Sbjct: 119 VLLLENLRFHPEEEKNDPGFAKKLAALCDIYVNDAFGAAHRAHASTEGITHFVAQSAAGL 178

Query: 172 AMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQ 231
            M+KEL+ L        KP VAI+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQ
Sbjct: 179 LMEKELNYLGKALQSPDKPFVAIIGGAKVSDKIGVIDNLLNKVDAIIIGGGMAYTFLNAQ 238

Query: 232 GMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPL 290
           G   G+SL + D  D       +A+    + ++P D ++A +      TQV    S  P 
Sbjct: 239 GQKTGKSLLEADKIDIAKAALKKAEEKGVKFLLPVDHILADKFAADARTQVFEGTSNFPE 298

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
           D + LD+G K++E     IA+ART++WNGP+GVFE+  F + T+ +AH VA  T     I
Sbjct: 299 DWMALDIGPKSIELFNAEIAEARTIVWNGPMGVFELPAFAKGTMAIAHAVADNTDA---I 355

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           SI GGGD+++A+  A +++  T++ST GGA LE+LEGK LPG+ ALS
Sbjct: 356 SIVGGGDSVSAVHAAEVTDRITHISTGGGASLEFLEGKTLPGVAALS 402


>gi|15219412|ref|NP_178073.1| PGK (PHOSPHOGLYCERATE KINASE); phosphoglycerate kinase [Arabidopsis
           thaliana]
 gi|30699430|ref|NP_849907.1| PGK (PHOSPHOGLYCERATE KINASE); phosphoglycerate kinase [Arabidopsis
           thaliana]
 gi|4835754|gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs
           gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140,
           gb|T46295, gb|H37082, gb|T46076, gb|N37132, gb|AA597649,
           gb|AI100648 and gb|Z48462 come from this gene
           [Arabidopsis thaliana]
 gi|7839393|gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gi|13194782|gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|17065574|gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gi|30725646|gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gi|332198141|gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|332198142|gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 401

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 249/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   ++VV
Sbjct: 1   MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   ++  ND IG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKE 176
           NVRFY+EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  MQKE
Sbjct: 120 NVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHASTEGVAKFLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+  VD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 240 SSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|159027867|emb|CAO89670.1| pgk [Microcystis aeruginosa PCC 7806]
          Length = 402

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 158/388 (40%), Positives = 248/388 (63%), Gaps = 4/388 (1%)

Query: 12  DIRGLRCLLRVDWNVPF--IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKS 69
           D+ G R L+RVD+NVP     G ++D TRI   +PTI +L++K AKV++ SH+GRP  + 
Sbjct: 13  DLAGKRVLVRVDFNVPMDKATGAISDDTRIRAALPTIEDLIKKGAKVILCSHMGRPDGQV 72

Query: 70  DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERND 129
            ++  L  V      +L + ++   DCIG  ++ +I+ +S G + L EN+RF+ EEE ND
Sbjct: 73  KENLRLTPVAKRLSELLGQEVIMCPDCIGEGVTAAISQMSNGQVALLENLRFHGEEEAND 132

Query: 130 PDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESK 188
           PDF + L+ N D Y+NDAF  +HRAHAS  G++H L PS  G  ++KEL+ L++     +
Sbjct: 133 PDFAKKLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKELNYLQAAIETPQ 192

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+SL + D  +  
Sbjct: 193 RPLAAIIGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKARGLSVGKSLVEEDKLELA 252

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             +  +AK      ++P DVV+A +      +Q+V+ +++P   + LD+G ++V+  ++ 
Sbjct: 253 KSLEAKAKEKGVAFLLPTDVVLADKFDKDANSQIVNVENIPDGWMGLDIGPESVKVFQEA 312

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           ++  ++V+WNGP+GVFE + F   T  +AH +A LT       I  GGD++ A+   G++
Sbjct: 313 LSNCKSVLWNGPMGVFEFDKFAAGTDAIAHTLADLTATGTTTIIG-GGDSVAAVEKVGVA 371

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            + +++ST GGA LE LEGK LPGI AL
Sbjct: 372 EKMSHISTGGGASLELLEGKVLPGIAAL 399


>gi|110598566|ref|ZP_01386834.1| Phosphoglycerate kinase [Chlorobium ferrooxidans DSM 13031]
 gi|110339800|gb|EAT58307.1| Phosphoglycerate kinase [Chlorobium ferrooxidans DSM 13031]
          Length = 397

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 165/389 (42%), Positives = 247/389 (63%), Gaps = 7/389 (1%)

Query: 13  IRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           I+G R L+RVD+NVP    K + D  RI   +P+I ++++   ++++ SHLGRP+ K + 
Sbjct: 11  IQGKRILMRVDFNVPLDASKNITDDKRIVESLPSIRKVLDDGGRLILMSHLGRPKGKVNA 70

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           D SL  V      ++   +    D IG+ + Q + ++ +G +IL EN+RF+ EEE NDPD
Sbjct: 71  DFSLAPVAKRLSELIDTPVTMAKDSIGTEVMQQVLAMQDGEVILLENLRFHPEEEANDPD 130

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLESCFSESKKP 190
           F + L+  G+ Y+NDAF  +HRAHAS  G++H + S + G  +++EL  L     + ++P
Sbjct: 131 FAKELASLGEIYVNDAFGTAHRAHASTEGITHYVQSAVAGFLIERELLYLGKALQDPERP 190

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
            VAI+GGSK+S KI +L NL KKVD ++IGG M  +F  AQG  VG SL +    +   +
Sbjct: 191 FVAILGGSKISGKIDVLENLFKKVDTVLIGGAMVFTFFKAQGYEVGNSLVEESKIELALE 250

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIP--TQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
           I  EAKR   ++++P DV+VA  +       T+++SA  +P   I +D+G KT E   + 
Sbjct: 251 ILAEAKRKGIKLLLPEDVIVAPAISADAEFRTELISA--IPEGMIGVDIGPKTAELYSRE 308

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           I  ARTV+WNGP+GVFEI+ F   T+ VA  +A  T  +  I+I GGGD+ +A+A AG++
Sbjct: 309 ILSARTVLWNGPMGVFEIDNFASGTMAVAKALADATA-KGAITIVGGGDSASAIAKAGLA 367

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            E T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 368 KEITHISTGGGASLEFLEGKELPGIAALN 396


>gi|311031865|ref|ZP_07709955.1| phosphoglycerate kinase [Bacillus sp. m3-13]
          Length = 394

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 238/386 (61%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  DG+V D TRI   +PTI  LV+  AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKRVFCRVDFNVPMKDGQVTDETRIRAALPTIKHLVDNGAKVLLASHLGRPKGQVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +  + +L K++   ++  G ++   +  +SEG ++L ENVRFY  EE+NDP+
Sbjct: 70  ELRLNAVAARLQELLGKDVKKADEAYGDSVKAIVNDMSEGDVLLLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKAFAELADVYVNDAFGAAHRAHASTEGIAQHLPAVAGLLMEKELEVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A+G  VG+SL + D  D     
Sbjct: 190 TAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLAYTFIKAKGYDVGKSLLEEDKIDLAKSF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK     + +P DVVVA +      T++V  + +P D   LD G K+ E    VI  
Sbjct: 250 MEQAKEKGVNMYMPVDVVVADDFSNDANTKIVPIEEIPSDWEGLDCGPKSREIYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE++ F   T  V   +A+ T    +I   GGGD+  A+    ++++ 
Sbjct: 310 SKLVIWNGPMGVFELDAFAGGTKAVGEALAEATDTYSVI---GGGDSAAAVEKFNLADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG++AL+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVLALN 392


>gi|160902889|ref|YP_001568470.1| phosphoglycerate kinase., Triose-phosphate isomerase [Petrotoga
           mobilis SJ95]
 gi|160360533|gb|ABX32147.1| Phosphoglycerate kinase., Triose-phosphate isomerase [Petrotoga
           mobilis SJ95]
          Length = 655

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 162/398 (40%), Positives = 251/398 (63%), Gaps = 4/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ D++G + ++RVD+NVP  DGK+ D TRI   + TI   ++K AKV++ S
Sbjct: 1   MEKL-TIKDV-DLKGKKVIMRVDFNVPIKDGKITDETRIVAALDTIQYALDKGAKVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + D   SL  V      +L+  + FV++  G  + ++++ L EG +++ EN R
Sbjct: 59  HLGRPKGEKDPQFSLKPVADRLGELLNNKVYFVDETRGPKVEEAVSELKEGEVLVLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FEKGETKNDPELAKYWASLADLHVNDAFGTAHRAHASNVGIADYIPSVAGFLMEKEIEFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP V I+GG+KVS KI ++ NL+ K DK++IGG M  +FL A    VG SL 
Sbjct: 179 QKAVENPEKPYVVILGGAKVSDKIGVINNLLNKADKILIGGAMMFTFLKALDKKVGSSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   +I   AK    EI++P D V+A++++ G+  + V     +P   + LD+G 
Sbjct: 239 EEDKLDVAKEILENAKAKGVEIVLPIDAVIAQKIEAGVEKKTVKIDDGIPEGWMGLDIGL 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TV   K+ I+ ++T++WNGP+GVFEI+ F   T EVA  +A++TK +  ISI GGGD+ 
Sbjct: 299 ETVSLFKEKISDSKTIVWNGPMGVFEIDDFAFGTEEVAKAIAEVTK-KGCISIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A    G+++EF++VST GGA LE+LEG +LPGI ++S
Sbjct: 358 AAAEKFGLASEFSHVSTGGGASLEFLEGIELPGISSIS 395


>gi|312880200|ref|ZP_07740000.1| phosphoglycerate kinase [Aminomonas paucivorans DSM 12260]
 gi|310783491|gb|EFQ23889.1| phosphoglycerate kinase [Aminomonas paucivorans DSM 12260]
          Length = 396

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 165/393 (41%), Positives = 243/393 (61%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           LRT +   D+RG R LLRVD+NVP  DG+V D TRI   + T+  L    A+V + SHLG
Sbjct: 3   LRTFSP-EDVRGKRVLLRVDFNVPMKDGRVTDGTRIRAHLETLNALRSAGARVALVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + D SL  V      I    +    DCIG  +++++ +L  GG++L ENVRFY 
Sbjct: 62  RPKGKRNPDYSLAPVAEELRRITGWEVGMAEDCIGPEVARAVEALPAGGLLLLENVRFYP 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F R L+   D ++ DAFS +HRAHAS  G++ LLPS+ G  M  E+  L   
Sbjct: 122 EEEKNDPAFSRQLAAPFDVFVMDAFSAAHRAHASTRGVADLLPSFAGSLMVGEVQALSQV 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P   I+GG+KVS KI ++ N++ +V  +++GGGMA +FL AQG  +GRSLC+ D
Sbjct: 182 RDHPEPPFFLILGGAKVSDKIGVIENMLDRVSGILVGGGMAFTFLKAQGREIGRSLCEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D   ++   A      I++P DVVVA E++ G+P+ VV A  +P  ++ LD+G  T  
Sbjct: 242 KLDFSREMLAVAAERGLPILLPEDVVVAEEIREGVPSSVVPADRIPSGTMGLDIGPATQA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
             ++ + +ART++WNGP+GVFE+E F + +  VA  +    + R  +++ GGGD+  A+A
Sbjct: 302 RFRETLREARTILWNGPMGVFEMEAFAQGSRSVAQDLVA-ARARGAVTVVGGGDSAAAVA 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G+ ++  +VST GGA LE+ EG+ LPG+  L
Sbjct: 361 LFGLEDQVGHVSTGGGASLEFFEGRMLPGVEPL 393


>gi|310826282|ref|YP_003958639.1| phosphoglycerate kinase [Eubacterium limosum KIST612]
 gi|308738016|gb|ADO35676.1| phosphoglycerate kinase [Eubacterium limosum KIST612]
          Length = 395

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 160/395 (40%), Positives = 243/395 (61%), Gaps = 8/395 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D++G + L+R D+NVP   DG + D TRI+  +PTI  ++++ A +++ SHLG
Sbjct: 3   KTVKDI-DLKGKKVLMRADFNVPLNEDGVITDDTRIQAALPTIKYILDQGASLILMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRF 121
           RP+++ D   SL  V      +L   ++F +D   +G     + A+L  G I+L +N RF
Sbjct: 62  RPKNEPDPKFSLLPVAKRLSEVLGTEVVFNDDGEVVGQVTKDAAAALKPGQILLLQNTRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EE++N+P F + L+  GD ++ DAF  SHRAHAS  G++  LP+  G  +QKEL  + 
Sbjct: 122 RPEEKKNEPSFAKELASLGDVFVEDAFGSSHRAHASTAGVADYLPAVSGFLIQKELDFIG 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + K+P VAI+GGSKVS KI ++ NL++KVD L++GGGMA +FL AQG  +G SL +
Sbjct: 182 GALEDPKRPFVAILGGSKVSDKIGVINNLLEKVDSLIVGGGMAFTFLKAQGYEIGTSLLE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   ++  +A+    ++++P DVVVA E K   P   V   ++P D + LD+G +T
Sbjct: 242 EDKIDLAKELLAKAEAKGVKLLLPIDVVVAPEFKADAPATNVKVDAIPADQMGLDIGVET 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +     I  A+TV+WNGP+GVFE   F + TV VA  +A    E   ++I GGGD+  A
Sbjct: 302 QKLFADTIKGAKTVIWNGPMGVFEFPEFAKGTVAVAKAMA----ESDAVTIIGGGDSAAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G  +  +++ST GGA LE++EGK LPGI  L
Sbjct: 358 VKQLGFEDGMSHISTGGGASLEFMEGKVLPGIDVL 392


>gi|225848311|ref|YP_002728474.1| phosphoglycerate kinase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643736|gb|ACN98786.1| phosphoglycerate kinase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 399

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 159/394 (40%), Positives = 242/394 (61%), Gaps = 7/394 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D+ D+ G R  +RVD+NVP  + G + D  RI   +PTI  L+++ AK+++ SHLGR
Sbjct: 7   TLKDV-DVSGKRVFVRVDYNVPLDEYGNIVDDVRIRETIPTINYLLDRNAKIILASHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K D   SL+ V    E +L K + F+ DCIG  + + + ++ EG IIL EN+RF+ E
Sbjct: 66  PKGKPDPKYSLYPVAKRLERLLGKEVKFLPDCIGKEVEEVVFNMKEGDIILLENLRFHKE 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESC 183
           EE NDPDF + L+   + Y+ DAF   HR H+S+ G+   + P  +G  +++EL      
Sbjct: 126 EETNDPDFAKKLASLAEIYVIDAFGTCHRKHSSVYGIKDFIQPVVMGFLLERELEYFRKA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA +GGSKVS+K+ ++  L+ KVDK+ IGG MA +F+ A G  VG SL + D
Sbjct: 186 LLNPQRPVVAFLGGSKVSSKLGVIEFLIDKVDKIFIGGAMAFTFIKAMGYNVGSSLVEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   +I  +AK+   +  +P D V  + +    P   V  Q +P   + LD+G  ++ 
Sbjct: 246 MLEKALEIIEKAKQKDVKFYLPVDFVCGQAVSDQTPVIEVPWQEIPKGWLGLDIGHASIV 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            IK+++   +T++WNGP+GVFEIE F   T E+AH +A    E   +SIAGGGDT  A+ 
Sbjct: 306 LIKEILKDVQTIVWNGPMGVFEIEKFKMGTFELAHAIA----ESPALSIAGGGDTDYAIH 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG+ ++ +Y+ST GGAFLE LEGK LP + A++
Sbjct: 362 KAGVVDKISYLSTGGGAFLELLEGKQLPCLQAIT 395


>gi|297847996|ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297337721|gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 478

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 250/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV++ +H
Sbjct: 77  KSVGDLTSADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTH 136

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  +   +ASL EGG++L ENVRF
Sbjct: 137 LGRPKGVTPK-FSLAPLVPRLSELLGIEVVKADDCIGPQVESLVASLPEGGVLLLENVRF 195

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 196 YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 255

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 256 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 315

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 316 EEDKLELATSLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 375

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE E F + T  VA+ +A+L+K + + +I GGGD++ 
Sbjct: 376 SVKTFNEALDTTQTVIWNGPMGVFEFEKFAQGTEAVANKLAELSK-KGVTTIIGGGDSVA 434

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   +++ST GGA LE LEGK LPG+V L
Sbjct: 435 AVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVVL 470


>gi|254526173|ref|ZP_05138225.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9202]
 gi|221537597|gb|EEE40050.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9202]
          Length = 402

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 159/400 (39%), Positives = 247/400 (61%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV++
Sbjct: 1   MSKLSLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ K ++   L  V +     L +N+   N CI         SLS G ++L EN
Sbjct: 61  AAHFGRPKGKVNEKMRLTPVAARLSEFLGQNVALTNSCIDDEAIAQSNSLSNGDVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRF+ EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G+++ L PS  G  ++KEL
Sbjct: 121 VRFFGEEEKNDLEFAKKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAIDSPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DVV+A E      +++    S+  + + LD+
Sbjct: 241 SLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISQIDSISGNWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPDSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSAFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|3738257|dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
          Length = 401

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 252/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKSVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKGVTPK-YSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++ +L P+  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVVVA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|15230595|ref|NP_187884.1| PGK1 (PHOSPHOGLYCERATE KINASE 1); phosphoglycerate kinase
           [Arabidopsis thaliana]
 gi|75273138|sp|Q9LD57|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags:
           Precursor
 gi|7839389|gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gi|13430644|gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|16226508|gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|11994421|dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|15010644|gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|16648943|gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|17065610|gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|20334796|gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|21387107|gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|22022520|gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|110742702|dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 gi|222423303|dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gi|332641725|gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
          Length = 481

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/396 (41%), Positives = 249/396 (62%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV++ +H
Sbjct: 80  KSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTH 139

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   +   +DCIG  +   +ASL EGG++L ENVRF
Sbjct: 140 LGRPKGVTPK-FSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRF 198

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 199 YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 258

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 259 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 318

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++  +AK     +++P DVVVA +      +++V A  +    + LD+G  
Sbjct: 319 EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD 378

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE+E F   T  +A+ +A+L+ E+ + +I GGGD++ 
Sbjct: 379 SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELS-EKGVTTIIGGGDSVA 437

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   +++ST GGA LE LEGK LPG++AL
Sbjct: 438 AVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|86605036|ref|YP_473799.1| phosphoglycerate kinase [Synechococcus sp. JA-3-3Ab]
 gi|123507822|sp|Q2JXF0|PGK_SYNJA RecName: Full=Phosphoglycerate kinase
 gi|86553578|gb|ABC98536.1| phosphoglycerate kinase [Synechococcus sp. JA-3-3Ab]
          Length = 412

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/398 (41%), Positives = 241/398 (60%), Gaps = 14/398 (3%)

Query: 12  DIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G R L+R D+NVP    G + D TRI   +PTI  L +  AKV++ SHLGRP  K D
Sbjct: 15  DLKGKRVLVRADFNVPLDPQGNITDDTRIRASLPTIQALAQAGAKVILTSHLGRPIQK-D 73

Query: 71  KDCSLFKVVSIAESI----------LHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           K     ++     S+          L + + F  DCIG      ++SL  G + L ENVR
Sbjct: 74  KATGAIQIAREGNSLAPVAVRLAQLLGQPVAFAPDCIGPEAEAVVSSLENGQVALLENVR 133

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSM 179
           F+ EEE NDP+F R L+   D ++NDAF  +HRAHAS  G++ +L P+  G  ++KEL  
Sbjct: 134 FHPEEEANDPEFARKLASLADLFVNDAFGSAHRAHASTAGVTAYLQPAVAGYLVEKELQF 193

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL AI+GGSKVSTKI ++  L++KVDKL++GGGM  +F  AQG+  G+SL
Sbjct: 194 LSGAIENPQRPLAAIIGGSKVSTKIGVIERLLEKVDKLLLGGGMIFTFYQAQGIPTGKSL 253

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D    +  +AK    E+++P DVVVA         Q VS  ++P D + LD+G 
Sbjct: 254 VETDKLDLARSLMEKAKARGVELLLPVDVVVADRFDKDANAQTVSIHAIPEDWMGLDIGP 313

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++V+  +  +   +TV+WNGP+GVFE + F   T  +A  +A LT +   I+I GGGD++
Sbjct: 314 ESVKAFQAALQGCKTVVWNGPMGVFEFDRFAAGTEAIARTLADLT-QAGAITIIGGGDSV 372

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+   G++++ T++ST GGA LE LEGK+LPGI ALS
Sbjct: 373 AAVEKVGLADKMTHISTGGGASLELLEGKELPGIAALS 410


>gi|194476823|ref|YP_002049002.1| Phosphoglycerate kinase [Paulinella chromatophora]
 gi|171191830|gb|ACB42792.1| Phosphoglycerate kinase [Paulinella chromatophora]
          Length = 401

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/388 (39%), Positives = 241/388 (62%), Gaps = 3/388 (0%)

Query: 11  RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKS 69
            D++  R L+RVD+NVP  D G + D TRI   +PTI +L+ K AK+++ +H GRP+ K 
Sbjct: 12  NDVKDKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLISKNAKIILAAHFGRPKGKV 71

Query: 70  DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERND 129
           ++   L  V +    +L K ++  + CIGS     + +++ G +IL EN+RF++EEE+ND
Sbjct: 72  NESMRLTPVATRLSELLGKTVVKTDSCIGSEAEAKVNAMAAGDVILLENIRFFAEEEKND 131

Query: 130 PDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESK 188
            +F   L+   D Y+NDAF  +HRAHAS  G++ HL P+  G  M+KEL  L+    E K
Sbjct: 132 SEFAAKLASLADMYVNDAFGAAHRAHASTEGVTKHLSPNVAGFLMEKELQYLQGAIDEPK 191

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +  
Sbjct: 192 RPLAAIVGGSKVSSKIGVLETLIDKCDKILIGGGMIFTFYKARGLSVGKSLVEEDKLELA 251

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             +  +A     + ++P DVV+A         +  S  ++P   + LD+G  +++  ++ 
Sbjct: 252 KSLEAKAAMKGVQFLLPTDVVLADNFAPDANVKTTSINAIPDGWMGLDIGPDSIKSFQEA 311

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +A  +T++WNGP+GVFE E F   T  +A+ +A LT      +I GGGD++ A+   G++
Sbjct: 312 LADCKTIIWNGPMGVFEFEKFAAGTDAIANTLANLTA-TGTCTIIGGGDSVAAVEKVGVA 370

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 371 DKMSHISTGGGASLELLEGKILPGVAAL 398


>gi|124024485|ref|YP_001018792.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9303]
 gi|166987797|sp|A2CDG7|PGK_PROM3 RecName: Full=Phosphoglycerate kinase
 gi|123964771|gb|ABM79527.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9303]
          Length = 401

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 245/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+R  R L+RVD+NVP  + G + D TRI   +PTI +L++K A+V++ +H GRP+ + +
Sbjct: 13  DLRSKRVLVRVDFNVPLNENGAITDDTRIRAALPTINDLIDKGARVILSAHFGRPKGQIN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V      +L K ++    C+GS     + ++++G ++L ENVRF+SEEE+ND 
Sbjct: 73  EGMRLTPVAKRLSELLGKTVIKTESCVGSDAEAKVNAMADGDVVLLENVRFFSEEEKNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    + K+
Sbjct: 133 NFAQKLAALADAYVNDAFGAAHRAHASTEGVTKFLNPSVAGHLMEKELQYLQGAIDDPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    ++++P DVV+A +      +Q VS  ++P   + LD+G  ++   +  +
Sbjct: 253 ELEAKAKAKGVQLLLPTDVVLADDFSPDANSQTVSIDAIPDGWMGLDIGPDSINLFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A L+  +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSG-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|320355230|ref|YP_004196569.1| phosphoglycerate kinase [Desulfobulbus propionicus DSM 2032]
 gi|320123732|gb|ADW19278.1| phosphoglycerate kinase [Desulfobulbus propionicus DSM 2032]
          Length = 391

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 159/395 (40%), Positives = 250/395 (63%), Gaps = 7/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ +L ++ G R L+RVD+NVP  + G++ D  RI  V+PT+  L+E+KA+V++ +H+
Sbjct: 1   MKTLREL-ELTGKRVLVRVDFNVPMNEAGEITDDLRIRTVLPTLRYLLEQKARVIVCTHM 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +  +  SL  V +   ++L + I    DC+G  +  ++  +  G I++ EN+RF+
Sbjct: 60  GRPKGQRVEKYSLAPVAAYTAALLGQPIPLAPDCVGPDVVTAVEQVKNGEILMLENLRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLE 181
            EEE+NDP+F R L+   D Y+NDAF+VSHRAHAS+ G++ H+     G  +QKE+   +
Sbjct: 120 PEEEKNDPEFSRQLAMLADVYVNDAFAVSHRAHASVVGVTLHVAEKAAGFLLQKEVEYFQ 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++PLVAIVGG+KVS K+  L N++ +VDK++IGG MAN+FL +QG  VG S  +
Sbjct: 180 RSIGIPQRPLVAIVGGAKVSGKLEALRNMLGRVDKMIIGGAMANTFLKSQGYAVGASKVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D      ++  +AK     I +P DV+VA         + V+ Q +P   + LD+G  +
Sbjct: 240 DDLLSTAAELLRQAKEKNINIYLPVDVIVADRFAPDAICKQVTIQDIPEGWMALDIGPAS 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V    +V+A A+T++WNGP+G FE++ F R T+ +AH VA        +S+ GGGD+  A
Sbjct: 300 VICFNEVLADAKTIVWNGPMGAFEMDAFARGTMALAHTVAA----SHALSVTGGGDSNAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  +G ++  +Y+ST GGAFLE +EGK LPGI AL
Sbjct: 356 ITLSGEASNISYMSTGGGAFLELMEGKVLPGIKAL 390


>gi|169826062|ref|YP_001696220.1| phosphoglycerate kinase [Lysinibacillus sphaericus C3-41]
 gi|168990550|gb|ACA38090.1| Phosphoglycerate kinase [Lysinibacillus sphaericus C3-41]
          Length = 394

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/398 (39%), Positives = 251/398 (63%), Gaps = 7/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +TM D+ D++G R  +RVD+NVP  DG + D TRI   +PT+  LVE+ AKV++ S
Sbjct: 1   MLNKKTMKDI-DVKGKRVFVRVDFNVPMADGVITDETRIRAAIPTVEYLVEQGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKV-VSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLGRP+ +  +D  L  V + +AE ++ K +  +++ IG  + +++A++ +G I+L ENV
Sbjct: 60  HLGRPKGEVKEDMRLTAVGIRLAE-LMSKPVTKLDESIGQAVEKAVANMQDGDILLLENV 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF++ EE+NDP   +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  MQ EL +
Sbjct: 119 RFHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGIAKHIPAVSGFLMQTELDV 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L    S  + P  AI+GG+KV  KI ++ +L++KVD L+IGGG++ +F+ AQG  +G+SL
Sbjct: 179 LGKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGLSFTFIKAQGYDIGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +       +AK    ++ +P D VVA E      T+VV   ++P D + LD+G 
Sbjct: 239 LEEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQDAETKVVDVDAIPADWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT  +  +VI  ++ ++WNGP+GVFE++ F   T  VA  +A  +      ++ GGGD+ 
Sbjct: 299 KTAAHYAEVINNSKLIIWNGPMGVFEMDKFANGTKTVADAMATTSG----YTVIGGGDSA 354

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+    ++++  ++ST GGA LE +EGK+LPGIVAL+
Sbjct: 355 AAVEKFKVADKMDHISTGGGASLELMEGKELPGIVALN 392


>gi|21536853|gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
          Length = 401

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   ++VV
Sbjct: 1   MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   ++  ND IG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRFY+EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+  VD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 240 SSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE +EGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELIEGKPLPGVLAL 398


>gi|229543253|ref|ZP_04432313.1| Phosphoglycerate kinase [Bacillus coagulans 36D1]
 gi|229327673|gb|EEN93348.1| Phosphoglycerate kinase [Bacillus coagulans 36D1]
          Length = 394

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 157/386 (40%), Positives = 233/386 (60%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           +++G R   RVD+NVP  DG V D TRI   +PTI  LVE  AKV++ SHLGRP+ +  +
Sbjct: 10  ELQGKRVFCRVDFNVPLKDGNVTDDTRIRAALPTIKYLVENGAKVILASHLGRPKGQVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V      +L K++   N+  G ++   I+ ++ G ++L ENVRFY  EE+NDP+
Sbjct: 70  ELRLTPVAKRLSELLGKDVKKANEAYGESVKAEISKMNNGDVLLLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   + Y+NDAF  +HRAHAS  G++H LP+  G  MQKEL +L    S  ++P 
Sbjct: 130 LAKEFASLAELYVNDAFGAAHRAHASTEGIAHHLPAVSGFLMQKELDVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL + D  D     
Sbjct: 190 TAIIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFVKAQGHEIGKSLLEEDKIDLAKSF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK       +P D +VA E       + V+ + +P D   LD+G KTVE   +VI +
Sbjct: 250 MAKAKEKGVNFYMPVDAIVADEFSETANKKEVAIEEIPADWQALDIGPKTVELYAKVIKE 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE++ +   T  VA  +A  T    II   GGGD+  A+    ++ + 
Sbjct: 310 SKLVIWNGPMGVFEMDAYANGTKGVAEALADATGTYSII---GGGDSAAAVEKFHLAEKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
            ++ST GGA LE++EGK LPG+ AL+
Sbjct: 367 DHISTGGGASLEFMEGKTLPGVAALN 392


>gi|327438832|dbj|BAK15197.1| 3-phosphoglycerate kinase [Solibacillus silvestris StLB046]
          Length = 394

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 157/393 (39%), Positives = 245/393 (62%), Gaps = 5/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           ++MND+ D++G R  +RVD+NVP  +G++ D TRI   +PTI +LV   AKV++ SHLGR
Sbjct: 5   KSMNDV-DVKGKRVFVRVDFNVPMDEGRITDETRIRAAIPTIEQLVNAGAKVILASHLGR 63

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ + ++D  L  V      ++ K +  +++ IGS +  ++ ++ +G IIL ENVRF+  
Sbjct: 64  PKGEVNEDMRLTAVGERLSELMDKPVNKLDESIGSDVEAAVNNMQDGEIILLENVRFHKG 123

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND    +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L    
Sbjct: 124 EEKNDEALAKEFAKLADLYVNDAFGAAHRAHASTEGIAKHVPAVSGLLMEKELDVLGKAL 183

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+  +F+ A G  +G+SL + D 
Sbjct: 184 SNPERPFTAIIGGAKVKDKIGVIENLLDKVDHLIIGGGLVFTFVKAMGHNIGKSLLEEDK 243

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK    ++ +P D VVA E      T+VV+  ++P D + LD+G KT E 
Sbjct: 244 IELAKGFIEQAKEKGVQLHMPVDAVVANEFSKDAETKVVAIDAIPSDWMGLDIGPKTAEN 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
             +VI Q++ ++WNGP+GVFE+E F   T  VA  +A         +I GGGD+  A+  
Sbjct: 304 YAEVIKQSKLIIWNGPMGVFEMEKFANGTKTVADAMATTDG----YTIIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             ++++  ++ST GGA LE +EGK+LPGIVAL+
Sbjct: 360 FEVASKMDHISTGGGASLELMEGKELPGIVALN 392


>gi|113953913|ref|YP_731897.1| phosphoglycerate kinase [Synechococcus sp. CC9311]
 gi|123132353|sp|Q0I6M5|PGK_SYNS3 RecName: Full=Phosphoglycerate kinase
 gi|113881264|gb|ABI46222.1| phosphoglycerate kinase [Synechococcus sp. CC9311]
          Length = 402

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 240/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVILAAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K +     CIG      + +++ G ++L ENVRF++EEE+ND 
Sbjct: 73  DKMRLTPVATRLSELLSKPVTKTESCIGPDAEAKVNAMANGDVVLLENVRFFAEEEKNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           DF + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    E K+
Sbjct: 133 DFAKQLAGLADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DV++A        +QV    ++P   + LD+G   ++  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVLLADNFAPDANSQVADVTAIPDGWMGLDIGPDAIKVFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A+L+  +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAELSG-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|269837281|ref|YP_003319509.1| Phosphoglycerate kinase [Sphaerobacter thermophilus DSM 20745]
 gi|269786544|gb|ACZ38687.1| Phosphoglycerate kinase [Sphaerobacter thermophilus DSM 20745]
          Length = 394

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 240/393 (61%), Gaps = 5/393 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT++DL D+ G R L+RVD+NVP  DG++ D TRI   +PTI  L E+ A +++ SHLG
Sbjct: 3   IRTLDDL-DVAGKRVLVRVDYNVPLDDGRITDDTRIRATLPTIQALRERGAAIILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K  ++  L  V +    +L + + +  D +G       +SL  GG+ L ENVRF  
Sbjct: 62  RPKGKVREELRLAPVAARLGELLGEPVKYARDVVGPEAQAMASSLQPGGVGLLENVRFEP 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE NDP+F R L+   D Y+NDAF  +HRAHAS T ++ LLPS  G  MQ+E++ L   
Sbjct: 122 GEEANDPEFARQLASLADCYVNDAFGAAHRAHASTTAVADLLPSAAGLLMQREIAALTKV 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P   I+GG+KVS K+ ++ +L+ +VD L++GGGMAN+FL A+G  VGRSL + D
Sbjct: 182 LESPEHPAALILGGAKVSDKVGVIEHLLDRVDLLLLGGGMANTFLKAEGFPVGRSLVEDD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D        A+     +++P DVVVA  ++   PT++V  + V  D  I D+G +TV 
Sbjct: 242 KLDVARATLDRARERGVTVLLPVDVVVAPRLENDAPTRIVPVEQVGDDDAIYDIGPQTVA 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +  ARTV+WNGP+GVFE+  F   T  VA  VA         ++ GGGD++ A+ 
Sbjct: 302 RFAEALRSARTVVWNGPMGVFEVPAFAAGTRGVAEAVASCEG----FTLIGGGDSVAAVE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G+++  +++ST GGA LE+LEGKDLPG+  L
Sbjct: 358 QMGLADRVSHISTGGGASLEFLEGKDLPGVAVL 390


>gi|168020306|ref|XP_001762684.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162686092|gb|EDQ72483.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 476

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/389 (42%), Positives = 239/389 (61%), Gaps = 3/389 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKV-ADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           + +G    +R D NVP  D ++  D TRI   +PTI  LV+  AKVV+ SHLGRP+   +
Sbjct: 88  EFQGKVVFVRADLNVPLDDARIITDDTRIRASLPTIQHLVKAGAKVVVASHLGRPKKGPE 147

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              SL  V     ++L + +    D +G  +   IA+L EG ++L ENVRFY EEE+ND 
Sbjct: 148 DKFSLKPVAGRLSNLLGQTVELAPDSVGPEVESKIAALKEGQVLLLENVRFYKEEEKNDV 207

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSMLESCFSESKK 189
           +F + L++N D ++NDAF  +HRAH+S  G++  +P S  G  ++KEL+ L        K
Sbjct: 208 EFSKKLAKNVDIFVNDAFGTAHRAHSSTAGIAEFVPKSVAGFLLEKELAYLSGAIKSPAK 267

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P VAIVGGSKVS+KIT++ +L+   DK+++GGGM  +F  A G  +G SL + D      
Sbjct: 268 PFVAIVGGSKVSSKITVIESLMNVCDKVILGGGMIFTFFKADGKSIGSSLVEEDKIGLAK 327

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +   AK    E+I+P DV+VA +      TQ  S+  +P   + LD+G K +E  K+ +
Sbjct: 328 NLVALAKEKGVELILPVDVLVADKYAPDANTQECSSSHIPDGWMGLDIGPKAIEQFKEAL 387

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
             ++TV+WNGP+GVFE + F + T  VA  +A LTKE   I+I GGGD++ A+  AG+++
Sbjct: 388 KGSKTVLWNGPMGVFEFDAFAKGTYAVAESLAGLTKEGA-ITIIGGGDSVAAVEKAGLAD 446

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           + ++VST GGA LE LEGK LPG+ AL G
Sbjct: 447 QMSHVSTGGGASLELLEGKVLPGVAALDG 475


>gi|229087607|ref|ZP_04219737.1| Phosphoglycerate kinase [Bacillus cereus Rock3-44]
 gi|228695723|gb|EEL48578.1| Phosphoglycerate kinase [Bacillus cereus Rock3-44]
          Length = 394

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/386 (39%), Positives = 237/386 (61%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  DGKV D TRI   +PTI  LVE+ AKV++ SHLGRP+ +  +
Sbjct: 10  DLKGKRVFCRVDFNVPMKDGKVTDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRFY+ EE+ND +
Sbjct: 70  EMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRFYAGEEKNDAE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKEFAALADLFVNDAFGAAHRAHASTAGIADYLPAVSGFLMEKELEVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+ D  D   + 
Sbjct: 190 TAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCENDKIDLAKEF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK       +P DVV+  E      T++V   S+P D   +D+G KT E    VI  
Sbjct: 250 MELAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPTDWEGVDIGPKTSEIYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAAVEKFGMADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+V L+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVVCLN 392


>gi|254432738|ref|ZP_05046441.1| phosphoglycerate kinase [Cyanobium sp. PCC 7001]
 gi|197627191|gb|EDY39750.1| phosphoglycerate kinase [Cyanobium sp. PCC 7001]
          Length = 401

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 244/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           ++RG R L+RVD+NVP  + G + D TRI   +PTI +LV+K A+V++ +H GRP+ + +
Sbjct: 13  ELRGKRVLVRVDFNVPLDEAGAITDDTRIRAALPTINDLVDKGARVILAAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L K ++  + CIG      +A++++G ++L ENVRF++EEE+NDP
Sbjct: 73  EGMRLTPVAARLGELLGKPVVKTDSCIGPDAEAKVAAMADGDVVLLENVRFFAEEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    E K+
Sbjct: 133 AFAAKLAALADVYVNDAFGAAHRAHASTEGVTKALSPSVAGYLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  D   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEEDKLDLAR 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        T   S   +P   + LD+G  +V+  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDAKTLTTSVNVIPEGWMGLDIGPDSVKAFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +AH +A L+  +   +I GGGD++ A+   G++ 
Sbjct: 313 ADCQTVIWNGPMGVFEFDKFAAGTNGIAHTLADLSA-KGCCTIIGGGDSVAAVEKVGVAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|138896643|ref|YP_001127096.1| phosphoglycerate kinase [Geobacillus thermodenitrificans NG80-2]
 gi|134268156|gb|ABO68351.1| 3-phosphoglycerate kinase [Geobacillus thermodenitrificans NG80-2]
          Length = 384

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/385 (41%), Positives = 235/385 (61%), Gaps = 3/385 (0%)

Query: 13  IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKD 72
           +RG R   RVD+NVP  DG + D TRI   +PTI  L+E  AKV++ SHLGRP+ K  ++
Sbjct: 1   MRGKRVFCRVDFNVPMEDGAITDDTRIRAALPTIQYLIEHGAKVILASHLGRPKGKVVEE 60

Query: 73  CSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDF 132
             L  V      +L + ++  N+ IG  +  ++A+L+EG ++L ENVRFY  EE+NDP+ 
Sbjct: 61  LRLDAVAKRLGELLERPVVKTNEAIGDEVKAAVANLNEGDVLLLENVRFYPGEEKNDPEL 120

Query: 133 VRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLV 192
            R  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L    S   +P  
Sbjct: 121 ARAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLGKALSNPDRPFT 180

Query: 193 AIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIA 252
           AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  VG+SL + D  +      
Sbjct: 181 AIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDKIELAKSFM 240

Query: 253 WEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQA 312
            +AK       +P DVVVA        T+VV   ++P D   LD+G +T E  + VI Q+
Sbjct: 241 EKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPSDWEALDIGPQTRELYRDVIRQS 300

Query: 313 RTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFT 372
           + V+WNGP+GVFE+E F   T  VA  +A+        S+ GGGD+  A+    ++++  
Sbjct: 301 KLVVWNGPMGVFEMETFSHGTRAVAEALAEAAD---TYSVIGGGDSAAAVEKFDLADKMD 357

Query: 373 YVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ST GGA LE++EGK LPG+VAL+
Sbjct: 358 HISTGGGASLEFMEGKQLPGVVALN 382


>gi|1022805|gb|AAB60303.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 399

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 244/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV++ +HLGRP+  + 
Sbjct: 7   DLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTP 66

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K  SL  +V     +L   +   +DCIG  +   +ASL EGG++L ENVRFY EEE+NDP
Sbjct: 67  K-FSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDP 125

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L    S  K+
Sbjct: 126 EFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVSNPKR 185

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL + D  +   
Sbjct: 186 PFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELAT 245

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK     +++P DVVVA +      +++V A  +    + LD+G  +++   + +
Sbjct: 246 ELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEAL 305

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              +TV+WNGP+GVFE+E F   T  +A+ +A+L+ E+ + +I GGGD++ A+   G++ 
Sbjct: 306 DTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELS-EKGVTTIIGGGDSVAAVEKVGVAG 364

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             +++ST GGA LE LEGK LPG++AL
Sbjct: 365 VMSHISTGGGASLELLEGKVLPGVIAL 391


>gi|238019089|ref|ZP_04599515.1| hypothetical protein VEIDISOL_00951 [Veillonella dispar ATCC 17748]
 gi|237864344|gb|EEP65634.1| hypothetical protein VEIDISOL_00951 [Veillonella dispar ATCC 17748]
          Length = 392

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 151/379 (39%), Positives = 240/379 (63%), Gaps = 4/379 (1%)

Query: 19  LLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKV 78
            +RVD+NVP  DG + D TRI   +PTI  L+EK AKV++ SH GRP+ +   + SL   
Sbjct: 16  FVRVDFNVPMKDGVITDDTRIRSALPTINYLIEKGAKVILASHFGRPKGERKPEMSLAPC 75

Query: 79  VSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSR 138
                 +++K + FV+DCIG  + +++ +L  G +++ EN+R+++EE +NDP+F + L+ 
Sbjct: 76  AKHLSELINKPVAFVDDCIGHKVEEAVKALQPGDVLMLENLRYHNEETKNDPEFAKQLAS 135

Query: 139 NGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGS 198
             D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +     K P+ AI+GG+
Sbjct: 136 LADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIEALSAAVVHPKTPMAAIIGGA 195

Query: 199 KVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRS 258
           KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL +         +  EA+ +
Sbjct: 196 KVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLFEEGQEAIATDLVMEARVA 255

Query: 259 ACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWN 318
             +++ P D VVA        T++V  +++    ++LD+G KT E   + +A  +T++WN
Sbjct: 256 GAKLLTPIDAVVADAFSNDANTKIVDVENIEDGWMVLDIGPKTRELYVEALAPMKTIIWN 315

Query: 319 GPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAG 378
           GP+GVFE+E F   T    + VAK   E   ++I GGGD++ A+  +G++++ +++ST G
Sbjct: 316 GPMGVFEMENFAAGT----NAVAKAVAESDAMTIVGGGDSVAAIEKSGLADKISHISTGG 371

Query: 379 GAFLEWLEGKDLPGIVALS 397
           GA LE+LEGK LPGI ALS
Sbjct: 372 GASLEFLEGKILPGIAALS 390


>gi|146298738|ref|YP_001193329.1| phosphoglycerate kinase [Flavobacterium johnsoniae UW101]
 gi|119067629|gb|ABL60888.1| hypothetical protein [Flavobacterium johnsoniae UW101]
 gi|146153156|gb|ABQ04010.1| Phosphoglycerate kinase [Flavobacterium johnsoniae UW101]
          Length = 395

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 159/396 (40%), Positives = 243/396 (61%), Gaps = 6/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND  D +  + ++RVD+NVP  +   V D TRIE   PTI  ++ +   V++ SHL
Sbjct: 1   MKTLNDF-DFKNKKAIIRVDFNVPLDENFNVTDTTRIEAAKPTIDAILAQGGSVILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +K  SL  ++  A  IL   + F  +CIG     +  +L  G ++L EN+RF+
Sbjct: 60  GRPKGAEEK-YSLKHILKTASEILGVQVKFAENCIGEPAQTAAKNLQPGEVLLLENLRFH 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS--YIGRAMQKELSML 180
           +EEE  D  F + L+  GD Y+NDAF  +HRAHAS T ++   P+    G  + KE+  L
Sbjct: 119 AEEEAGDVAFAKELASLGDIYVNDAFGTAHRAHASTTIIAQFFPNDKCFGTLLAKEIDSL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                 S+KP+ A++GGSKVS+KIT++ N++ KVD ++IGGGM  +F+ AQG  +G S+C
Sbjct: 179 NKVLKNSEKPVTAVLGGSKVSSKITVIENILDKVDHMIIGGGMTFTFIKAQGGKIGESIC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D   +I   AK    ++ +P DVV A +      TQ+V   ++P     LD G K
Sbjct: 239 EDDKLDLALEILRLAKEKNVQVHIPVDVVAADDFSNTANTQIVDVTAIPDGWQGLDAGPK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++E  K+VI +++T++WNGPLGVFE+E F + T+ +  ++A+ TK     S+ GGGD++ 
Sbjct: 299 SLENFKKVILESKTILWNGPLGVFEMETFSKGTIALGDFIAEATK-NGAFSLVGGGDSVA 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G  ++ +YVST GGA LE LEG+ LPGI A+
Sbjct: 358 AVKQFGFEDKMSYVSTGGGAMLEMLEGRILPGIAAI 393


>gi|189182911|ref|YP_001936696.1| phosphoglycerate kinase [Orientia tsutsugamushi str. Ikeda]
 gi|229620376|sp|B3CQC3|PGK_ORITI RecName: Full=Phosphoglycerate kinase
 gi|189179682|dbj|BAG39462.1| phosphoglycerate kinase [Orientia tsutsugamushi str. Ikeda]
          Length = 406

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/397 (42%), Positives = 247/397 (62%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +LR ++D+  ++    LLR+D N+P   GK+ D TRI R +PTI  L+   AKVVI S
Sbjct: 1   MIQLRQLSDVI-VKDKVVLLRLDLNIPQEGGKITDNTRIVRTIPTIKYLILHGAKVVIIS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLG P+ + +   SL  VV+  E++L+  + F  + IGST   +I  +  G ++L EN+R
Sbjct: 60  HLGNPKGRIELTLSLRSVVTELEALLNIKVQFCPESIGSTPKNAIIKMKAGEVLLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F S EE ND  FV  LS  GD Y+NDAFS SHR HASI GL   LPS  G  +  EL  L
Sbjct: 120 FNSGEELNDATFVNELSSLGDIYVNDAFSCSHRKHASICGLPAKLPSAAGFLLLSELKHL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            S FS + KP   I+GG+K+STK+ LL +L+ K D L++ G MAN FL  +   +G SL 
Sbjct: 180 TSIFSNANKPFTVIIGGAKMSTKLDLLNSLITKADYLIVAGAMANIFLAMKRFNIGASLY 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP-TQVVSAQSVPLDSIILDVGF 299
           + +  +    I  +A  + C+II+P D V+       I   ++ S+  +  ++ I+D+G 
Sbjct: 240 KPELVNVASLILKKATSTNCKIILPFDAVIQNFNSNNITIIELNSSLVMQSNAKIMDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT+  I  +I  ++T++WNGP+G FE  PFD  +  ++  +A+ T+   + S+AGGGDTI
Sbjct: 300 KTIAQIINIIKISKTIVWNGPVGAFEQLPFDHGSTYLSKAIAEKTRTGSLCSVAGGGDTI 359

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+  +G+ ++F+Y+ST GGAFLEWL+GK LPG+ AL
Sbjct: 360 SAIKKSGVIDDFSYISTGGGAFLEWLQGKTLPGVEAL 396


>gi|113476890|ref|YP_722951.1| phosphoglycerate kinase [Trichodesmium erythraeum IMS101]
 gi|123160489|sp|Q10Z46|PGK_TRIEI RecName: Full=Phosphoglycerate kinase
 gi|110167938|gb|ABG52478.1| phosphoglycerate kinase [Trichodesmium erythraeum IMS101]
          Length = 398

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 245/386 (63%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G + L+R D+NVP  +G + D TRI   +PTI +L EK AKV++ SH GRP+ K ++
Sbjct: 13  DLSGKKVLMRADFNVPVDNGSITDDTRIRAALPTIQDLTEKGAKVILTSHFGRPKGKVNE 72

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L  V      +L K +   +DCIG  ++ ++A + +G ++L ENVRFYS EE NDP+
Sbjct: 73  KMRLTLVGERLSEVLGKEVKKCDDCIGDEVTSTVAEMKDGDVVLLENVRFYSGEEGNDPE 132

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKKP 190
           F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  +++EL  L+      +KP
Sbjct: 133 FAKQLASVADLYVNDAFGTAHRAHASTEGVTKYLSPSVAGYLIEQELKFLQGAIDSPQKP 192

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L AI+GGSKVS+KI ++  L+ K DKL++GGGM  +F  A+G+ VG+SL + D  +    
Sbjct: 193 LAAIIGGSKVSSKIGVIEALLDKCDKLLLGGGMIFTFYKARGLSVGKSLVEEDKIELAKS 252

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK     +++P DVVVA +      TQ VS +++P   + LD+G ++ +  +  +A
Sbjct: 253 LEAKAKEKGVTMLLPTDVVVADKFDPEANTQTVSIEAIPDGWMGLDIGPESAKVFQDALA 312

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             +TV+WNGP+GVFE+E F + T  +A  +A    ++  I+I GGGD++ A+   G+  +
Sbjct: 313 DCKTVIWNGPMGVFEMEKFAKGTEAIAQTLA---DKQDAITIIGGGDSVAAVEQLGLGEK 369

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPGIVAL
Sbjct: 370 MSHISTGGGASLELLEGKKLPGIVAL 395


>gi|295131919|ref|YP_003582595.1| phosphoglycerate kinase [Zunongwangia profunda SM-A87]
 gi|294979934|gb|ADF50399.1| phosphoglycerate kinase [Zunongwangia profunda SM-A87]
          Length = 394

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 160/395 (40%), Positives = 245/395 (62%), Gaps = 5/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T++D  + +  + L+RVD+NVP  D  KV D  RIE   PTI++++E    VV+ SHL
Sbjct: 1   MKTVDDF-NFKDKQALIRVDFNVPLNDDLKVTDANRIEAAKPTIVKILEDGGSVVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K  K  SL  +VS    ++     FV DC+G+ + ++  SL  G I+L EN+RF+
Sbjct: 60  GRPKGKEAK-FSLKNIVSKVSEVIGVEPKFVEDCVGAEVKKAADSLQSGEILLLENLRFH 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSMLE 181
            EE   D DF + LS  GD Y+NDAF  +HRAHAS T ++        G  + KE+  L+
Sbjct: 119 DEETAGDEDFAKQLSELGDIYVNDAFGTAHRAHASTTVVAQFFEDKCFGYLLAKEIESLD 178

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  +KP+ A++GG+KVS+KIT++ N++  +D L+IGGGM  +F+ AQG  +G SL +
Sbjct: 179 KVLNSKEKPVTAVLGGAKVSSKITVIENILDAIDHLIIGGGMTYTFIKAQGGKIGNSLVE 238

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +I  +AK    ++ +P D V+A        TQV +  ++P   + LDVG +T
Sbjct: 239 DDKQELALEILKKAKEKGVQVHLPVDSVIADSFSEQASTQVEAVDNIPDGWMGLDVGPET 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +++   VIA+++ ++WNGPLGVFE+E F + T+E+   +A+ TK     S+ GGGD++ A
Sbjct: 299 LKHFSNVIAESKIILWNGPLGVFEMETFAKGTIELGKAIAEATK-NGAFSLVGGGDSVAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G  ++ +YVST GGA LE LEGK LPGI A+
Sbjct: 358 VKQFGFDDKVSYVSTGGGAMLEMLEGKSLPGIAAI 392


>gi|157363860|ref|YP_001470627.1| phosphoglycerate kinase [Thermotoga lettingae TMO]
 gi|166987818|sp|A8F5X9|PGK_THELT RecName: Full=Phosphoglycerate kinase
 gi|157314464|gb|ABV33563.1| Phosphoglycerate kinase [Thermotoga lettingae TMO]
          Length = 397

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 163/399 (40%), Positives = 250/399 (62%), Gaps = 8/399 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M +L T+ D+ D+     ++RVD+NVP   DGKV+D TRI   +PTI   VEKKAKV++ 
Sbjct: 1   MKKL-TIKDI-DLSNKAVIMRVDFNVPIGKDGKVSDDTRITAALPTIKYAVEKKAKVILL 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   D   SL  +    ++I   N++FV   +G  + +++ ++  G ++L EN 
Sbjct: 59  SHLGRPKGSFDPKYSLKPIAEHLKNISGLNVIFVPHVVGEEVKEAVKNMKVGDVLLLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+  EE+ND +  +  +   D ++NDAF  +HRAHAS  G+++ +PS  G  M+KE+  
Sbjct: 119 RFHPGEEKNDQELAKAWAELADIHVNDAFGTAHRAHASNVGIANFIPSVAGFLMEKEIDF 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E   P V ++GG+KVS KI ++ NL+ K DKL+IGG M  +FL AQG+ VG SL
Sbjct: 179 LNKVTYEPDHPYVVVLGGAKVSDKIGVITNLLNKADKLLIGGAMMFTFLKAQGLKVGSSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSII-LDVG 298
            + D  D   QI  +AK    EI++P D +VA++++ G+  +    +    D  + LD+G
Sbjct: 239 VENDKLDLAKQILEQAKEKKVEIVLPVDAIVAQKIEAGVEKKTADLKDGIDDGWMGLDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT++  ++ +  A+TV+WNGP+GVFEIE F   T  VA  +AK+    +  ++ GGGD+
Sbjct: 299 PKTIKVFEEALKNAKTVVWNGPMGVFEIEDFAGGTKAVAEMIAKI----KGTTVIGGGDS 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             A+A  G+ + +++VST GGA LE+LEGKDLPGI +++
Sbjct: 355 AAAVAKFGLESAYSHVSTGGGASLEFLEGKDLPGIRSIA 393


>gi|121535413|ref|ZP_01667224.1| Phosphoglycerate kinase [Thermosinus carboxydivorans Nor1]
 gi|121306012|gb|EAX46943.1| Phosphoglycerate kinase [Thermosinus carboxydivorans Nor1]
          Length = 394

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/394 (40%), Positives = 238/394 (60%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+  + G +  +RVD+NVP    G + D TRI   +PTI  L+++ A V++ SHLG
Sbjct: 4   KTVKDIA-VTGKKVFVRVDYNVPMDKSGHITDDTRIRATLPTIRYLLDQGAAVILASHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+     + SL  V      +L + +LF  DC+G+      A L  G ++L EN+RF+ 
Sbjct: 63  RPKGAPAPEYSLAPVAKRLSELLGQEVLFAADCVGAEAEAKAAQLKPGQVLLLENLRFHK 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+R  D  +NDAF VSHRAHAS+ G++  +P   G  M+KE++ L   
Sbjct: 123 EEEKNDERFAQSLARLADVAVNDAFGVSHRAHASVEGITKFVPMVAGFLMEKEIAFLGQA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            +   +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG   G+SL + D
Sbjct: 183 VTNPTRPFVAIIGGAKVSDKIGVIENLLGKVDTLIIGGGMANTFLRAQGFATGKSLVEED 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  +AK    ++++P DVV+A         +V     +  + ++LD+G +T +
Sbjct: 243 KVELAATLIDQAKAKGLKLLLPTDVVIADRFAADAAWRVAGVAEIDPEWMVLDIGPETAK 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +  A+TV+WNGP+GVFE + F + T  VA  VA         SI GGGD+I AL 
Sbjct: 303 AFGEAVQGAKTVVWNGPMGVFEFDAFAKGTEAVAKAVAG----SGATSIVGGGDSIAALE 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G++   T++ST GGA LE+LEGK LPGI AL+
Sbjct: 359 KVGLAARITHISTGGGASLEFLEGKVLPGIAALA 392


>gi|87300807|ref|ZP_01083649.1| Phosphoglycerate kinase [Synechococcus sp. WH 5701]
 gi|87284678|gb|EAQ76630.1| Phosphoglycerate kinase [Synechococcus sp. WH 5701]
          Length = 401

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 246/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLQGKRVLVRVDFNVPLDESGAITDDTRIRAALPTIHDLISKGAKVILAAHFGRPKGEVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L K ++  + CIG      +A++++G ++L ENVRF++EEE+ND 
Sbjct: 73  EAMRLTPVAARLSELLGKPVVKTDSCIGPDAEAKVAAMADGDVVLLENVRFFAEEEKNDT 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   + Y+NDAF  +HRAHAS  G++ +L P+  G  M+KEL  L+    E K+
Sbjct: 133 EFAKKLAALAEVYVNDAFGAAHRAHASTEGVTEYLKPNVAGHLMEKELQYLQGAIDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    ++++P DVV+A        T   S   +P   + LD+G  +++  +  +
Sbjct: 253 ELEAKAKAKGVQLLLPTDVVLADSFSPDAKTLTTSVNVIPDGWMGLDIGPDSLKAFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  VAH +A+L+  +   +I GGGD++ A+   G++ 
Sbjct: 313 ADCKTVIWNGPMGVFEFDKFAAGTNGVAHTLAELSG-KGCCTIIGGGDSVAAVEKVGVAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|225620597|ref|YP_002721854.1| phosphoglycerate kinase [Brachyspira hyodysenteriae WA1]
 gi|225215416|gb|ACN84150.1| phosphoglycerate kinase [Brachyspira hyodysenteriae WA1]
          Length = 411

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 250/392 (63%), Gaps = 11/392 (2%)

Query: 12  DIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           DI+G + ++RVD+NVP     + K+ D TR++  +PTI  ++ + A +++ SHLGRP+ +
Sbjct: 21  DIKGKKVIMRVDFNVPLDKETNSKITDTTRVDAAMPTIEYILSQGACLILMSHLGRPKGE 80

Query: 69  SDKDCSLFKVVSIAESILHKN-ILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
           ++   SL  V    ++ L  N + F NDCIG  + +  A L  G ++L EN+R+++EEE+
Sbjct: 81  ANPKYSLKPVYDYLKTKLPNNKVSFANDCIGEEVKKQAAELKAGDVLLLENLRYHAEEEK 140

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL---LPSYIGRAMQKELSMLESCF 184
           ND  F + L+   D Y+NDAF  +HRAHAS  G+      +P+  G  M+KE+  L    
Sbjct: 141 NDAAFSKQLADLADVYVNDAFGTAHRAHASTAGIVSAKAGMPAVAGFLMEKEIQYLGDAV 200

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +  ++P VAI+GG+KVS+KI++L NL+ KVD L++ GGMA +F  A+G+ +G SLC+ D+
Sbjct: 201 ANPERPFVAIIGGAKVSSKISVLKNLLNKVDTLIVVGGMAYTFFKAKGLEIGTSLCEDDY 260

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
                +I  +AK     + +P D V+A +       + V + ++P   + +DVG KT++ 
Sbjct: 261 IATAKEIMDKAKELNKTLYLPVDNVIADKFDNDANIKTVDSNAIPAGWMGMDVGPKTLKE 320

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           ++ ++ +A+TV+WNGPLGVFE+  F + T EVA ++A        +SI GGGD+++A+  
Sbjct: 321 LEDILKKAKTVVWNGPLGVFEMANFAKGTFEVAKFIA----NSGAVSIIGGGDSVSAVNK 376

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G++++ T+VST GGA LE+LEG +LPGI  L
Sbjct: 377 SGVADKMTHVSTGGGASLEFLEGIELPGIAVL 408


>gi|300870040|ref|YP_003784911.1| phosphoglycerate kinase [Brachyspira pilosicoli 95/1000]
 gi|300687739|gb|ADK30410.1| phosphoglycerate kinase [Brachyspira pilosicoli 95/1000]
          Length = 399

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 155/392 (39%), Positives = 248/392 (63%), Gaps = 11/392 (2%)

Query: 12  DIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           DI+G + ++RVD+NVP       K+ D TR++  +PTI  ++ + A +++ SHLGRP+ +
Sbjct: 9   DIKGKKVIMRVDFNVPLDKETSSKITDTTRVDAAMPTIEYILSQGASLILMSHLGRPKGE 68

Query: 69  SDKDCSLFKVVSIAESILHKN-ILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
           ++   SL  V    ++ L  N ++F NDCIG  + +  + L  G ++L EN+R+++EEE+
Sbjct: 69  ANPKYSLKPVYDYLKTKLPNNKVIFANDCIGEEVKKLASDLKAGDVLLLENLRYHAEEEK 128

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL---LPSYIGRAMQKELSMLESCF 184
           ND  F + L+   D Y+NDAF  +HRAHAS  G+      +P+  G  M+KE+  L    
Sbjct: 129 NDAAFSKQLADLADVYVNDAFGTAHRAHASTAGIVSAKAGMPAVAGFLMEKEIQYLGDAV 188

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +   +P VAI+GG+KVS+KI++L NL+ KVD L++ GGMA +F  A+G+ +G SLC+ D+
Sbjct: 189 ANPARPFVAIIGGAKVSSKISVLKNLLNKVDTLIVVGGMAYTFFKAKGLEIGASLCEDDY 248

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
                +I  +AK     + +P D V+A +       +VV + ++P   + +DVG KT+  
Sbjct: 249 ISTAKEIMDKAKELNKTLYLPVDNVIADKFDNDATIKVVDSTAIPAGWMGMDVGPKTLTE 308

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
           I+ ++  A+TV+WNGPLGVFE+  F + T EVA ++A        +SI GGGD+++A+  
Sbjct: 309 IEGILKNAKTVVWNGPLGVFEMANFAKGTFEVAKFIA----NSGAVSIIGGGDSVSAVNK 364

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +G++++ T+VST GGA LE+LEG +LPGI  L
Sbjct: 365 SGVADKMTHVSTGGGASLEFLEGIELPGIAVL 396


>gi|9230771|gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
          Length = 401

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 249/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G R  +RVD NVP  D   + D TRI   +PTI  L    AKV+
Sbjct: 1   MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAIPTIKYLTGYGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   +    D IG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKGVTPK-YSLKPLVPRLSELLGSEVTIAGDSIGEEVEKLVAQIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRF+ EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  KKP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVSNPKKPFAAIVGGSKVSSKIGVIESLLEKVDILLLGGGMVFTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D       +  +AK     +++P DVV+A +       ++V A S+P   + LD
Sbjct: 240 TSLVEEDKLGLATSLIEKAKAKGVSLLLPTDVVIADKFSADANDKIVPASSIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + + +++TV+WNGP+GVFE + F   T  +A  +A+++  + + +I GGG
Sbjct: 300 IGPDSIKTFNEALDKSQTVIWNGPMGVFEFDKFAAGTEAIAKKLAEISG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|289522890|ref|ZP_06439744.1| phosphoglycerate kinase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503914|gb|EFD25078.1| phosphoglycerate kinase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 397

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 161/397 (40%), Positives = 252/397 (63%), Gaps = 3/397 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +LR + D +D+ G + L+RVD+NVP  DG V D TRI+  + T+  L    A++ + SHL
Sbjct: 2   KLR-IPDSKDVSGKKVLVRVDFNVPMKDGVVTDDTRIKAHLDTLTFLRNSGARLALVSHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   D   SL  V    +++    + F+ DCIG  +++++AS  +  +++ ENVRFY
Sbjct: 61  GRPKEGRDSQFSLKPVAEHLKALTGWKVTFIQDCIGEEVTRAVASQQQEEVLVLENVRFY 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             E +NDPDF + L++  + ++ DAFS +HRAHAS  G+   L S+ G  +++E+  L  
Sbjct: 121 KGETKNDPDFAKELAKPFEVFVMDAFSAAHRAHASTRGVVDYLTSFAGFLIKREIDSLGL 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                  P + I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL A+G G+G+SLC+ 
Sbjct: 181 VRDNPAHPYILILGGAKVSDKIGVIENLISKVDHIIIGGGMAYTFLKARGYGIGKSLCEE 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQ-SVPLDSIILDVGFKT 301
           +  +   ++   ++    EI +P D VVA ++K  +P  V+  + S+P D + LD+G K+
Sbjct: 241 EKLEYAKEMLELSRSRGVEIHLPVDSVVAPDVKADVPASVIDLETSIPEDMMALDIGPKS 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++   ++I +A+TV WNGP+GVFE+EPF   T +VA  VA++TK     ++ GGGDT  A
Sbjct: 301 IDNFSKIIGKAKTVFWNGPMGVFELEPFRAGTEKVALAVAQVTKNGG-HTVIGGGDTAAA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +   G S++ ++VST GGA LE++EGK LPGI  L G
Sbjct: 360 VNMLGFSDQMSHVSTGGGASLEFMEGKMLPGIEPLLG 396


>gi|450686|emb|CAA53187.1| 3-phosphoglycerate kinase [Thermotoga maritima MSB8]
          Length = 390

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 245/387 (63%), Gaps = 3/387 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 5   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 64  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K ++++IGG M  +FL A G  VG S  + D  
Sbjct: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKANRILIGGAMMFTFLKALGKEVGSSRVEEDKI 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS-AQSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +T+E 
Sbjct: 244 DLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLP 391
            G+ ++F++VST GGA LE+LEGK+LP
Sbjct: 363 FGLEDKFSHVSTGGGASLEFLEGKELP 389


>gi|318040689|ref|ZP_07972645.1| phosphoglycerate kinase [Synechococcus sp. CB0101]
          Length = 401

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 245/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           ++RG R L+RVD+NVP  D G + D TRI   +PTI +L  K AKV++ +H GRP+ + +
Sbjct: 13  ELRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLTGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L K+++  + CIG      +A+++EG ++L ENVRF++EEE+N+ 
Sbjct: 73  EGMRLTPVAARLSELLGKSVVKTDSCIGPDAEAKVAAMAEGDVVLLENVRFFAEEEKNEG 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           DF + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    E K+
Sbjct: 133 DFAKQLAALADVYVNDAFGAAHRAHASTEGVTQYLSPSVAGYLMEKELQYLQGAIDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK+++GGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALLDKCDKILVGGGMIFTFYKARGLAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +A     + ++P DVV+A        +Q+    ++P   + LD+G  +V+  +  +
Sbjct: 253 ELEAKAAAKGVQFLLPTDVVLADNFAPDANSQIAKVDAIPDGWMGLDIGPDSVKVFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A L+  +   +I GGGD++ A+  AG+++
Sbjct: 313 ADCKTVIWNGPMGVFEFDAFAAGTNAIATTLADLSG-KGCCTIIGGGDSVAAVEKAGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|332972919|gb|EGK10861.1| phosphoglycerate kinase [Desmospora sp. 8437]
          Length = 393

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 232/386 (60%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+RG R   RVD+NVP   G++ D  RI   +PTI  L E  AKV++ SHLGRP  +  +
Sbjct: 10  DVRGKRVFCRVDFNVPLDQGRITDDNRIRAALPTIRHLTEHGAKVILASHLGRPNGRVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V      +L ++++  ++ +G  + + +A L EG ++L ENVRF   EE+NDP+
Sbjct: 70  ELRLTPVAERLSQLLGQSVVKTDETVGEEVEKEVAGLKEGDVLLLENVRFCPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             R  ++  D Y+NDAF  +HRAHAS  G++  LP+  G  MQ+EL  L        +P 
Sbjct: 130 LSRAFAKLADLYVNDAFGTAHRAHASTAGIAEHLPAVAGFLMQQELETLGRALQNPDRPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            A++GG+KV  KI ++ NL+ KVD L+IGGG++ +FL A+G+ +G+SL + D  D     
Sbjct: 190 TAVIGGAKVKDKIGVIDNLLDKVDNLLIGGGLSFTFLKAKGLEIGQSLLEPDKIDLAESF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A++    +++P D  VA+      P ++V  +++P DS+ LD+G KT E    VI  
Sbjct: 250 MEKAEQKGVRLLLPVDAAVAKSFAPDAPAELVDVEAIPRDSMGLDIGPKTREAFADVIRA 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE + F   T  VA  VA  T     ++I GGGD++ A+  +G++ + 
Sbjct: 310 SKLVIWNGPMGVFEFDRFADGTFAVARAVATCTG----MTIIGGGDSVAAVKKSGLAGQV 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
            ++ST GGA LE +EGK LPG+  L 
Sbjct: 366 GHISTGGGASLELMEGKTLPGVAVLQ 391


>gi|284048292|ref|YP_003398631.1| triosephosphate isomerase [Acidaminococcus fermentans DSM 20731]
 gi|283952513|gb|ADB47316.1| triosephosphate isomerase [Acidaminococcus fermentans DSM 20731]
          Length = 641

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 152/393 (38%), Positives = 245/393 (62%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D++ + G R L+RVD+NVP  D G++ D  RIE  +PT+  L+++ A V++ +HLG
Sbjct: 4   KTVKDIQ-LTGKRVLVRVDYNVPMNDKGEITDFIRIEASLPTLHYLLDQGAAVILMAHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K +   +L  V      ++H+ + F  DC+G     + A L  G I+L EN+RF+ 
Sbjct: 63  RPKGKVNPKFTLKPVAEALSQLIHRPVQFCPDCVGKDAQDAAAQLRNGDILLLENLRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+  GD Y+ND F VSHRAHAS+  ++H LP+  G  ++KE++ L + 
Sbjct: 123 EEEKNDPHFAQELAALGDVYVNDGFGVSHRAHASVEAVTHYLPAVAGFLLEKEIAYLGNA 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + ++P  AI+GG+KV+ KI ++ +L+KK D ++IGGGMAN+FL A+G  +G+SL +++
Sbjct: 183 VDKPQRPFAAIIGGAKVADKIAVIRSLIKKADVILIGGGMANTFLAAKGYNLGKSLVEKE 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
                  +  EA     ++++P D+++A         +     ++  D + LD+G KT E
Sbjct: 243 SLGIAKDLLAEAAAQKTKMLLPVDLIMAASFSNEADHEAEDLDALNPDYMALDIGPKTAE 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              Q +A  +T++WNGP+GVFE+  +   T  VA  +A        I+I GGGD+  A+ 
Sbjct: 303 LYAQTLAGMKTIVWNGPMGVFEMPNYAEGTRRVAEAMAASDG----ITIVGGGDSAAAVK 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G++++ ++VST GGA LE+LEGK LPG+ AL
Sbjct: 359 QMGLADKMSHVSTGGGASLEYLEGKVLPGLAAL 391


>gi|129919|sp|P18912|PGK_BACST RecName: Full=Phosphoglycerate kinase
 gi|157833493|pdb|1PHP|A Chain A, Structure Of The Adp Complex Of The 3-Phosphoglycerate
           Kinase From Bacillus Stearothermophilus At 1.65
           Angstroms
 gi|48855|emb|CAA41093.1| 3-phosphoglycerate kinase [Geobacillus stearothermophilus]
          Length = 394

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 238/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV   ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T  +A  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIAEALAEALD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>gi|295401524|ref|ZP_06811493.1| Phosphoglycerate kinase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109551|ref|YP_003987867.1| phosphoglycerate kinase [Geobacillus sp. Y4.1MC1]
 gi|294976436|gb|EFG52045.1| Phosphoglycerate kinase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214652|gb|ADP73256.1| Phosphoglycerate kinase [Geobacillus sp. Y4.1MC1]
          Length = 394

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 157/393 (39%), Positives = 237/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R   RVD+NVP  +G + D TRI   +PTI  L+E+ AKV++ SHLGR
Sbjct: 4   KTIQDV-DVKGKRVFCRVDFNVPMENGAITDDTRIRAALPTIRYLIEQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L K ++  ++  G  +  +IA + EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLNAVAERLSELLGKQVVKTDEAYGEAVKTAIAGMKEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L    
Sbjct: 123 EEKNDPELAKAFAELADIYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPERPFTAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLAYTFVKALGHEVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P D VVA        T+VV+  ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVNFYMPVDAVVADRFANDANTKVVAIDAIPSDWEALDIGPKTCEL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T         L       S+ GGGD+  A+  
Sbjct: 303 YRDVIMKSKLVVWNGPMGVFEMDAFAGGT---KAVAQALADAADTYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL+
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALN 392


>gi|123967750|ref|YP_001008608.1| phosphoglycerate kinase [Prochlorococcus marinus str. AS9601]
 gi|166987799|sp|A2BNZ0|PGK_PROMS RecName: Full=Phosphoglycerate kinase
 gi|123197860|gb|ABM69501.1| Phosphoglycerate kinase [Prochlorococcus marinus str. AS9601]
          Length = 402

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 157/400 (39%), Positives = 247/400 (61%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV++
Sbjct: 1   MSKLSLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ + ++   L  V +    +L +N+   N CIG        SLS G ++L EN
Sbjct: 61  AAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAVAQSNSLSNGDVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRF+ EEE+ND +F   L+ + D Y+NDAF  +HRAHAS  G+++ L PS  G  ++KEL
Sbjct: 121 VRFFGEEEKNDLEFAEKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+       +PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAVDSPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DVV+A E      +++    ++  + + LD+
Sbjct: 241 SLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISQIDAISGNWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPDSIKVFQNALAECKTIIWNGPMGVFEFDKFADGTNAIATTLADLSAFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|95930091|ref|ZP_01312830.1| Phosphoglycerate kinase [Desulfuromonas acetoxidans DSM 684]
 gi|95133785|gb|EAT15445.1| Phosphoglycerate kinase [Desulfuromonas acetoxidans DSM 684]
          Length = 396

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 156/388 (40%), Positives = 237/388 (61%), Gaps = 6/388 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           ++ G R   RVD+NVP    + + D TRI   +PTI  ++E+  K+++ SHLGRP+    
Sbjct: 11  ELTGKRVFCRVDFNVPLDSAQTITDDTRIVAALPTIRYIIEQGGKLILASHLGRPKGSFK 70

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
            + SL  V      +L + +    DC+G  +   IA++++G ++L EN+RFY  EE+NDP
Sbjct: 71  PESSLAPVAPYLSKLLDQPVTMAKDCVGDEVKAQIAAMNDGDVLLLENMRFYPGEEKNDP 130

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   D Y+NDAF  +HRAHAS  G++ LL P+  G  M KEL  L       K+
Sbjct: 131 AFCAELAELADIYVNDAFGTAHRAHASTEGIARLLQPAAAGFLMAKELEYLGQALDAPKR 190

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  A++GG+KVS KIT++  L+ KV+ L+IGGGMA +FL AQG+ +G SL + D  D   
Sbjct: 191 PFAAVIGGAKVSDKITVIDTLLDKVNALLIGGGMAYTFLKAQGVEIGTSLVEIDQLDLAR 250

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +A+++  E+++P D V A+         V + ++ P + + LD+G +T +     +
Sbjct: 251 ELMAKAEKNGVELMLPVDHVTAKAFDKEAAASVYTNEAFPTNEMGLDIGPQTAQAYAAKM 310

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
            +A TV+WNGP+GVFE   F + T  VA  +AK       ISI GGGD++ A+  AG+++
Sbjct: 311 TEAATVVWNGPMGVFEFPAFAKGTFAVAEALAK----SDAISIIGGGDSVAAVNQAGLND 366

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + T++ST GGA LE+LEGK LPGI AL+
Sbjct: 367 QMTHISTGGGASLEFLEGKTLPGIAALT 394


>gi|188996739|ref|YP_001930990.1| Phosphoglycerate kinase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931806|gb|ACD66436.1| Phosphoglycerate kinase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 398

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 247/394 (62%), Gaps = 7/394 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D+ D+ G R  +RVD+NVP  + G + D  RI   VPTI  L+++ AK+++ SHLGR
Sbjct: 7   TLKDV-DVAGKRVFVRVDYNVPIDENGNIEDDVRIRETVPTINYLLDRNAKIILASHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K D   SL+ V    E ++ K + F+ DCIG  + +++ ++ EG I+L EN+RF+ E
Sbjct: 66  PKGKPDPKYSLYPVAKRLERLVGKEVKFLPDCIGDDVEKTVLNMKEGEIVLLENLRFHKE 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSMLESC 183
           EE NDP+F + L++  + Y+ DAF   HR HAS+ G+  ++ P  +G  ++KE+   +  
Sbjct: 126 EENNDPEFAKALAKLAEIYVIDAFGTCHRKHASMYGIKDYVQPVVMGFLLEKEIEYFKKA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA +GGSKVS+K+ ++  L+ KVDK+ IGG MA +F+ A G  VG SL + +
Sbjct: 186 LLNPQRPVVAFLGGSKVSSKLGVIEFLLDKVDKIFIGGAMAFTFIKALGYKVGSSLVEEE 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   +I  +AK    +  +P D +  + +    P   V+ Q +P   + LD+G  +V 
Sbjct: 246 MINKALEIIEKAKEKDVKFYLPVDFICGQAVSDQTPVIEVAWQEIPSGWLGLDIGHASVV 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            IK++I  A+T++WNGP+GVFEI+ F   T E+AH +A    E   +SIAGGGDT  A+ 
Sbjct: 306 LIKEIIKDAQTIVWNGPMGVFEIDKFKMGTFELAHAIA----ESPALSIAGGGDTDYAIH 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG+ ++ +Y+ST GGAFLE LEGK LP + A++
Sbjct: 362 KAGVVDKISYLSTGGGAFLELLEGKQLPCLEAIT 395


>gi|154249426|ref|YP_001410251.1| phosphoglycerate kinase [Fervidobacterium nodosum Rt17-B1]
 gi|171769339|sp|A7HL11|PGK_FERNB RecName: Full=Phosphoglycerate kinase
 gi|154153362|gb|ABS60594.1| Phosphoglycerate kinase [Fervidobacterium nodosum Rt17-B1]
          Length = 400

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 156/398 (39%), Positives = 245/398 (61%), Gaps = 4/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI  ++E+ AKV++ +
Sbjct: 1   MEKL-TIRDV-DLKGKRVIMRVDFNVPIKDGVVTDDTRIVEALPTIKYVLEQGAKVILLT 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   D   ++         +L K + FV    G  + +++A L EG +++ EN R
Sbjct: 59  HLGRPKGGPDPKYTVKPAAERLAQLLGKEVKFVPALYGEEVEKAVAELKEGEVLMLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+ND +  +  +   D ++NDAF  +HRAH+S  G++  +PS  G  M+KE+  L
Sbjct: 119 FDPGEEKNDLELAKKWASLADIHVNDAFGTAHRAHSSNVGIAQYIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   KP V ++GG+KVS KI ++ NL+ K DK++IGG M  +F  A G   G SL 
Sbjct: 179 SKATHNPDKPYVVVLGGAKVSDKIGVITNLLNKADKIIIGGAMMFTFWRALGKQTGNSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   Q+  +AK    E+++P D V A++M+ G+  +V + +  +P      D+G 
Sbjct: 239 EEDKIDLAKQLLEQAKEKGVELVIPTDAVCAQKMEAGVEKKVFTCEEGIPEGWAGYDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            ++E IK  +A A+T++WNGPLGVFEIE F   T  VA ++A LT ++ + ++ GGGD+ 
Sbjct: 299 ASIELIKSKLADAKTIVWNGPLGVFEIEDFANGTKAVAEFIASLT-DKGVTTVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A++  G+  +F++VST GGA LE+LEGK+LPGI +++
Sbjct: 358 AAVSQFGLEKKFSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|148284538|ref|YP_001248628.1| phosphoglycerate kinase [Orientia tsutsugamushi str. Boryong]
 gi|229620375|sp|A5CDP5|PGK_ORITB RecName: Full=Phosphoglycerate kinase
 gi|146739977|emb|CAM80017.1| phosphoglycerate kinase [Orientia tsutsugamushi str. Boryong]
          Length = 403

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 166/397 (41%), Positives = 248/397 (62%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +LR ++D+  ++    LLR+D N+P   GK+ D TRI R +PTI  L+   AKVVI S
Sbjct: 1   MIQLRQLSDVI-VKDKVVLLRLDLNIPQEGGKITDNTRIVRTIPTIKYLILHGAKVVIIS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLG P+ + +   SL  VV+  E++L+  + F  + IG+T   +I ++  G ++L EN+R
Sbjct: 60  HLGNPKGRIELTLSLRSVVTELEALLNIKVQFCPESIGATPKNAIINMKAGEVLLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F S EE ND  F+  L  +GD Y+NDAFS SHR HASI GL   LPS  G  +  EL  L
Sbjct: 120 FNSGEELNDATFINELGSSGDIYVNDAFSCSHRKHASICGLPTKLPSAAGFLLLSELKHL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            S FS + KP   I+GG+K+STK+ LL +L+ K D L++ G MAN FL  +   +G SL 
Sbjct: 180 TSIFSNANKPFTVIIGGAKMSTKLDLLNSLITKADYLIVAGAMANIFLAMKRFNIGASLY 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDVGF 299
           + +  +    I  +A  + C+II+P D V+       I   ++ S+  +  ++ I+D+G 
Sbjct: 240 KPELINVASLILKKATSTNCKIILPFDAVIQNFNSNNITILELNSSLVMQSNAKIMDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T+  I  +I  ++TV+WNGP+G FE  PFD  +  ++  +A+ T+   + SIAGGGDTI
Sbjct: 300 QTIAQIINIIKISKTVVWNGPVGAFEQTPFDYGSTYLSKAIAEKTRTGSLCSIAGGGDTI 359

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+  +G+ ++F+Y+ST GGAFLEWL+GK LPG+ AL
Sbjct: 360 SAIKKSGVIDDFSYISTGGGAFLEWLQGKTLPGVEAL 396


>gi|317968173|ref|ZP_07969563.1| phosphoglycerate kinase [Synechococcus sp. CB0205]
          Length = 401

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 245/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           ++RG R L+RVD+NVP  D G + D TRI   +PTI +LV K AKV++ +H GRP+ + +
Sbjct: 13  ELRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L K ++  + CIG      +A++++G ++L ENVRF++EEE+N+ 
Sbjct: 73  EGMRLTPVAARLSELLGKGVVKTDSCIGPDAEAKVAAMADGDVVLLENVRFFAEEEKNEG 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           DF + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    + K+
Sbjct: 133 DFAKKLANLADVYVNDAFGAAHRAHASTEGVTQYLSPSVAGYLMEKELQYLQGAIDQPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK+++GGGM  +F  A+GM VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALLDKCDKILVGGGMIFTFYKARGMAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +A     + ++P DVV+A        +QV    ++P   + LD+G  +V+  +  +
Sbjct: 253 ELEAKAAAKGVQFLLPTDVVLADNFAPDANSQVAKVDAIPDGWMGLDIGPDSVKVFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A ++  +   +I GGGD++ A+  AG+++
Sbjct: 313 ADCKTVIWNGPMGVFEFDAFAAGTNAIATTLADISG-KGCCTIIGGGDSVAAVEKAGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|147918735|ref|YP_687542.1| 3-phosphoglycerate kinase [uncultured methanogenic archaeon RC-I]
 gi|110622938|emb|CAJ38216.1| 3-phosphoglycerate kinase [uncultured methanogenic archaeon RC-I]
          Length = 403

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 156/395 (39%), Positives = 248/395 (62%), Gaps = 7/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPF--IDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           ++T+ND+ D+   R LLRVD+NVP     G + D TRI   +PTI  L++  AKV+I SH
Sbjct: 3   IKTVNDI-DVTSKRVLLRVDFNVPMEKSGGGIRDDTRIRVCLPTIRYLLDHHAKVIICSH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K D+   +  V      +L + +  + +C+G  + + ++S+++G ++L EN+RF
Sbjct: 62  LGRPKGKIDETLRMTPVARRLSELLGQPVKSLKECVGPEVEKVVSSMNDGDVVLLENLRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+F + L+R  D ++NDAF  SHRAHAS+ G+++ LPS  G  M+KE++ L 
Sbjct: 122 YPGEEKNDPEFAKGLARLADVFVNDAFGASHRAHASVVGVTNYLPSVAGFLMEKEVTSLG 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + ++P  A++GG+KVS K+ +L N+V  VD L+IGGGM  +FL ++G  VG+SL +
Sbjct: 182 GLLEKPERPFAAVIGGAKVSDKLDVLDNIVPDVDVLIIGGGMTATFLKSRGNRVGKSLVE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D    V  ++ +AK     +++P DVVV+  +     ++ VS   +P    I D+G +T
Sbjct: 242 DDKIQYVRDLSEQAKSHDVRLLLPTDVVVSPSLDGTSESRTVSVSDIPDGWFIGDIGPQT 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +      ++  +TV WNGP+GVFE+E F   T E+A  +A+L      + + GGG T+ A
Sbjct: 302 IAEYTGALSGCKTVFWNGPMGVFEVEQFATGTREIASTIARLDA----VKVVGGGSTVEA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G++++ T+VST GGA LE++ GK LPG+ AL
Sbjct: 358 VTRLGVADQMTHVSTGGGATLEFISGKQLPGVKAL 392


>gi|148243328|ref|YP_001228485.1| phosphoglycerate kinase [Synechococcus sp. RCC307]
 gi|166987817|sp|A5GW73|PGK_SYNR3 RecName: Full=Phosphoglycerate kinase
 gi|147851638|emb|CAK29132.1| Phosphoglycerate kinase [Synechococcus sp. RCC307]
          Length = 402

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 244/386 (63%), Gaps = 3/386 (0%)

Query: 13  IRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           +RG R L+RVD+NVP  D G + D TRI   +PTI +L  K AKV++ +H GRP+ + ++
Sbjct: 14  LRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLTGKGAKVILSAHFGRPKGQVNE 73

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           D  L  V +    +L   +   + CIGS     +A++++G ++L ENVRF++EEE+N+  
Sbjct: 74  DMRLTPVAARLSELLGAPVAKTDSCIGSDAEAKVAAMADGDVVLLENVRFFAEEEKNESG 133

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKKP 190
           F   L+   + Y+NDAF  +HRAHAS  G++ +L PS  G  M+KEL  L+    + K+P
Sbjct: 134 FAEKLAALAEVYVNDAFGAAHRAHASTEGVTKYLSPSVAGYLMEKELQYLQGAVDDPKRP 193

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
           L AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   +
Sbjct: 194 LAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVGKSLVEEDKLELAKE 253

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +  +AK    ++++P DVV+A        +QV S  ++P   + LD+G  +++  +  + 
Sbjct: 254 LEAKAKAKGVQLLLPTDVVLADNFAPDANSQVASIDAIPEGWMGLDIGPDSIKVFQDALG 313

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
             +TV+WNGP+GVFE + F   T  +A  +A+L+  +   +I GGGD++ A+  AG++ +
Sbjct: 314 DCKTVIWNGPMGVFEFDKFAAGTNAIATTLAELSA-KGCCTIIGGGDSVAAVEKAGLAAQ 372

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            +++ST GGA LE LEGK LPG+ AL
Sbjct: 373 MSHISTGGGASLELLEGKVLPGVAAL 398


>gi|313893606|ref|ZP_07827175.1| phosphoglycerate kinase [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441877|gb|EFR60300.1| phosphoglycerate kinase [Veillonella sp. oral taxon 158 str. F0412]
          Length = 393

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 155/392 (39%), Positives = 243/392 (61%), Gaps = 9/392 (2%)

Query: 11  RDIRGLRC-----LLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           + I GL+       +RVD+NVP  DG + D TRI   +PTI  LVE+ AKV++ SH GRP
Sbjct: 4   QTIEGLQVANKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLVEQGAKVILASHFGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL         +++K + FV+DCIG  + +++ +L  G I++ EN+R+++EE
Sbjct: 64  KGERKPEMSLAPCAKHLSELINKPVAFVDDCIGPKVEEAVKALQPGDILMLENLRYHNEE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +   
Sbjct: 124 TKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIDALSAAVV 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL +    
Sbjct: 184 HPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLFEEGQE 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
                +  EA+ +  +++ P D VVA        T++V    +    ++LD+G KT E  
Sbjct: 244 AIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIVDVDQIEDGWMVLDIGPKTRELY 303

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
            + +A  +T++WNGP+GVFE+E F   T    + VAK   E   ++I GGGD++ A+  +
Sbjct: 304 VEALAPMKTIIWNGPMGVFEMENFAAGT----NAVAKAVVESDAMTIVGGGDSVAAIEKS 359

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 360 GLADKISHISTGGGASLEFLEGKILPGIAALS 391


>gi|282850379|ref|ZP_06259758.1| phosphoglycerate kinase [Veillonella parvula ATCC 17745]
 gi|282579872|gb|EFB85276.1| phosphoglycerate kinase [Veillonella parvula ATCC 17745]
          Length = 393

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 242/392 (61%), Gaps = 9/392 (2%)

Query: 11  RDIRGLRC-----LLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           + I GL+       +RVD+NVP  DG + D TRI   +PTI  L+EK AKV++ SH GRP
Sbjct: 4   QTIEGLQVANKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLIEKGAKVILASHFGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL         +++K + FV+DCIG  + +++ +L  G +++ EN+R+++EE
Sbjct: 64  KGERKPEMSLAPCAKHLSDLINKPVAFVDDCIGPKVEEAVKALQSGDVLMLENLRYHNEE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +   
Sbjct: 124 TKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIDALSAAIV 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL +    
Sbjct: 184 HPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLFEEGQE 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
                +  EA+ +  +++ P D VVA        T++     +    +ILD+G KT E  
Sbjct: 244 VIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIADVDQIEDGWMILDIGPKTRELY 303

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
            + +A  +T++WNGP+GVFE+E F   T    + VAK   E   ++I GGGD++ A+  +
Sbjct: 304 VEALAPMKTIIWNGPMGVFEMENFAAGT----NAVAKAVAESDAMTIVGGGDSVAAIEKS 359

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 360 GLADKISHISTGGGASLEFLEGKILPGIAALS 391


>gi|237756109|ref|ZP_04584684.1| phosphoglycerate kinase [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691734|gb|EEP60767.1| phosphoglycerate kinase [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 398

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 157/394 (39%), Positives = 245/394 (62%), Gaps = 7/394 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D+ D+ G R  +RVD+NVP  + G + D  RI   VPTI  L+++ AK+++ SHLGR
Sbjct: 7   TLKDV-DVSGKRVFVRVDYNVPIDENGNIEDDVRIRETVPTINYLLDRNAKIILASHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K D   SL+ V    E ++ K + F+ DC+G  + +++  + EG I+L EN+RF+ E
Sbjct: 66  PKGKPDPKYSLYPVAKRLERLVGKEVKFLPDCVGEDVEKTVLYMKEGEIVLLENLRFHKE 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSMLESC 183
           EE NDP+F + L++  + Y+ DAF   HR HAS+ G+  ++ P  +G  ++KE+   +  
Sbjct: 126 EENNDPEFAKALAKLAEIYVIDAFGTCHRKHASMYGIKDYVQPVVMGFLLEKEIEYFKKA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA +GGSKVS+K+ ++  L+ KVDK+ IGG MA +F+ A G  VG SL + +
Sbjct: 186 LLNPQRPVVAFLGGSKVSSKLGVIEFLIDKVDKIFIGGAMAFTFIKALGYKVGSSLVEEE 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
                 +I  +AK    +  +P D +  + +    P   V+ Q +P   + LD+G  +V 
Sbjct: 246 MIKKALEIIEKAKEKDVKFYLPVDFICGQAVSDQTPVIEVAWQEIPSGWLGLDIGHASVV 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            IK++I  A+T++WNGP+GVFEI+ F   T E+AH +A    E   +SIAGGGDT  A+ 
Sbjct: 306 LIKEIIKDAQTIVWNGPMGVFEIDKFKMGTFELAHAIA----ESPALSIAGGGDTDYAIH 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG+ ++ +Y+ST GGAFLE LEGK LP + A++
Sbjct: 362 KAGVVDKISYLSTGGGAFLELLEGKQLPCLEAIT 395


>gi|255544582|ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gi|223547260|gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
          Length = 401

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 253/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L++  A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+  + K  SL  +V     +L   +   +DCIG  + + +A + EGG++L E
Sbjct: 61  LCTHLGRPKGVTPK-YSLKPLVPRLSELLGVEVKMASDCIGEEVEKLVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRF+ EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  MQKE
Sbjct: 120 NVRFHKEEEKNEPEFAKKLAGLADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLEKVDILILGGGMIFTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVV+A +      ++VV A S+P   + LD
Sbjct: 240 SSLVEGDKLDLASSLIEKAKAKGVDLLLPTDVVIADKFAADANSKVVPASSIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +   +T++WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 VGPDAIKTFCEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|120437618|ref|YP_863304.1| phosphoglycerate kinase [Gramella forsetii KT0803]
 gi|117579768|emb|CAL68237.1| phosphoglycerate kinase [Gramella forsetii KT0803]
          Length = 394

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/395 (40%), Positives = 241/395 (61%), Gaps = 5/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ D  +    + L+RVD+NVP   D +V D  RIE   PTI++++E    VV+ SHL
Sbjct: 1   MKTIEDY-NFNNKKALIRVDFNVPLNEDMEVTDANRIEAAKPTIIKILEDGGSVVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K  K  SL  + S    +L   + FV DC+G  +    A L  G I+L EN+RF+
Sbjct: 60  GRPKGKESK-YSLQHITSKVSEVLGVEVKFVEDCVGEEVETKAAELEPGEILLLENLRFH 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSMLE 181
            EE+  D  F R LS+ GD Y+NDAF  +HRAHAS T ++        G  + KE+  L+
Sbjct: 119 EEEKNGDETFARNLSKLGDIYVNDAFGTAHRAHASTTVVAKFFEDKCFGYLLAKEIKSLD 178

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              + ++KP+ A++GG+KVS+KIT++ N++ K+D L+IGGGM  +F+ AQG  +G SL +
Sbjct: 179 KVLNSTEKPVTAVLGGAKVSSKITVIENILDKIDHLIIGGGMTYTFIKAQGGHIGNSLVE 238

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +I  +AK    EI +P D ++A        TQ  S  ++P   + LDVG +T
Sbjct: 239 DDKQELALEILKKAKEKGVEIHLPVDSIIADSFSEQASTQTESVDNIPDGWMGLDVGPET 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +     VIAQ++ ++WNGPLGVFE++ F + T+E+   +A+ TK     S+ GGGD++ A
Sbjct: 299 IRNFSDVIAQSKIILWNGPLGVFEMDTFAKGTIELGEAIAEATK-NGAFSLVGGGDSVAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G+ ++ +YVST GGA LE LEGK LPGI A+
Sbjct: 358 VKKFGLEDKVSYVSTGGGAMLEMLEGKSLPGIDAI 392


>gi|86609153|ref|YP_477915.1| phosphoglycerate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123502133|sp|Q2JKX6|PGK_SYNJB RecName: Full=Phosphoglycerate kinase
 gi|86557695|gb|ABD02652.1| phosphoglycerate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 412

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 238/398 (59%), Gaps = 14/398 (3%)

Query: 12  DIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+R D+NVP    G + D TRI   +PT+  L +  AKV++ SHLGRP  K D
Sbjct: 15  DLAGKRVLVRADFNVPLDAQGNITDDTRIRAALPTVQALTQAGAKVILTSHLGRP-VKKD 73

Query: 71  KDCSLFKVVSIAESI----------LHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           K+    KV     S+          L + + F  DCIG      +  L  G + L ENVR
Sbjct: 74  KETGAVKVAREGNSLAPVATRLSQLLGQPVAFAPDCIGPEAEAVVNRLENGQVALLENVR 133

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSM 179
           FY EEE NDP+F R L+   D ++NDAF  +HRAHAS  G++ +L P+  G  +++EL  
Sbjct: 134 FYPEEEDNDPEFARKLASLADLFVNDAFGSAHRAHASTAGVTAYLQPAVAGYLVERELQF 193

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++PL AI+GGSKVSTKI ++  L++KVDKL++GGGM  +F  AQG+  G+SL
Sbjct: 194 LSGAIEDPRRPLAAIIGGSKVSTKIGVIERLLEKVDKLLLGGGMIFTFYQAQGIQTGKSL 253

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D    +  +AK    E+++P DVVVA         Q VS  ++P D + LD+G 
Sbjct: 254 VETDKLDLARSLMEKAKERGVELLLPVDVVVADRFDKDAQAQTVSIHAIPEDWMGLDIGP 313

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++V+  +  +   +TV+WNGP+GVFE + F   T  +A  +A LT +    +I GGGD++
Sbjct: 314 ESVKAFQSALQGCQTVVWNGPMGVFEFDRFALGTEAIARTLADLT-QAGATTIIGGGDSV 372

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+   G++++ T++ST GGA LE LEGK LPGI AL+
Sbjct: 373 AAVEKVGLADKMTHISTGGGASLELLEGKVLPGIAALT 410


>gi|119513809|ref|ZP_01632780.1| phosphoglycerate kinase [Nodularia spumigena CCY9414]
 gi|119461537|gb|EAW42603.1| phosphoglycerate kinase [Nodularia spumigena CCY9414]
          Length = 388

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 162/391 (41%), Positives = 246/391 (62%), Gaps = 7/391 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +T+ +L   DI G R L+RVD+NVP  D G + D TRI   +PTI +L+EK AKV+
Sbjct: 1   MSK-KTLANLSAADISGKRALVRVDFNVPVDDNGNITDDTRIRAALPTIQDLMEKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+   DK   L  V      +L + ++  +DCIG  ++  + +L  G ++L E
Sbjct: 60  LASHFGRPKGVDDK-LRLTPVAQRLSELLGQEVVKTDDCIGDAVTAQVGALQNGQVLLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+ N DFY+NDAF  +HRAHAS  G++H L PS  G  ++KE
Sbjct: 119 NVRFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHASTEGVTHYLSPSVGGYLIEKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+S     ++PL AI+GGSKVS+KI ++  L+ K DKL+IGGGM  +F  A+G+ VG
Sbjct: 179 LQYLQSAIENPQRPLAAIIGGSKVSSKIGVIETLLDKCDKLIIGGGMIFTFYKARGLSVG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P D+V A +         VS +++P D + LD
Sbjct: 239 KSLVEEDKLELAKTLEAKAKERGVALLLPTDIVSADKFAPDANATTVSIENIPADGMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A  +TV+WNGP+GVFE + F   T  +AH +A++ K      I  GG
Sbjct: 299 IGPDSIKVFQAALADCKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIG-GG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEG 387
           D++ A+   G++++ +++ST GGA LE LEG
Sbjct: 358 DSVAAVEKVGLADQMSHISTGGGASLELLEG 388


>gi|24214403|ref|NP_711884.1| phosphoglycerate kinase [Leptospira interrogans serovar Lai str.
           56601]
 gi|30173000|sp|Q8F5H8|PGK_LEPIN RecName: Full=Phosphoglycerate kinase
 gi|24195342|gb|AAN48902.1| phosphoglycerate kinase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 396

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 241/385 (62%), Gaps = 4/385 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  LRVD+NVP  +GKV D TRIE+ +PTI  L++K A+++I SHLGRP+ + + 
Sbjct: 10  DLSGKRVFLRVDFNVPVENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQVNP 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  VV   +S++   + F    IG    +    L  G I++ ENVRF+ EEE NDP 
Sbjct: 70  EFSLAPVVETFQSLVKSKVYFSKTVIGEDAIKLSKELKNGEILVIENVRFHKEEEENDPG 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + LS   D Y+NDAF  +HRAH+S  G++ LLP+Y G  M KE+  L +   +  +P 
Sbjct: 130 FSKKLSALADIYVNDAFGAAHRAHSSTEGIARLLPAYAGLLMHKEILELSALLHKPARPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GGSKVSTKI +L NL  KV+ L+IGGGMA +FL ++ + +G SL +++F     Q+
Sbjct: 190 VAIIGGSKVSTKIKVLTNLFDKVNHLLIGGGMAYTFLKSRAIPIGNSLVEKEFEVQAFQL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A  +  ++ +P D ++  +      T+ V    +    + +D+G KTV   +++I  
Sbjct: 250 IEKAGVAGIDLQLPVDHIIGDQFNEKAKTKSVDKMGILDGWMGMDIGSKTVSNYEKIIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A T+ WNGP+GVFE++ F   T+ +A  VAK        ++ GGGD+I A+  AG++++ 
Sbjct: 310 AGTIFWNGPMGVFEMDKFASGTMAIAKAVAKSKA----KTVVGGGDSIAAINKAGVADKI 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T++ST GGA LE++EG+ LPG+ AL
Sbjct: 366 THISTGGGASLEFMEGRKLPGVEAL 390


>gi|288554076|ref|YP_003426011.1| phosphoglycerate kinase [Bacillus pseudofirmus OF4]
 gi|288545236|gb|ADC49119.1| phosphoglycerate kinase [Bacillus pseudofirmus OF4]
          Length = 393

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/393 (40%), Positives = 246/393 (62%), Gaps = 5/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G +   RVD+NVP  DG++ D TRI   +PTI  L+EK AKV++ SHLGR
Sbjct: 4   KTVRDI-DLKGKKVFCRVDFNVPMKDGEITDETRIRAALPTIEFLIEKGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +  ++  L  V +    +L+K++  V++  G+    +  SL +G ++L ENVRFY+ 
Sbjct: 63  PKGEVVEELRLTPVAARLGELLNKDVKKVDEAHGAEAEAAANSLQDGDVLLLENVRFYAG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFASLADVYVNDAFGAAHRAHASTEGIAKHIPAVAGLLMEKELDVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ AQG  VG+SL + D 
Sbjct: 183 SNPERPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKAQGHEVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D       +AK    +  +P DVVVA +      T+VV   S+P D   LD+G KT + 
Sbjct: 243 IDLARSFMDKAKEKGVKFYMPEDVVVADDFSEEANTEVVDIDSIPADWEALDIGPKTRDT 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE+  F   T  VA  +A         S+ GGGD+  A+  
Sbjct: 303 YRSVIEESKLVIWNGPMGVFELSVFANGTKAVADALAT----SDAYSVIGGGDSAAAVEK 358

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             ++++ +++ST GGA LE++EGK LPG+VAL+
Sbjct: 359 FDLADKMSHISTGGGASLEFMEGKQLPGVVALN 391


>gi|258510740|ref|YP_003184174.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477466|gb|ACV57785.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 395

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 155/385 (40%), Positives = 240/385 (62%), Gaps = 6/385 (1%)

Query: 14  RGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKD 72
           +G R L+RVD+NVP  D + + D TRI   +PTI  L ++ A+V++ SHLGRP+ + +  
Sbjct: 12  QGKRALVRVDFNVPMDDARQITDDTRIRAALPTITYLSDRGARVILMSHLGRPKGEPNPK 71

Query: 73  CSLFKVVS-IAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
            SL  V   +A  I  K + F  + +G    +++++L++G I+L ENVRFY  EE+NDP 
Sbjct: 72  YSLRPVADHLASLIPDKRVSFCPEAVGEEAQKAVSALADGDILLLENVRFYPGEEKNDPA 131

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F R L+  GD ++NDAF  +HRAHAS  G++  LP   G  M++E+ ++    +  ++P 
Sbjct: 132 FARQLADLGDVFVNDAFGSAHRAHASTAGIAQYLPCVAGFLMEREVGIMGKALANPERPF 191

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL  +G  + +SL + D  +   ++
Sbjct: 192 VAIIGGAKVSDKIKVIENLLPKVDALIIGGGMANTFLAVEGHDMAKSLVEEDAKETARRL 251

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              A+ S  ++++P DVV A+         V     +  D + LDVG  +VE  +  I  
Sbjct: 252 LDLARTSNRKLLLPVDVVAAKAFAPDAEHTVRLVSELQPDEMALDVGPASVEMFRNEILG 311

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A+TV+WNGP+GVFE+  F + T  +A  +A    E    +I GGGD++ A+  AG++++ 
Sbjct: 312 AKTVIWNGPMGVFEMPAFAKGTFAIAQAMA----EADATTIVGGGDSVAAVEQAGVADKM 367

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T+VST GGA LE+LEG+ LPG+  +
Sbjct: 368 THVSTGGGASLEFLEGRTLPGVAVI 392


>gi|253700505|ref|YP_003021694.1| phosphoglycerate kinase [Geobacter sp. M21]
 gi|259530759|sp|C6E770|PGK_GEOSM RecName: Full=Phosphoglycerate kinase
 gi|251775355|gb|ACT17936.1| Phosphoglycerate kinase [Geobacter sp. M21]
          Length = 399

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 159/400 (39%), Positives = 240/400 (60%), Gaps = 8/400 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +R ++++ ++ G +  +RVD+NVP  D + + + TRI  V+P+I   +++KAK+++ SHL
Sbjct: 3   IRYIDEIENLSGKKLFMRVDFNVPLDDNQNITEDTRIRAVLPSINYALDQKAKIILASHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +  +  S+         +L K +   +DCIG  +   I ++  G +I+ ENVRFY
Sbjct: 63  GRPKGERKEKYSMAPAAKRLSRLLGKEVKLASDCIGDEVKAMINAMQPGDVIMLENVRFY 122

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLE 181
           + EE+ND DF + L+ + D Y+NDAF+VSHRAHAS+  +++  P    G  M+ E++  E
Sbjct: 123 AGEEKNDADFAKALANDCDVYVNDAFAVSHRAHASVEAITNCFPVVAAGFLMKNEMNYFE 182

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  +PLVAI+GG+KVS KI +L NL  KVDK++IGGGMA +FL   G  VG+SL +
Sbjct: 183 KAMKNPIRPLVAILGGAKVSGKIEVLENLCDKVDKIIIGGGMAFTFLKGMGYNVGKSLVE 242

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +  D   +   +A+    +  +P D VVA +      T+V   Q +P   + LDVG  T
Sbjct: 243 DNLIDTAMKTYEKARAQGVKFYLPVDCVVADQFNPAAETKVCPIQEIPEGWMALDVGPAT 302

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V    + +  A+T++WNGP+GVFE++ F R T  +   VA        ++I GGGDT  A
Sbjct: 303 VTLFTEALQNAKTIVWNGPMGVFEMDAFSRGTFAMVSAVAN----SYALTIVGGGDTDVA 358

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS--GH 399
           +  AG   + +Y+ST GGAFLE LEGK LPGI  L   GH
Sbjct: 359 VHRAGEYAKISYISTGGGAFLELLEGKKLPGIKVLEDKGH 398


>gi|126662711|ref|ZP_01733710.1| phosphoglycerate kinase [Flavobacteria bacterium BAL38]
 gi|126626090|gb|EAZ96779.1| phosphoglycerate kinase [Flavobacteria bacterium BAL38]
          Length = 395

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 242/396 (61%), Gaps = 6/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND  +    + ++RVD+NVP  +  KV D TRIE   PTI ++++    V++ SHL
Sbjct: 1   MKTLNDF-NFNNKKAIIRVDFNVPLDENFKVTDATRIEAAKPTIDKILKDGGSVILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+    K  SL  +V     IL + + F +DCIG     +  +L  G I+L EN+RFY
Sbjct: 60  GRPKGVEAK-YSLQHIVEKTAEILGQKVHFASDCIGEVAETAAKNLQPGEILLLENLRFY 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
           +EEE+ D DF + L+  GD Y+NDAF  +HRAHAS T ++         G  + KE+  +
Sbjct: 119 AEEEKGDVDFAKKLASLGDIYVNDAFGTAHRAHASTTIIAQFFKDAKCFGYLLAKEIESI 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E     S+KP+VAI+GGSKVS+KIT++ N++ KV+ ++IGGGM  +F+ A G  +G S+C
Sbjct: 179 EKVLKNSEKPVVAILGGSKVSSKITVIENILDKVNHMIIGGGMTFTFVKALGGSIGDSIC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   +I  +AK    +I +P DV+ A        TQVV    +P     LD G K
Sbjct: 239 EDDKLELAIEILKQAKEKGVQIHIPVDVIAADAFSNDANTQVVDVNQIPDGWQGLDAGPK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++E  K++I  ++T++WNGPLGVFE+E F + T+ +  ++A+ T      S+ GGGD++ 
Sbjct: 299 SLEIFKRIILDSKTILWNGPLGVFEMESFAKGTIALGDFIAESTA-NGAFSLVGGGDSVA 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G  ++ +YVST GGA LE LEG+ LPGI A+
Sbjct: 358 AVKQFGFEDKMSYVSTGGGAMLEMLEGRTLPGIAAI 393


>gi|218290984|ref|ZP_03495032.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius LAA1]
 gi|218239066|gb|EED06270.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius LAA1]
          Length = 395

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/385 (40%), Positives = 238/385 (61%), Gaps = 6/385 (1%)

Query: 14  RGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKD 72
           +G R L+RVD+NVP  D + + D TRI   +PTI  L +  A+V++ SHLGRP+ + +  
Sbjct: 12  QGKRALVRVDFNVPMDDARRITDDTRIRAALPTITYLSDHGARVILMSHLGRPKGEPNSK 71

Query: 73  CSLFKVVSIAESIL-HKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
            SL  V     S+L +K + F    IG     ++++L++G I+L ENVRFY  EE+NDP 
Sbjct: 72  YSLQPVAEHLASLLPNKRVSFCPAAIGEEAQAAVSALADGDILLLENVRFYPGEEKNDPA 131

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F R L+  GD ++NDAF  +HRAHAS  G++  LP   G  M+KE+ ++    +  ++P 
Sbjct: 132 FARQLADLGDVFVNDAFGSAHRAHASTAGIAEYLPCVAGFLMEKEVGIMGKALANPERPF 191

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL  +G  + +SL + D  D   ++
Sbjct: 192 VAIIGGAKVSDKIKVIENLLPKVDALIIGGGMANTFLTVEGHDMAKSLVEEDAKDTARRL 251

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              A+ S  ++++P DVV A+         V     +  D + LD+G  +VE  +  I  
Sbjct: 252 LDLARASNRKLLLPVDVVAAKAFAPDAEHAVRLVSELQPDEMALDIGPASVEMFRNEILG 311

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A+TV+WNGP+GVFE+  F + T  +A  +A    E    +I GGGD++ A+  AG++++ 
Sbjct: 312 AKTVIWNGPMGVFEMPAFAKGTFAIAQTMA----EADATTIVGGGDSVAAVEQAGVADKM 367

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T+VST GGA LE+LEG+ LPG+  +
Sbjct: 368 THVSTGGGASLEFLEGRTLPGVAVI 392


>gi|124516460|gb|EAY57968.1| phosphoglycerate kinase [Leptospirillum rubarum]
 gi|206603301|gb|EDZ39781.1| Phosphoglycerate kinase [Leptospirillum sp. Group II '5-way CG']
          Length = 399

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 245/403 (60%), Gaps = 16/403 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKVVI 58
           MS  +   D  D+RG R  LR D+NVP +DG   + D  RI   +PTI  L+++ AKV+I
Sbjct: 1   MSPSKVSVDEIDVRGKRVFLRADFNVP-LDGDLHITDDRRIRLSLPTINYLIDEGAKVII 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+ K D   S+  V      +L+K+I F +  +G  + + +  +  GG++L EN
Sbjct: 60  GSHLGRPKGKVDPKYSMAPVAKRLSRLLNKDIRFSDQVVGPVVEREVEKMEAGGVLLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
           +RF + EE NDP+F R LS   D Y+NDAF  +HRAHAS+ GL  LL +  IG  M+KE+
Sbjct: 120 LRFNAGEESNDPEFSRQLSLLCDVYVNDAFGTAHRAHASVVGLPSLLKTVAIGFLMKKEV 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
           + L+   S   +P VA++GG KVS K+ ++ NL +KVDK++IGGGMA +F  A G  +G 
Sbjct: 180 NYLQGAVSSPTRPFVAVLGGGKVSGKLGVIANLQEKVDKIIIGGGMAFTFYKAMGFEIGD 239

Query: 238 SLCQRDFSDNVHQIAWE----AKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSI 293
           SL +    DN+  I  E    +++   ++ +P D +VA       PT++V  Q +P    
Sbjct: 240 SLVE----DNLLHIPLEMLEKSRKGGFKLYLPVDCIVAESRDPAAPTKIVPYQEIPKGWT 295

Query: 294 ILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIA 353
            LD+G  +V    +V+  A+T++WNGP+GVFEI+ + R T  +AH VA        +++ 
Sbjct: 296 GLDIGPASVRLFSEVLDNAKTILWNGPMGVFEIDAYSRGTFAMAHAVAN----SYALTVV 351

Query: 354 GGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           GGGDT  A+  AG ++  T++ST GGA LE LEGK+LPG+ A+
Sbjct: 352 GGGDTALAVYRAGEADNMTFISTGGGAALELLEGKELPGLKAI 394


>gi|299138683|ref|ZP_07031861.1| Phosphoglycerate kinase [Acidobacterium sp. MP5ACTX8]
 gi|298599319|gb|EFI55479.1| Phosphoglycerate kinase [Acidobacterium sp. MP5ACTX8]
          Length = 403

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/401 (41%), Positives = 246/401 (61%), Gaps = 13/401 (3%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           ++ DL D+ G R L+RVD+NVP   +G + D TRI   +PTI   + +KA+V++ +HLGR
Sbjct: 5   SIRDL-DLTGKRVLIRVDFNVPLSKEGTITDDTRIRETIPTIEYALRRKARVILAAHLGR 63

Query: 65  PQSKSDKDCSLFKVVSIAESILH------KNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           P+ K     SL  VV    S+L       +N+ F  DC+G    +   +L  G  +L EN
Sbjct: 64  PKGKHVDAMSLRPVVDRLRSLLDHVLDPDENVAFAPDCVGPVAIELADNLEPGQTLLLEN 123

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKEL 177
           +RF++EEE NDP F R L++  D Y+NDAF  +HRAHAS  G++H +  S  G  M+KEL
Sbjct: 124 LRFHAEEEANDPAFARQLAQLCDIYVNDAFGAAHRAHASTEGITHFVAQSAAGLLMEKEL 183

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
           + L    +E  +P VAI+GG+KVS KI ++  L+ KVD L+IGG MA +FL AQG   G+
Sbjct: 184 NYLGKAVAEPNRPFVAIIGGAKVSDKIEVINALLNKVDALLIGGAMAYTFLNAQGQTTGK 243

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA-QSVPLDSIILD 296
           SL + D  D       +A+    + ++P D V+A +      TQ+ S  +  P D + LD
Sbjct: 244 SLVEADKYDIARAALEKAEAREVKFLLPVDHVLADKFGADAKTQIFSGTKPFPADLMALD 303

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G +T++     IA+A TV+WNGP+GV E+ PF + T  VA  +A   K    ISI GGG
Sbjct: 304 IGPETIKLFAAEIAEAATVVWNGPMGVAELAPFAKGTNAVAKALA---KNEDAISIVGGG 360

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ AL ++G++++ T++ST GGA LE+LEGK LPG+  L+
Sbjct: 361 DSVAALHNSGVADKITHISTGGGASLEFLEGKTLPGVATLT 401


>gi|289450877|ref|YP_003474933.1| triose-phosphate isomerase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289185424|gb|ADC91849.1| triose-phosphate isomerase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 651

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 247/397 (62%), Gaps = 9/397 (2%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPF--IDGKVADVTRIERVVPTILELVEKKAKV 56
           M++L  +++ D+ ++ G R + RVD+NVP     G + D  RI   +PTI  L++  AK+
Sbjct: 1   MAKLLKKSIEDI-EVTGKRVIARVDFNVPQDKATGAITDDKRIRAALPTIQYLIDHGAKL 59

Query: 57  VIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILA 116
           ++ SHLGRP++  +   S+  V +    +L K +    D IG      IA++ +G +++ 
Sbjct: 60  ILVSHLGRPKNGPEDKFSMRPVAARLSELLGKEVTLAKDVIGDDAKAKIAAMHDGDVVML 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           ENVRF+ EE +N+P F R L+   + ++NDAF  +HRAHAS  GL++ LPS  G  +QKE
Sbjct: 120 ENVRFHKEETKNNPAFARELASLAEIFVNDAFGTAHRAHASTAGLANYLPSVCGFLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L ++    +  K+PLVAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  A+G  VG
Sbjct: 180 LKIMGDAINNPKRPLVAILGGAKVSDKIGVIENLIAKVDTLIIGGGMAYTFFAAKGYEVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +A+    ++++P D VV +E K      VV++ ++P D + +D
Sbjct: 240 KSLLEADKIELAKGLLAKAEDKGVKLLLPVDTVVVKEFKADAAATVVASDAIPADQMGMD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  K  IA A TV+WNGP+GVFE + F   T  +A  V+    E   ISI GGG
Sbjct: 300 IGPESVKLFKAAIADAGTVIWNGPMGVFEFDAFAVGTRAIAQAVS----ESGAISIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           D+  A+   G +++ T++ST GGA LE+LEGK LPGI
Sbjct: 356 DSAAAIEKLGFADKVTHISTGGGASLEFLEGKVLPGI 392


>gi|297834088|ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297330766|gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 481

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 162/396 (40%), Positives = 248/396 (62%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L++  AKV++ +H
Sbjct: 80  KSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTH 139

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   +   +DCIG  +   +ASL EGG++L ENVRF
Sbjct: 140 LGRPKGVTPK-FSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRF 198

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 199 YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 258

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 259 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 318

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++  +AK     +++P DVVVA +      +++V A  +    + LD+G  
Sbjct: 319 EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD 378

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   + +   +TV+WNGP+GVFE+E F   T  VA+ +A+L+  + + +I GGGD++ 
Sbjct: 379 SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSG-KGVTTIIGGGDSVA 437

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   +++ST GGA LE LEGK LPG++AL
Sbjct: 438 AVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|221195801|ref|ZP_03568854.1| phosphoglycerate kinase [Atopobium rimae ATCC 49626]
 gi|221184275|gb|EEE16669.1| phosphoglycerate kinase [Atopobium rimae ATCC 49626]
          Length = 396

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/393 (39%), Positives = 241/393 (61%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D  D+ G R L+RVD+NVP  DG V D TR+   +PTI  L++  AKV++ SHLGR
Sbjct: 6   KTVRD-ADVDGKRVLMRVDFNVPLKDGVVTDDTRVRAALPTIQYLLDHNAKVILMSHLGR 64

Query: 65  PQSKS-DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P       + SL         +L K + FV D  G    +++ SL  G +++ ENVRF  
Sbjct: 65  PDGTGFQPELSLRPAAEKLSELLGKPVKFVEDTYGEKAKEAVDSLESGQVLVLENVRFDK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  ++L+  GD ++ DAF  +HRA  S+ G +  LP+Y G  ++KE+  L S 
Sbjct: 125 REKKNDPEIAKILASYGDIFVLDAFGTAHRAQGSVVGPAAYLPAYAGFLLEKEVDTLTSI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           F++  +P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G  VG SL + D
Sbjct: 185 FADPARPFVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAKGYTVGTSLQEPD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+   C+I++P D VVA         + V++ ++P D + +D+G KTV+
Sbjct: 245 WVEPAKKMLEKAEAKGCKILLPVDNVVADHFGEDAKGEAVNSDNIPDDRMGMDIGPKTVQ 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
                I  A+TV WNGP+GVFE + F + T  VA  +A    +    SI GGGD++ A+ 
Sbjct: 305 LYTDAIKGAKTVFWNGPMGVFEFDQFAKGTEAVARAIA----DSDCTSIIGGGDSVAAIN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G++++ +++ST GGA +E +EGK LPG+ AL
Sbjct: 361 KFGLADKMSWISTGGGASMELVEGKALPGVEAL 393


>gi|15616121|ref|NP_244426.1| phosphoglycerate kinase [Bacillus halodurans C-125]
 gi|20138853|sp|Q9K714|PGK_BACHD RecName: Full=Phosphoglycerate kinase
 gi|10176183|dbj|BAB07278.1| phosphoglycerate kinase [Bacillus halodurans C-125]
          Length = 394

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 232/386 (60%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           +++G +   RVD+NVP  DG V D TRI   +PTI  L EK A++++ SHLGRP+ +  +
Sbjct: 10  ELQGKKVFCRVDFNVPMKDGVVTDDTRIRAALPTIQLLAEKGARIILASHLGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +  + +L K +  VN   G    Q+   L +G ++L ENVRFY  EE+NDP+
Sbjct: 70  ELRLDPVAARLQELLGKPVAKVNVAHGPEAEQAANELKDGDVLLLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D Y+NDAF  +HRAHAS  G++H + +  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKAFASLADVYVNDAFGAAHRAHASTEGIAHHVTAVAGLLMEKELEVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL + D  D     
Sbjct: 190 TAIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFIKAQGHEIGKSLLEADKMDLALSF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK       VP+D +VA +      T+ V    +P D   LD+G KT E  + VI  
Sbjct: 250 MEKAKEKGVNFYVPQDAIVADDFSNDANTKAVDIDQIPADWEALDIGPKTRETYRNVIQS 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE++ F   T  VA  +A       +I   GGGD+  A+   G++N+ 
Sbjct: 310 SKLVIWNGPMGVFELDAFAGGTKAVAEALADANDTYSVI---GGGDSAAAVEKFGLANQM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK LPG+VAL+
Sbjct: 367 SHISTGGGASLEFMEGKALPGVVALN 392


>gi|81299925|ref|YP_400133.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
 gi|123556987|sp|Q31P73|PGK_SYNE7 RecName: Full=Phosphoglycerate kinase
 gi|81168806|gb|ABB57146.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
          Length = 402

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/400 (40%), Positives = 248/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ RT+  L   D+ G R L+RVD+NVP   +GK+ D TRI   +PTI  L E  AKV+
Sbjct: 1   MSK-RTLASLTAADLEGKRVLVRVDFNVPLDGNGKITDDTRIRAALPTIRYLSESGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L  V      +L + ++   D +G+     +A+ S G ++L E
Sbjct: 60  LVSHFGRPKGKPVESMRLTPVAERLSELLGRPVVKTTDAVGAGAEAQVAATSNGQVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRF++EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++ +L P   G  ++KE
Sbjct: 120 NVRFHAEEEANDAEFAKALASLADIYVNDAFGAAHRAHASTAGVTEYLSPCVAGYLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+ VG
Sbjct: 180 LQYLQAAIDNPQRPLAAIVGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +A+    ++++P DVVVA +       + V+  ++P   + LD
Sbjct: 240 GSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  ++ +A  R+V+WNGP+GVFE + F   T  +A  +A LT+ +   +I GGG
Sbjct: 300 IGPESVKQFEEALADCRSVIWNGPMGVFEFDQFAVGTEAIARSLAGLTR-KGATTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++E +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|116071998|ref|ZP_01469266.1| phosphoglycerate kinase [Synechococcus sp. BL107]
 gi|116065621|gb|EAU71379.1| phosphoglycerate kinase [Synechococcus sp. BL107]
          Length = 401

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 238/387 (61%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +LV K AKVV+ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVVLSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K +   + CIG      + +++ G ++L ENVRF++EEE+ND 
Sbjct: 73  DAMRLTPVAARLSELLGKTVTKTDSCIGPDAEAKVGAMANGDVVLLENVRFFAEEEKNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAGLADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        +Q+    ++P   + LD+G   ++  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDANSQIADVTAIPDGWMGLDIGPDAIKVFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A++   +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAEIGG-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|269798150|ref|YP_003312050.1| phosphoglycerate kinase [Veillonella parvula DSM 2008]
 gi|269094779|gb|ACZ24770.1| phosphoglycerate kinase [Veillonella parvula DSM 2008]
          Length = 392

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 243/392 (61%), Gaps = 9/392 (2%)

Query: 11  RDIRGLRC-----LLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           + I GL+       +RVD+NVP  DG + D TRI   +PTI  L+EK AKV++ SH GRP
Sbjct: 3   QTIEGLQVANKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLIEKGAKVILASHFGRP 62

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL         +++K + FV+DCIG  + +++ +L  G +++ EN+R+++EE
Sbjct: 63  KGERKPEMSLAPCAKHLSDLINKPVAFVDDCIGPKVEEAVKALQSGDVLMLENLRYHNEE 122

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +   
Sbjct: 123 TKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIDALSAAIV 182

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             K P+ AI+GG+KV+ KI+++ +L+ KVD ++IGGGMAN+F+ AQG  +G SL +    
Sbjct: 183 HPKTPMAAIIGGAKVTDKISVISSLLPKVDVMIIGGGMANAFIKAQGCNIGSSLFEEGQE 242

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
                +  EA+ +  +++ P D VVA        T++V    +    +ILD+G KT E  
Sbjct: 243 VIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIVDVDQIEDGWMILDIGPKTRELY 302

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
            + +A  +T++WNGP+GVFE+E F   T    + VAK   E   ++I GGGD++ A+  +
Sbjct: 303 VEALAPMKTIIWNGPMGVFEMENFAAGT----NAVAKAVAESDAMTIVGGGDSVAAIEKS 358

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 359 GLADKISHISTGGGASLEFLEGKILPGIAALS 390


>gi|254995461|ref|ZP_05277651.1| phosphoglycerate kinase [Anaplasma marginale str. Mississippi]
          Length = 398

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/388 (43%), Positives = 241/388 (62%), Gaps = 9/388 (2%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M  +RT+  +++  +RG R LLRVD+NVP   G+V D TRIERV PT+  LV+  AKV++
Sbjct: 14  MKNIRTLPWVQNSSVRGCRVLLRVDFNVPVEHGQVRDRTRIERVAPTVDYLVKAGAKVIM 73

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP S  D D SL  +V     +L   + FV DC G  +   + +L  G ++L EN
Sbjct: 74  VSHFGRP-SCVDADFSLEPLVGTISEVLGVPVTFVGDCFGERVCTVVNALPWGSVVLLEN 132

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RF++ EE+NDP F + L+   D Y+NDAFS SHR HASI  ++  LP+  G  +Q EL 
Sbjct: 133 LRFHAGEEKNDPAFAKQLASMADLYVNDAFSCSHRMHASIDAITKFLPAAAGLNLQDELH 192

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +  SE   P+ A++GG+K S+KI +L NL +KVD LV+GGG++NSFL A G  +G S
Sbjct: 193 YLGNIVSE--HPVAAVIGGAKTSSKIPMLRNLAQKVDFLVLGGGLSNSFLRASGHKIGSS 250

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + +    D VH +   A++S C +IVPRD VVAR +     T+    + V  +  I D+G
Sbjct: 251 VYE-PCDDAVHAVLESARKSNCCVIVPRDHVVARNLDCSAQTK--QNKDVGEEDCIFDIG 307

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T   + +V+ + +TV WNGP+GVFE   F   T ++   +  L KE+ + +I GGGD+
Sbjct: 308 TQTSAEVAEVLGKCKTVFWNGPMGVFERAAFATGTSDLIRNLVCLKKEKGVSTIVGGGDS 367

Query: 359 ITALAHAGISNE-FTYVSTAGGAFLEWL 385
           I A+  +G S E F+YVST GGA L++L
Sbjct: 368 IFAIKASGYSAEDFSYVSTGGGALLQFL 395


>gi|126178878|ref|YP_001046843.1| phosphoglycerate kinase [Methanoculleus marisnigri JR1]
 gi|125861672|gb|ABN56861.1| phosphoglycerate kinase [Methanoculleus marisnigri JR1]
          Length = 403

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 239/386 (61%), Gaps = 5/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+RG R L+R D+NVP  + G +AD TRI   +PTI  L E+ A+V++ SHL RP+ +  
Sbjct: 16  DVRGKRVLVRADFNVPLDEEGAIADDTRIRASLPTINYLCERGARVILCSHLDRPKGEIV 75

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +   ++L + ++ + DCIG  +  ++A++S+G I+L EN+RF+ EE  +DP
Sbjct: 76  ERLRLALVANRLSALLGRPVVALRDCIGPEVESAVAAMSDGDIVLLENLRFHPEERADDP 135

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKP 190
            F   L+   + Y+NDAF  SHR+HAS+ G+   LP+  G  +++E+S       + ++P
Sbjct: 136 SFSEKLADLAEVYVNDAFGASHRSHASVVGVPQHLPAVAGLLLEREVSAFTRILQDPERP 195

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
             A++GG+KVS K+ +L N++ +VD L+IGGGMA +FL ++G   G S  + D  D+V +
Sbjct: 196 FAAVIGGAKVSDKLGVLDNVISRVDLLLIGGGMAATFLASRGYPTGASHVETDRLDDVRR 255

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +   A +    +++PRDVVVA   +TG PT+VV A  VP   +I D+G +  +   + + 
Sbjct: 256 VEENAAKRGVRLVLPRDVVVAERPETGAPTRVVPATEVPDGQVIADIGPEAADEFSRELG 315

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
            ARTV+WNGP+GVFE+  F   T  VA  +A L    R  ++ GGG T  A+   G+++E
Sbjct: 316 GARTVVWNGPVGVFEVPEFAEGTRRVAAALANL----RGTTVIGGGSTTDAVQRFGLADE 371

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            T+VST GGA L  L GK LPG  AL
Sbjct: 372 MTHVSTGGGAALAMLAGKPLPGFEAL 397


>gi|86134874|ref|ZP_01053456.1| phosphoglycerate kinase [Polaribacter sp. MED152]
 gi|85821737|gb|EAQ42884.1| phosphoglycerate kinase [Polaribacter sp. MED152]
          Length = 395

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 244/396 (61%), Gaps = 6/396 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ND  +    R ++RVD+NVP  D  +V D TRI+    TI++++E     V+ SHL
Sbjct: 1   MKTLNDF-NFDKKRAIIRVDFNVPLNDNFEVTDNTRIQAAKSTIIKVLEDGGSCVLMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K + + SL  VV     ++  N+ FV+DCIG  + +++A+L  G I+L EN+RFY
Sbjct: 60  GRPKGKQE-EFSLKHVVKSVVDVIGCNVKFVDDCIGPKVEEAVANLDAGEILLLENLRFY 118

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSML 180
            EE+  D  F   LS+ GD Y+NDAF  +HRAHAS T ++         G  + +E+  +
Sbjct: 119 EEEKNGDVAFAEKLSKFGDIYVNDAFGTAHRAHASTTIIAQFFEENKCFGNLLAREIESI 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +   + S+KP++AI+GG+KVS+KIT++ N++ KVD L+IGGGM  +F+ AQG  VG S+C
Sbjct: 179 DKVLNNSEKPVLAILGGAKVSSKITVIKNILDKVDHLIIGGGMTFTFIKAQGGSVGDSIC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    I  +AK    E+ +P DV+ A        TQV+    +P     LD G K
Sbjct: 239 EDDKMELALDILKQAKEKGVEVHIPVDVIAADAFNNDANTQVIDVTVIPDGWQGLDAGPK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++E    V+ + +T++WNGPLGVFE+E F + T+ + + +   TK     S+ GGGD++ 
Sbjct: 299 SLENFDAVVNKCKTILWNGPLGVFEMESFAKGTIALGNSIDNATK-NGAFSLVGGGDSVA 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G +++ +YVST GGA LE LEGK LPGI A+
Sbjct: 358 AVKQFGFADKVSYVSTGGGAMLEMLEGKSLPGIEAI 393


>gi|255003652|ref|ZP_05278616.1| phosphoglycerate kinase [Anaplasma marginale str. Puerto Rico]
 gi|255004777|ref|ZP_05279578.1| phosphoglycerate kinase [Anaplasma marginale str. Virginia]
          Length = 390

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/388 (43%), Positives = 241/388 (62%), Gaps = 9/388 (2%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M  +RT+  +++  +RG R LLRVD+NVP   G+V D TRIERV PT+  LV+  AKV++
Sbjct: 6   MKSIRTLPWVQNSSVRGCRVLLRVDFNVPVEHGQVRDRTRIERVAPTVDYLVKAGAKVIM 65

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP S  D D SL  +V     +L   + FV DC G  +   + +L  G ++L EN
Sbjct: 66  VSHFGRP-SCVDADFSLEPLVGTISEVLGVPVTFVGDCFGERVCTVVNALPWGSVVLLEN 124

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RF++ EE+NDP F + L+   D Y+NDAFS SHR HASI  ++  LP+  G  +Q EL 
Sbjct: 125 LRFHAGEEKNDPAFAKQLASMADLYVNDAFSCSHRMHASIDAITKFLPAAAGLNLQDELH 184

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +  SE   P+ A++GG+K S+KI +L NL +KVD LV+GGG++NSFL A G  +G S
Sbjct: 185 YLGNIVSE--HPVAAVIGGAKTSSKIPMLRNLAQKVDFLVLGGGLSNSFLRASGHKIGSS 242

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + +    D VH +   A++S C +IVPRD VVAR +     T+    + V  +  I D+G
Sbjct: 243 VYE-PCDDAVHAVLESARKSNCCVIVPRDHVVARNLDCSAQTK--QNKDVGEEDCIFDIG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T   + +V+ + +TV WNGP+GVFE   F   T ++   +  L KE+ + +I GGGD+
Sbjct: 300 TQTSAEVAEVLGKCKTVFWNGPMGVFERAAFATGTSDLIRNLVCLKKEKGVSTIVGGGDS 359

Query: 359 ITALAHAGISNE-FTYVSTAGGAFLEWL 385
           I A+  +G S E F+YVST GGA L++L
Sbjct: 360 IFAIKASGYSAEDFSYVSTGGGALLQFL 387


>gi|299470729|emb|CBN79775.1| Phosphoglycerate kinase [Ectocarpus siliculosus]
          Length = 485

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/395 (41%), Positives = 238/395 (60%), Gaps = 6/395 (1%)

Query: 5   RTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ DL   D++G R L+R D NVP     + D TRI   +PT+  LV+K AKV++ SHL
Sbjct: 90  KSVGDLTSEDLKGKRVLVRCDLNVPLDGSTITDDTRIRASIPTVKFLVDKGAKVLLSSHL 149

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +   SL  V      +L K +    DCIG  ++  +  +  GG++L ENVRFY
Sbjct: 150 GRPKDGPEDKFSLAPVSERLTKLLGKKVTMAPDCIGPEVASLVDDMKNGGVLLLENVRFY 209

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLE 181
            EE +ND DF + L+ N D ++NDAF  +HRAH S  G++ +L PS  G  +QKEL  L+
Sbjct: 210 KEETKNDSDFAKKLAANADLFVNDAFGTAHRAHGSTEGVTKYLSPSVAGFLLQKELDYLQ 269

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +E K+P  A+VGGSKVS+KI ++ +++ KVD LVIGGGM  +FL A+G+ VG SL +
Sbjct: 270 GAVAEPKRPFAAVVGGSKVSSKIGVIDSMLNKVDMLVIGGGMVFTFLKARGLSVGSSLVE 329

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   ++   A     EII+P DVV+A        TQV S  ++P   + LD G  +
Sbjct: 330 DDKLDLARELEKTAASKGVEIILPTDVVLADAFSADANTQVASVDAIPDGWMGLDNGPDS 389

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
              I+  +A  +TV+WNGP+GVFE E F  A   V   +      +  ++I GGG ++ A
Sbjct: 390 TSLIQGKLADCKTVIWNGPMGVFEYEAF--AKFGVGENLGA-APGKGWLTIIGGGKSVGA 446

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 447 VEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 481


>gi|257791526|ref|YP_003182132.1| Phosphoglycerate kinase [Eggerthella lenta DSM 2243]
 gi|257475423|gb|ACV55743.1| Phosphoglycerate kinase [Eggerthella lenta DSM 2243]
          Length = 394

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 243/397 (61%), Gaps = 5/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+ ++T+++L D RG R L+RVD+NVP  DG V D TRI   +PTI +LV+  A+V++ S
Sbjct: 1   MAEIKTIDEL-DARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMS 59

Query: 61  HLGRPQSKS-DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLGRP  +  ++  +L         ++ K ++F  D +G       ASL +G +++ EN+
Sbjct: 60  HLGRPAGEGFEESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENL 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF   E++NDP F   L+  G+ Y+NDAF  +HRAHAS  G++ LLP+Y G  MQ+E++ 
Sbjct: 120 RFDKREKKNDPAFCEELAALGEAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVAT 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E ++P  AI+GGSKVS KI ++  L+ K D L+IGGGM  +FL+AQG  VG SL
Sbjct: 180 LSGMLEEPRRPFTAILGGSKVSDKIKVIDALMDKCDTLIIGGGMCFTFLLAQGKAVGTSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D+ +    +  +A+    ++++P DVV A        T  VS   +P D + LD+G 
Sbjct: 240 KEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAETLTVSVDGIPGDMMGLDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T +     +AQA+TV WNGP+GVFE++ F+  T  VA  VA       II   GGGD++
Sbjct: 300 ETAKLYADAVAQAKTVFWNGPMGVFEMKAFEAGTKAVAEAVAANADADTII---GGGDSV 356

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+    ++ + T++ST GGA +E ++G+ LPG+ AL
Sbjct: 357 AAVNKFDLAEQMTFISTGGGASMELVQGEALPGVEAL 393


>gi|222475660|ref|YP_002564077.1| phosphoglycerate kinase (pgk) [Anaplasma marginale str. Florida]
 gi|222419798|gb|ACM49821.1| phosphoglycerate kinase (pgk) [Anaplasma marginale str. Florida]
          Length = 398

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/388 (43%), Positives = 241/388 (62%), Gaps = 9/388 (2%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M  +RT+  +++  +RG R LLRVD+NVP   G+V D TRIERV PT+  LV+  AKV++
Sbjct: 14  MKSIRTLPWVQNSSVRGCRVLLRVDFNVPVEHGQVRDRTRIERVAPTVDYLVKAGAKVIM 73

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP S  D D SL  +V     +L   + FV DC G  +   + +L  G ++L EN
Sbjct: 74  VSHFGRP-SCVDADFSLEPLVGTISEVLGVPVTFVGDCFGERVCTVVNALPWGSVVLLEN 132

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RF++ EE+NDP F + L+   D Y+NDAFS SHR HASI  ++  LP+  G  +Q EL 
Sbjct: 133 LRFHAGEEKNDPAFAKQLASMADLYVNDAFSCSHRMHASIDAITKFLPAAAGLNLQDELH 192

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +  SE   P+ A++GG+K S+KI +L NL +KVD LV+GGG++NSFL A G  +G S
Sbjct: 193 YLGNIVSE--HPVAAVIGGAKTSSKIPMLRNLAQKVDFLVLGGGLSNSFLRASGHKIGSS 250

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + +    D VH +   A++S C +IVPRD VVAR +     T+    + V  +  I D+G
Sbjct: 251 VYE-PCDDAVHAVLESARKSNCCVIVPRDHVVARNLDCSAQTK--QNKDVGEEDCIFDIG 307

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T   + +V+ + +TV WNGP+GVFE   F   T ++   +  L KE+ + +I GGGD+
Sbjct: 308 TQTSAEVAEVLGKCKTVFWNGPMGVFERAAFATGTSDLIRNLVCLKKEKGVSTIVGGGDS 367

Query: 359 ITALAHAGISNE-FTYVSTAGGAFLEWL 385
           I A+  +G S E F+YVST GGA L++L
Sbjct: 368 IFAIKASGYSAEDFSYVSTGGGALLQFL 395


>gi|197118718|ref|YP_002139145.1| phosphoglycerate kinase [Geobacter bemidjiensis Bem]
 gi|229620366|sp|B5EF40|PGK_GEOBB RecName: Full=Phosphoglycerate kinase
 gi|197088078|gb|ACH39349.1| phosphoglycerate kinase [Geobacter bemidjiensis Bem]
          Length = 399

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 159/400 (39%), Positives = 240/400 (60%), Gaps = 8/400 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +R ++++ ++ G +  +RVD+NVP  D + + + TRI  V+P+I   +++KAK+++ SHL
Sbjct: 3   IRYIDEIENLSGKKLFMRVDFNVPLDDHQNITEDTRIRAVLPSINYALDQKAKIILASHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +  +  S+         +L K +   +DCIG  +   I ++  G +I+ ENVRFY
Sbjct: 63  GRPKGERKEKYSMAPAAKRLSRLLGKEVKLASDCIGDEVKAMINAMQPGDVIMLENVRFY 122

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLE 181
           + EE+ND DF + L+ + D Y+NDAF+VSHRAHAS+  +++  P    G  M+ E++  E
Sbjct: 123 AGEEKNDADFAKALANDCDVYVNDAFAVSHRAHASVEAITNCFPVVAAGFLMKNEMNYFE 182

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  +PLVAI+GG+KVS KI +L NL  KVDK++IGGGMA +FL   G  VG+SL +
Sbjct: 183 KAMKNPIRPLVAILGGAKVSGKIEVLENLCDKVDKIIIGGGMAFTFLKGMGYNVGKSLVE 242

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +  D   +   +A+    +  +P D VVA +      T+V   Q +P   + LDVG  T
Sbjct: 243 DNLIDTAMKTYEKARAQGVKFYLPVDCVVADQFNPAAETKVCPIQEIPEGWMALDVGPAT 302

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V    + +  A+T++WNGP+GVFE++ F R T  +   VA        ++I GGGDT  A
Sbjct: 303 VTLFTEALQNAKTIVWNGPMGVFEMDAFSRGTFAMVSAVAN----SYALTIVGGGDTDVA 358

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS--GH 399
           +  AG   + +Y+ST GGAFLE LEGK LPGI  L   GH
Sbjct: 359 VHRAGEYAKISYISTGGGAFLELLEGKKLPGIKVLEDKGH 398


>gi|89098796|ref|ZP_01171677.1| phosphoglycerate kinase [Bacillus sp. NRRL B-14911]
 gi|89086472|gb|EAR65592.1| phosphoglycerate kinase [Bacillus sp. NRRL B-14911]
          Length = 394

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 241/393 (61%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +++ D+ D++G R   RVD+NVP  DG + D TRI   +PTI  L E+ AKV++ SHLGR
Sbjct: 4   KSVKDI-DLKGKRVFCRVDFNVPMKDGSITDETRITAALPTIQYLTEQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ ++ ++  L  V      +L K++   ++  G  +   ++ ++EG ++L ENVRFY  
Sbjct: 63  PKGQAVEELRLTPVAKRLSELLGKDVKKADEAYGEAVQGLVSEMAEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELDVLGKAM 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S  ++P  AIVGG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL + D 
Sbjct: 183 SNPERPFTAIVGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKAQGHEIGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D       +A+    +  +P DV+VA +       + VS + +P D   LD+G KT   
Sbjct: 243 IDLADSFMKKAEEKGVKFYMPVDVLVADDFSEDANIKEVSIEEIPSDWEALDIGPKTRAI 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI  ++ V+WNGP+GVFE+  F   T  VA  +A   + +   S+ GGGD+  A+  
Sbjct: 303 YQDVIKSSKLVIWNGPMGVFELNAFAGGTKAVAEALA---ESQDTYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             ++++ +++ST GGA LE++EGK+LPG+ AL+
Sbjct: 360 FDLADKMSHISTGGGASLEFIEGKELPGVTALN 392


>gi|224109060|ref|XP_002315066.1| predicted protein [Populus trichocarpa]
 gi|222864106|gb|EEF01237.1| predicted protein [Populus trichocarpa]
          Length = 481

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 159/396 (40%), Positives = 250/396 (63%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV++ SH
Sbjct: 80  KSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNGAKVILSSH 139

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++  +DCIG  + + +ASL +GG++L ENVRF
Sbjct: 140 LGRPKGVTPK-FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF 198

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 199 YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVSGFLLQKELDYL 258

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 259 VGAVSTPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLPVGSSLV 318

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D       +  +AK     +++P DV++A +      +++V A ++P   + LD+G +
Sbjct: 319 EEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSKIVPASAIPDGWMGLDIGPE 378

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGGD++ 
Sbjct: 379 SVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGGDSVA 437

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK+LPG++AL
Sbjct: 438 AVEKVGVADVMSHISTGGGASLELLEGKELPGVLAL 473


>gi|317490659|ref|ZP_07949127.1| phosphoglycerate kinase [Eggerthella sp. 1_3_56FAA]
 gi|325831453|ref|ZP_08164707.1| phosphoglycerate kinase [Eggerthella sp. HGA1]
 gi|316910241|gb|EFV31882.1| phosphoglycerate kinase [Eggerthella sp. 1_3_56FAA]
 gi|325486707|gb|EGC89155.1| phosphoglycerate kinase [Eggerthella sp. HGA1]
          Length = 394

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 160/397 (40%), Positives = 243/397 (61%), Gaps = 5/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+ ++T+++L D RG R L+RVD+NVP  DG V D TRI   +PTI +LV + A+V++ S
Sbjct: 1   MAEIKTIDEL-DARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVTQGARVILMS 59

Query: 61  HLGRPQSKS-DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLGRP  +  ++  +L         ++ K ++F  D +G       ASL +G +++ EN+
Sbjct: 60  HLGRPAGEGFEESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENL 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF   E++NDP F   L+  G+ Y+NDAF  +HRAHAS  G++ LLP+Y G  MQ+E++ 
Sbjct: 120 RFDKREKKNDPAFCEELAALGEAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVAT 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E ++P  AI+GGSKVS KI ++  L+ K D L+IGGGM  +FL+AQG  VG SL
Sbjct: 180 LSGMLEEPRRPFAAILGGSKVSDKIKVIDALMDKCDTLIIGGGMCFTFLLAQGKAVGTSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D+ +    +  +A+    ++++P DVV A        T  VS   +P D + LD+G 
Sbjct: 240 KEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAETLTVSVDGIPGDMMGLDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T +     +AQA+TV WNGP+GVFE++ F+  T  VA  VA       II   GGGD++
Sbjct: 300 ETAKLYADAVAQAKTVFWNGPMGVFEMKAFEAGTKAVAEAVAANADADTII---GGGDSV 356

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+    ++ + T++ST GGA +E ++G+ LPG+ AL
Sbjct: 357 AAVNKFDLAEQMTFISTGGGASMELVQGEALPGVEAL 393


>gi|225849789|ref|YP_002730023.1| phosphoglycerate kinase [Persephonella marina EX-H1]
 gi|225646502|gb|ACO04688.1| phosphoglycerate kinase [Persephonella marina EX-H1]
          Length = 398

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 156/394 (39%), Positives = 244/394 (61%), Gaps = 7/394 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D+ D+ G R  +RVD+NVP  + G + D TRI   +PTI  L++K AKV++ SHLGR
Sbjct: 7   TLEDV-DVTGKRVFVRVDYNVPLDEHGHIVDDTRIRETIPTINYLLDKNAKVILASHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ + +   SLF V    E +L+K + F  DC+G  + + + ++ +G ++L EN+RF+  
Sbjct: 66  PKGERNPKYSLFPVARRLERLLNKEVKFAPDCVGKEVEELVFNMKDGDVVLLENLRFHPG 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESC 183
           EE NDP+F + L++  + Y+ DAF   HR HAS+ G+   + P  +G  +++EL   E  
Sbjct: 126 EEGNDPEFAKSLAKLAEIYVIDAFGTCHRKHASMYGIKDFVQPVVMGFLLERELKYFEKA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA +GGSKVS+K+ ++ +L+ K DK+ IGG MA +F+ A G  VG SL + D
Sbjct: 186 LVNPQRPVVAFIGGSKVSSKLGVIKHLLDKADKIFIGGAMAFTFIKAMGYEVGSSLVEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    +  EAK+   +  +P D V  + +    P   V+ Q +P   + LD+G  ++ 
Sbjct: 246 MFDEALYVIDEAKKRGVKFYLPVDFVCGQAISEQTPVIEVAWQEIPKGWMGLDIGHASIT 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            IK+++  A+T++WNGP+GVFEI+ F   T  +AH +A    E   +SIAGGGDT  A+ 
Sbjct: 306 LIKEILKDAQTIIWNGPMGVFEIDKFKGGTFGLAHAIA----ESPALSIAGGGDTDYAIH 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG+ +E +Y+ST GGAFL+ LEGK LP + A++
Sbjct: 362 KAGVIDEISYISTGGGAFLKLLEGKVLPCLEAIT 395


>gi|86131110|ref|ZP_01049709.1| phosphoglycerate kinase [Dokdonia donghaensis MED134]
 gi|85818521|gb|EAQ39681.1| phosphoglycerate kinase [Dokdonia donghaensis MED134]
          Length = 395

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 246/394 (62%), Gaps = 6/394 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T++D  +    + L+RVD+NVP  + G + D TRIE   PTIL+++E     ++ SHLGR
Sbjct: 3   TVDDF-NFENKKALIRVDFNVPLDEEGNITDTTRIEAAKPTILKILEDGGSAILMSHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+++ +++ SL ++ S    I+   + FV++C+G  ++Q+   L  G I+L EN+R++SE
Sbjct: 62  PKNE-EEEFSLSQICSTVSEIIGVEVNFVDNCVGDKVTQAAQDLEMGKILLLENLRYHSE 120

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSMLES 182
           E   D +F + LS  GD Y+NDAF  +HRAHAS T ++   P     G  + KE+  L+ 
Sbjct: 121 ETAGDEEFAKQLSTLGDVYVNDAFGTAHRAHASTTVVAQFFPDAKCYGYLLAKEIESLDR 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             + S+KP++AI+GGSKVS+KIT++ N++ KVD+++IGGGMA +F+ AQG  +G S+C+ 
Sbjct: 181 VLNNSEKPVLAILGGSKVSSKITVIENILDKVDEMIIGGGMAFTFIKAQGGQIGNSICED 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  D    I  +AK    +I +P DV+ A +      T+V    ++      LD G  + 
Sbjct: 241 DKMDLALDILKQAKEKGVQIHIPVDVIAADDFANDANTKVSDITAIEDGWQGLDAGPASR 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E    V+ +A+T++WNGPLGVFE+E F   T+ + H +A+ T +    S+ GGGD++ A+
Sbjct: 301 ENFDAVVKRAKTILWNGPLGVFEMETFAGGTIALGHSIAEST-QNGAFSLVGGGDSVAAV 359

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              G  ++ +YVST GGA LE LEGK LPGI A+
Sbjct: 360 KQFGFDSKVSYVSTGGGAMLEMLEGKTLPGIAAI 393


>gi|82623391|gb|ABB87110.1| unknown [Solanum tuberosum]
          Length = 401

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 238/387 (61%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G R  +RVD NVP  D   + D TRI   VPTI  L++  A+V++ SHLGRP+  + 
Sbjct: 14  DLKGKRVFVRVDLNVPLDDIFNITDDTRIRAAVPTIKYLMQNGARVILASHLGRPKGVTP 73

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K  SL  +V     +L   +   ND IG  +   +A L EGG++L ENVRFY EEE+NDP
Sbjct: 74  K-YSLKPLVPRLSELLAIEVKMANDSIGPEVENLVAELPEGGVVLLENVRFYKEEEKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++ +L P+  G  MQKEL  L    S  +K
Sbjct: 133 EFAKKLASLADLYVNDAFGTAHRAHASTEGVAKVLKPAVAGFLMQKELDYLVGAVSNPQK 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG  VG SL + D  D   
Sbjct: 193 PFAAIVGGSKVSSKIGVIESLLEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLAT 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVV+A +      +++V A  +P   + LD+G   ++     +
Sbjct: 253 SLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              + ++WNGP+GVFE + F   T  +A  +A+L+  + + +I GGGD++ A+   G++ 
Sbjct: 313 DTTKNIIWNGPMGVFEFDKFAAGTEAIAKKLAELSG-KGVTTIIGGGDSVAAVEKVGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG++AL
Sbjct: 372 KMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|299821967|ref|ZP_07053855.1| phosphoglycerate kinase [Listeria grayi DSM 20601]
 gi|299817632|gb|EFI84868.1| phosphoglycerate kinase [Listeria grayi DSM 20601]
          Length = 396

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 247/398 (62%), Gaps = 12/398 (3%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           + + DL D++G + L+RVD+NVP  DGK+ +  RI   +PTI  ++E+  K ++FSHLG+
Sbjct: 4   KVVTDL-DLKGKKVLVRVDFNVPMKDGKITNDNRIVAALPTIKYILEQGGKAILFSHLGK 62

Query: 65  PQSKSDK-DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
            +++ DK D +L  V      +L K + FV    G  L ++I  L +G ++L EN RF  
Sbjct: 63  VKTEEDKADKTLRPVAERLSELLEKEVEFVPVTRGPELEKAIDELKDGEVLLFENTRFED 122

Query: 124 ----EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
               +E +NDP+  +  +  GD ++NDAF  +HR+HAS  G++  L S  G  M KE+  
Sbjct: 123 IDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRSHASNVGIASNLESAAGFLMDKEIKF 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +     E  +P VAI+GG+KVS KI ++ NL+KK DK++IGGGMA +F+VAQG  VG SL
Sbjct: 183 IGGAVDEPVRPFVAILGGAKVSDKIGVIENLLKKADKILIGGGMAYTFMVAQGKEVGISL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D  D   +I     ++  ++I+P D VVA+E    +P   VS+  +P D   LD+G 
Sbjct: 243 LEKDKVDLAKEI---LDKAGDKLILPVDTVVAKEFSNDVPFHTVSSDEIPADEEGLDIGE 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT+E   + +  A+TV+WNGP+GVFE+  F + T+ V   +A L   +   +I GGGD+ 
Sbjct: 300 KTIELFSKELQGAKTVIWNGPMGVFEMSNFAKGTIGVCEAIANL---KDATTIIGGGDSA 356

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A    G +++FT++ST GGA LE+LEGK+LPG+ ++S
Sbjct: 357 AAAMQLGYADKFTHISTGGGASLEYLEGKELPGVASIS 394


>gi|319789187|ref|YP_004150820.1| Phosphoglycerate kinase [Thermovibrio ammonificans HB-1]
 gi|317113689|gb|ADU96179.1| Phosphoglycerate kinase [Thermovibrio ammonificans HB-1]
          Length = 406

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 161/402 (40%), Positives = 242/402 (60%), Gaps = 10/402 (2%)

Query: 2   SRLRTMNDLRDI-----RGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKV 56
           S++     LRD+     +G +  +RVD+NVP  DG + +  RI   +PTI  L++  AKV
Sbjct: 4   SKMFNKMTLRDVPPEKLKGRKVFVRVDFNVPIEDGVITNDKRIRAALPTINYLLDHGAKV 63

Query: 57  VIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILA 116
           V+ SHL RP+   D   SL  V      +L K + FV DCIG    +++ SL  G + L 
Sbjct: 64  VLCSHLDRPKG-WDPKLSLKPVAERLSRLLEKEVKFVPDCIGEVAKEAVDSLEPGEVALL 122

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQK 175
           ENVRFY  E +NDP+F R L+   + Y+NDAF  +HR HAS  G++  +  +  G  ++K
Sbjct: 123 ENVRFYPGETKNDPEFARQLAELAEIYVNDAFGTAHRKHASTYGITQFVELAVAGFLLEK 182

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  L+      ++PLV I+GGSKVS K+ ++ NL+ KVDK+++GGGMA +FL A G  V
Sbjct: 183 EIKYLQKALENPERPLVLIIGGSKVSGKLEVIENLLTKVDKMLVGGGMAYTFLKAMGYQV 242

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G+SL + D      +I  EA +   +  VP D   A +      T++ + + +P D + L
Sbjct: 243 GKSLVEDDLIPTAKRIMEEADQRGVKFYVPVDSNNADQFSETAHTKLTTYKEIPEDMMGL 302

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G  TVE  K+ ++ A+T++WNGP+GVFE+E F   T+ +   VA+  +  RI+   GG
Sbjct: 303 DIGPATVELFKEALSDAKTILWNGPMGVFEMEKFRFGTMAIGKIVAEHKEALRIV---GG 359

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           GD++ A+   G+ +E  +VST GGAFL++L GK+LP IVAL+
Sbjct: 360 GDSVAAIEMLGLEHEIDHVSTGGGAFLQFLAGKELPAIVALT 401


>gi|254455555|ref|ZP_05068984.1| phosphoglycerate kinase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082557|gb|EDZ59983.1| phosphoglycerate kinase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 392

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 153/393 (38%), Positives = 251/393 (63%), Gaps = 2/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++++ +  ++   + LLR+D NVP +D K+ D TRI++++PT+  L+++  K++I SH+G
Sbjct: 1   MKSIKEEVNLENKKILLRLDLNVPIVDNKIMDTTRIDKILPTLRFLIDQNTKIIIISHVG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  +        ++N+  ++  +    S+ + + ++  I++ EN+RFYS
Sbjct: 61  RPKGKIVNELSLKLICEELSKKSNQNVKLISKNVKEINSKELFNNNDERIMMLENIRFYS 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAFS SHR+HASI  +++ LPSY G    +E++ L+  
Sbjct: 121 EEEKNDEQFAKHLATLADIYVNDAFSCSHRSHASIDEITNFLPSYSGLQFDQEVNALKKI 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
            SE KKP+  I+GGSKVSTKI ++ NL+ K D ++I GGMAN+ +   G  +G+SL +  
Sbjct: 181 TSEIKKPITCIIGGSKVSTKINIIKNLIPKFDNIIIVGGMANNIIKFMGNNIGKSLHEEG 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
               + +I   ++++ C+II P+DV+V + +  G P Q+     +  D +ILD+G KT++
Sbjct: 241 SDKIIEEILLLSEKTNCKIIYPKDVLVGKNL-DGNP-QIKELNEILSDDMILDIGPKTIK 298

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            I  +I +++T++WNGP G FE   F   ++++A  + +  K   I S+AGGGDT++ + 
Sbjct: 299 IINNIIDESKTILWNGPAGYFENPKFANGSIKIAKKMIENNKSNNIYSVAGGGDTVSLIN 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
                N F +VSTAGGAFLE+LEGK LPGI AL
Sbjct: 359 SLNAINNFNFVSTAGGAFLEYLEGKKLPGIKAL 391


>gi|218295500|ref|ZP_03496313.1| Phosphoglycerate kinase [Thermus aquaticus Y51MC23]
 gi|218244132|gb|EED10658.1| Phosphoglycerate kinase [Thermus aquaticus Y51MC23]
          Length = 390

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 239/398 (60%), Gaps = 11/398 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ DL D RG R L+RVD+NVP   G V D TRI   +PT+  L+E    +V+ SHLG
Sbjct: 1   MRTLKDL-DPRGKRVLVRVDYNVPIQGGVVQDETRILESLPTLRHLLEGGGSLVLLSHLG 59

Query: 64  RPQSKSDKDCSLFKVVSIAESILH--KNILFVNDCIGSTLS-QSIASLSEGGIILAENVR 120
           RP+    K    + +  +AE++        FV    GS  + +++  L+ G + L ENVR
Sbjct: 60  RPKGPDPK----YSLAPVAEALARHIPKARFVPHSPGSDEALEAVKGLAPGEVALLENVR 115

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+NDP+  R  +R G+ ++ DAF  +HRAHAS+ G++ LLP+Y G  M+KE+  L
Sbjct: 116 FEPGEEKNDPELSRRYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVKAL 175

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                + +KP   ++GG+KVS KI +L +L+ KVD+L+IGG MA +F+ A G  VG+SL 
Sbjct: 176 SRLLHDPEKPYAVVIGGAKVSDKIGVLESLLPKVDRLLIGGAMAFTFIKALGGEVGKSLV 235

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    +   A+    ++ +P DVV A +++ G+PTQV  A ++P   + LD+G +
Sbjct: 236 EEDRLDLARDLLARAEALGVKVYLPADVVAAEKIEPGVPTQVFPADAIPTPYVGLDIGPR 295

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E  ++ +   RT  WNGP+GVFE+ PFD  T+ V   +A L       ++ GGGD++ 
Sbjct: 296 TRELFREALRGVRTAFWNGPMGVFEVPPFDEGTLAVGRALADLEG---AFTVVGGGDSVA 352

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           A+   G+ + F +VST GGA LE+LE   LPGI  L G
Sbjct: 353 AVNRLGLKDRFGHVSTGGGASLEYLEKGTLPGIEVLEG 390


>gi|301122065|ref|XP_002908759.1| phosphoglycerate kinase [Phytophthora infestans T30-4]
 gi|262099521|gb|EEY57573.1| phosphoglycerate kinase [Phytophthora infestans T30-4]
          Length = 428

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 159/399 (39%), Positives = 246/399 (61%), Gaps = 6/399 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPF----IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           L  +   + ++G R L+R D NVPF        + D TRI  V+PT+  L    A+ V+ 
Sbjct: 29  LEQLAQRQSLKGARVLVRADLNVPFKKNVTPATITDDTRIRAVLPTLKLLQGAGARTVLC 88

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP  ++  +  L  V +    +L   +  ++DCIG  +  SI  L +G I+L ENV
Sbjct: 89  SHLGRPGGEAKDELRLTPVAARLGELLSSPVKKLDDCIGPQVDASIDQLQDGEIVLLENV 148

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELS 178
           RFY +E +NDP+F + L+ + D Y+NDAF  +HRAHAS  G+++ + + + G  ++KEL 
Sbjct: 149 RFYKQETKNDPEFAKQLAHDADIYVNDAFGTAHRAHASTEGVTNFIKTNVAGFLVEKELK 208

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L        +PL AI+GG+KVSTKI +L +L++K DK++IGGGM  +F  AQG+ VG+S
Sbjct: 209 YLSGAVDAPVRPLGAIIGGAKVSTKIPVLKSLLQKCDKIMIGGGMIFTFYKAQGLDVGKS 268

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + + D      +I  EAK+   +I++P DVVVA + +    ++VV A ++P D + LD+G
Sbjct: 269 IIEEDKVALAKEILEEAKQRDVQIVLPTDVVVADKFEADAQSKVVPANAIPADWLGLDIG 328

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             ++    + + + +TV+WNGP+GVFE   F + T  VA  +A+ T E  + +I GGGD+
Sbjct: 329 PNSMATFAKELKECKTVVWNGPMGVFEFPEFAKGTFGVAKALAEST-ESGVTTIVGGGDS 387

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + A+  AG+  + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 388 VAAVEQAGLGAKMSHISTGGGASLELLEGKVLPGVAALN 426


>gi|154151082|ref|YP_001404700.1| phosphoglycerate kinase [Candidatus Methanoregula boonei 6A8]
 gi|153999634|gb|ABS56057.1| Phosphoglycerate kinase [Methanoregula boonei 6A8]
          Length = 395

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 161/394 (40%), Positives = 237/394 (60%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D  ++ G R L+R D+NVP   +G + D TRI   +PTI  L++ +A++++ SHLG
Sbjct: 4   KTVED-EEVYGKRVLVRADFNVPMDRNGTIEDDTRIRACLPTITYLIDHRARIILCSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RPQ + D    L  V      +L + +  + + IG  + ++++ +  G IIL EN+RFY 
Sbjct: 63  RPQGRVDGHLRLEPVARRLSELLQRPVKPLREAIGPEVERAVSGMENGEIILLENLRFYP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            +E NDP F R L+   D ++NDAF  SHRAHAS+ GL+  LP   G  M+KE+  L S 
Sbjct: 123 GDEENDPGFARELASLADLFVNDAFGASHRAHASVVGLAAYLPCVAGLLMEKEIERLGSL 182

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P  AI+GG+KV  KI +L N++ KVD ++IGGGM+ +FL  QG   G S  + D
Sbjct: 183 LENPRRPFAAIMGGAKVEEKIGILENIISKVDLILIGGGMSATFLKGQGWDAGISPVEPD 242

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             + V  I  +A      I++P+DV+V  ++KTG   + VSAQ +P DSII D+G +T+ 
Sbjct: 243 KMEIVRAIMQKAGALGVRILLPQDVIVTEKLKTGAIARGVSAQQIPADSIIADIGPQTIT 302

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +   RTV+WNGP+GVFEI  F   T  +A  +A L      ++I GGG T  A+ 
Sbjct: 303 EFTKELKNCRTVVWNGPMGVFEIPQFSEGTKSIATALADL----HAMTIVGGGSTAEAVT 358

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G+S + T+VST GGA L +L GK LPGI  L+
Sbjct: 359 KLGLSGKMTHVSTGGGATLLFLSGKILPGIAVLA 392


>gi|148240687|ref|YP_001226074.1| phosphoglycerate kinase [Synechococcus sp. WH 7803]
 gi|166987816|sp|A5GPB2|PGK_SYNPW RecName: Full=Phosphoglycerate kinase
 gi|147849226|emb|CAK24777.1| Phosphoglycerate kinase [Synechococcus sp. WH 7803]
          Length = 402

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 157/388 (40%), Positives = 241/388 (62%), Gaps = 3/388 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K +   + CIG      + ++++G ++L ENVRF++EEE+N+ 
Sbjct: 73  DAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMADGDVVLLENVRFFAEEEKNEA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   + Y+NDAF  +HRAHAS  G++  L P+  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        +QV    ++P   + LD+G   V+  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDANSQVADVTAIPDGWMGLDIGPDAVKVFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE E F   T  +A  +A+L+  +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCQTVIWNGPMGVFEFEKFATGTNAIATTLAELSA-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAALN 399


>gi|224005154|ref|XP_002296228.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|209586260|gb|ACI64945.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 441

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 243/396 (61%), Gaps = 3/396 (0%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ DL   D++G + L+R D NVP    K+ D TRI   +PTI  L  K A V + SHL
Sbjct: 44  KSIEDLSEADLKGKKVLVRCDVNVPLDGKKITDDTRIRSSIPTIEYLKGKGAIVTVCSHL 103

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +   SL         +L + +    DCIG  +S  + +  EG +I+ EN RFY
Sbjct: 104 GRPKDGPEDKFSLGPCAERMGELLGQEVKLAPDCIGEEVSTLVNAAKEGDVIMLENTRFY 163

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLE 181
            EEE+N+  FV  L+   D ++NDAF  +HRAHAS  G++  L PS  G  + KEL  L+
Sbjct: 164 KEEEKNEAGFVEKLAAPFDLFVNDAFGTAHRAHASTEGVTKFLQPSVSGFLLAKELEYLD 223

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 KKP+ AIVGGSKVS+KIT+L  L+ K DK++IGGGM  +FL A+G+ VG SL +
Sbjct: 224 GAIENGKKPMAAIVGGSKVSSKITVLNALLDKCDKIIIGGGMVFTFLKAKGLNVGTSLVE 283

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D+ +   ++  +A++   EI++P D+V+A +      T+VVS+ ++P   + LD G  +
Sbjct: 284 DDYVETAKEVLAKAEKLGKEILLPSDIVIADKFAADAETKVVSSDAIPDGWMGLDNGPAS 343

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
               K+ ++  +TV+ NGP+GVFE++ F++ T  +   +A L+KE+  I+I GGGD++ A
Sbjct: 344 TAEQKEFLSDCQTVIMNGPMGVFEMKAFEKGTFGLVDILADLSKEKGAITIIGGGDSVAA 403

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              +G + + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 404 TELSGRAGDMSHISTGGGASLELLEGKVLPGVAALN 439


>gi|78185710|ref|YP_378144.1| phosphoglycerate kinase [Synechococcus sp. CC9902]
 gi|123580989|sp|Q3AVX6|PGK_SYNS9 RecName: Full=Phosphoglycerate kinase
 gi|78170004|gb|ABB27101.1| phosphoglycerate kinase [Synechococcus sp. CC9902]
          Length = 401

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 238/387 (61%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +LV K AKVV+ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVVLAAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L K +   + CIG      + +++ G ++L ENVRF +EEE+ND 
Sbjct: 73  EAMRLTPVAARLSELLGKTVTKTDSCIGPDAEAKVGAMANGDVVLLENVRFVAEEEKNDS 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   D Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAALADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        +Q+    ++P   + LD+G   ++  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDANSQIADVTAIPDGWMGLDIGPDAIKVFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A++   +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAEIGG-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|269958314|ref|YP_003328101.1| phosphoglycerate kinase [Anaplasma centrale str. Israel]
 gi|269848143|gb|ACZ48787.1| phosphoglycerate kinase [Anaplasma centrale str. Israel]
          Length = 450

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 167/388 (43%), Positives = 240/388 (61%), Gaps = 9/388 (2%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M  +RT+  +++  +RG R LLRVD+NVP   G+V D TRIERV PT+  LV+  AKV++
Sbjct: 66  MESIRTLPWVQNSSVRGCRVLLRVDFNVPVEHGQVRDRTRIERVAPTVDYLVKAGAKVIM 125

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP S  D D SL  +V     +L   + FV DC G  +   + +L  G ++L EN
Sbjct: 126 VSHFGRP-SCVDADFSLEPLVGTISEVLGVPVTFVGDCFGERVCTVVNALPWGSVVLLEN 184

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RF++ EE+NDP F + L+   D Y+NDAFS SHR HASI  ++  LP+  G  +Q EL 
Sbjct: 185 LRFHAGEEKNDPAFAKQLASMADLYVNDAFSCSHRMHASIDAITKFLPAAAGLNLQDELH 244

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +  SE   P+ A++GG+K S+KI +L NL +KVD LV+GGG++NSFL A G  +G S
Sbjct: 245 YLGNIVSE--HPVAAVIGGAKTSSKIPMLRNLAQKVDFLVLGGGLSNSFLRASGHKIGSS 302

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           +      D VH +   A++S C +IVPRD VVAR +     T+    + V  +  I D+G
Sbjct: 303 V-YEPCDDAVHAVLESARKSNCGVIVPRDHVVARNLDCSAQTK--QNKDVGEEDCIFDIG 359

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T   + +V+ + +TV WNGP+GVFE   F   T ++   +  L KE+ + +I GGGD+
Sbjct: 360 TQTSAEVAEVLGKCKTVFWNGPMGVFERAAFATGTSDLIRNLVCLKKEKGVSTIVGGGDS 419

Query: 359 ITALAHAGISNE-FTYVSTAGGAFLEWL 385
           I A+  +G S E F+Y+ST GGA L++L
Sbjct: 420 IFAIKASGYSAEDFSYISTGGGALLQFL 447


>gi|256545224|ref|ZP_05472589.1| phosphoglycerate kinase [Anaerococcus vaginalis ATCC 51170]
 gi|256399051|gb|EEU12663.1| phosphoglycerate kinase [Anaerococcus vaginalis ATCC 51170]
          Length = 398

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 161/394 (40%), Positives = 250/394 (63%), Gaps = 10/394 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI-DGK--VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ DL ++ G + L+RVD+NVP   DG   ++D TRI+  +PTI  L+E  AKV++ SH
Sbjct: 4   KTVKDL-NVEGKKVLVRVDFNVPLSKDGNHTISDDTRIKAALPTIDYLLENNAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFV--NDCIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ +++ + SL  V S  E+   +   F+  +  +   + + +  L  G + L EN 
Sbjct: 63  LGRPKGEANPEFSLKPVASWLENHYGEKFHFLPSDVVVDEKVKEEVEKLENGNLALLENT 122

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+   E +NDP+F + LS   D ++NDAF  SHRAHAS  G+++ L S +G  +QKE+ +
Sbjct: 123 RYVKGETKNDPEFAKELSSLADLFVNDAFGTSHRAHASNVGVANNLESAVGFLIQKEIEI 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G+SL
Sbjct: 183 MGKALENPERPFVSILGGAKVSDKIGVIENLISKVDYILIGGGMAYTFLKAQGKEIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+ +  +I++P+DVV+A E+K    T++V   ++P D   LD+G 
Sbjct: 243 LEEDKMDLSLELIKKAEANNVKILLPKDVVIADEIKEDAETEIVDIDNIPTDKEALDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +    +I +A+TV+WNGP+GVFE++ F   T EVA  +A    +    +I GGGD+ 
Sbjct: 303 KTAKEYADIIKKAKTVVWNGPMGVFEVKVFANGTNEVAKALA----DSSATTIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
            A+  AG  ++ T+VST GGA LE+LEGK LPGI
Sbjct: 359 LAIEEAGYKDKITHVSTGGGASLEFLEGKTLPGI 392


>gi|2499497|sp|Q42961|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|1161600|emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
          Length = 481

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 162/396 (40%), Positives = 247/396 (62%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   +++G +  +R D NVP  D + + D TRI   VPTI  L+   AKV++ SH
Sbjct: 79  KSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVILSSH 138

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++ V DCIG  + + +ASL EGG++L ENVRF
Sbjct: 139 LGRPKGVTPK-YSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLENVRF 197

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 198 YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 257

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 258 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 317

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 318 EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 377

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGGD++ 
Sbjct: 378 SVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSG-KGVTTIIGGGDSVA 436

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK LPG++AL
Sbjct: 437 AVEKVGVASVMSHISTGGGASLELLEGKVLPGVIAL 472


>gi|228993843|ref|ZP_04153747.1| Phosphoglycerate kinase [Bacillus pseudomycoides DSM 12442]
 gi|228765899|gb|EEM14549.1| Phosphoglycerate kinase [Bacillus pseudomycoides DSM 12442]
          Length = 394

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 153/386 (39%), Positives = 236/386 (61%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  DGKV D TRI   +PTI  LVE+ AKV++ SHLGRP+ +  +
Sbjct: 10  DLKGKRVFCRVDFNVPMKDGKVTDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRFY+ EE+ND +
Sbjct: 70  EMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRFYAGEEKNDAE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKEFAALADLFVNDAFGAAHRAHASTAGIADYLPAVSGFLMEKELEVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+ D  D   + 
Sbjct: 190 TAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCENDKIDLAKEF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK       +P DVV+  E      T+VV   ++P     +D+G KT E    VI  
Sbjct: 250 MELAKEKGVNFYMPVDVVITEEFSETATTKVVGIDAIPETWEGVDIGPKTSEIYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAAVEKFGMADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+V L+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVVCLN 392


>gi|228999869|ref|ZP_04159441.1| Phosphoglycerate kinase [Bacillus mycoides Rock3-17]
 gi|229007423|ref|ZP_04165020.1| Phosphoglycerate kinase [Bacillus mycoides Rock1-4]
 gi|228753811|gb|EEM03252.1| Phosphoglycerate kinase [Bacillus mycoides Rock1-4]
 gi|228759811|gb|EEM08785.1| Phosphoglycerate kinase [Bacillus mycoides Rock3-17]
          Length = 394

 Score =  306 bits (783), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 236/386 (61%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SHLGRP+ +  +
Sbjct: 10  DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +    +L K++   N+  G  + + +A+++EG +++ ENVRFY+ EE+ND +
Sbjct: 70  EMRLTPVAARLGELLGKDVKKANEAFGPAVQEMVAAMNEGDVLVLENVRFYAGEEKNDAE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKEFAALADLFVNDAFGAAHRAHASTAGIADYLPAVSGFLMEKELEVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+ D  D   + 
Sbjct: 190 TAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCENDKIDLAKEF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK       +P DVV+  E      T+VV   ++P     +D+G KT E    VI  
Sbjct: 250 MELAKEKGVNFYMPVDVVITEEFSETATTKVVGIDAIPETWEGVDIGPKTSEIYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAAVEKFGMADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+V L+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVVCLN 392


>gi|224014072|ref|XP_002296699.1| phosphoglycerate kinase precursor [Thalassiosira pseudonana
           CCMP1335]
 gi|220968554|gb|EED86900.1| phosphoglycerate kinase precursor [Thalassiosira pseudonana
           CCMP1335]
          Length = 406

 Score =  306 bits (783), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 241/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G + L+R D NVP +DGK + D TRI   +PTI  L +  A V + SHLGRP+   +
Sbjct: 14  DLKGKKVLVRCDLNVP-LDGKTITDDTRIRSSIPTIEYLTKAGAIVTVCSHLGRPKDGPE 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              SL    +    +L + +    DCIG  ++  +A   EG +++ EN RFY EE +NDP
Sbjct: 73  DKFSLAPCATRMGELLGQEVKLAPDCIGDEVATMVAEAKEGDVVMLENTRFYKEETKNDP 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
           +FV  L++  D Y+NDAF  +HRAHAS  G++ +L PS  G  + KEL  L       +K
Sbjct: 133 EFVEKLAKPFDMYVNDAFGSAHRAHASTEGVTKYLHPSVSGFLLAKELKYLAGAIDNGEK 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P+ AIVGGSKVS+KIT+L  L+ K DK++IGGGM  +FL A+ + VG SL + D+ +   
Sbjct: 193 PMAAIVGGSKVSSKITVLNALLDKCDKIIIGGGMVFTFLKAKDLSVGTSLVEDDYVETAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +A++   +I++P D+VVA +      T++V+   +P   + LD G  +    K+ +
Sbjct: 253 EVLAKAEKLGKKILLPCDIVVADKFAADAETKIVATDEIPDGWMGLDNGPASTAEQKEFL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           +  +TV+ NGPLGVFE++ F++ T+ +   +A LTKE+  I+I GGGD++ A   +G + 
Sbjct: 313 SDCKTVIMNGPLGVFEMKAFEKGTMGIIDILADLTKEKGAITIIGGGDSVAATEQSGRAK 372

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE +EGK LPG+ AL
Sbjct: 373 DMSHISTGGGASLELMEGKVLPGVAAL 399


>gi|125972662|ref|YP_001036572.1| phosphoglycerate kinase [Clostridium thermocellum ATCC 27405]
 gi|256004748|ref|ZP_05429724.1| Phosphoglycerate kinase [Clostridium thermocellum DSM 2360]
 gi|125712887|gb|ABN51379.1| phosphoglycerate kinase [Clostridium thermocellum ATCC 27405]
 gi|255991341|gb|EEU01447.1| Phosphoglycerate kinase [Clostridium thermocellum DSM 2360]
 gi|316941101|gb|ADU75135.1| Phosphoglycerate kinase [Clostridium thermocellum DSM 1313]
          Length = 397

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 159/397 (40%), Positives = 240/397 (60%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIF 59
           M   +T+ D+ D++G + ++RVD+NVP  +  K+ D  RI   +PTI  LVE  AK ++ 
Sbjct: 3   MMNKKTIEDI-DVKGKKVIVRVDFNVPLDENRKITDDKRIVGALPTIKYLVEHGAKTILV 61

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   ++  S+         +L K ++   D IG       A+L EG +++ ENV
Sbjct: 62  SHLGRPKEGFEEKYSMAPTAVRLGELLGKEVIMAKDVIGPDAKAKAAALKEGEVLMLENV 121

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EE +NDP F + L+   + Y+NDAF  +HRAHAS  GL+  LP+  G  +QKE+ +
Sbjct: 122 RFHKEETKNDPAFAKELASMAEIYVNDAFGTAHRAHASTAGLADYLPAVCGYLIQKEIEV 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +    S  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  A+G  +G SL
Sbjct: 182 MGKALSNPERPFVAILGGAKVSDKIGVIENLIDKVDTLIIGGGMAYTFFKAKGYSIGTSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ D  +    +  +A++   ++++P D VV +E       + V +  +P   + +D+G 
Sbjct: 242 CEDDKVELAKSLMDKAEKKGVKLLLPVDNVVGKEFSNDTERKTVPSDQIPDGWMGMDIGE 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T++   + I  A+TV+WNGP+GVFE   F   T EVA  VA    E   ISI GGGD+ 
Sbjct: 302 ETIKLYSEAIKNAKTVVWNGPMGVFEFSNFANGTREVARAVA----ESGAISIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 358 AAIEQLGFADKITHISTGGGASLEFLEGKVLPGIDVL 394


>gi|116749491|ref|YP_846178.1| phosphoglycerate kinase [Syntrophobacter fumaroxidans MPOB]
 gi|229620382|sp|A0LJZ1|PGK_SYNFM RecName: Full=Phosphoglycerate kinase
 gi|116698555|gb|ABK17743.1| phosphoglycerate kinase [Syntrophobacter fumaroxidans MPOB]
          Length = 397

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 156/399 (39%), Positives = 240/399 (60%), Gaps = 7/399 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ +L ++ G R  +RVD+NVP   + +V D  RI  V+PT+ +++EK  K ++ SHL
Sbjct: 1   MKTVGEL-ELSGKRVFIRVDFNVPLDKEFRVKDDLRIRAVLPTLNKVIEKGGKAILASHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K   + SL  V      ++ + +    DC G  + + IA +  G ++L EN+RF+
Sbjct: 60  GRPKGKPSAEFSLKPVGEHLSRLIDRPVPLAPDCTGREVVERIAQMKNGDVLLLENLRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLE 181
           +EEE+ND  F R L+   D Y+NDAF+VSHRAHAS+ G++        G  ++ E+    
Sbjct: 120 AEEEKNDEAFSRALADLADVYVNDAFAVSHRAHASVHGMTRFARECAAGYQLENEIKYFR 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  +P+  ++GG+KVSTKI +L +L+ +VD LVIGG MAN+F  AQG  VGRSL +
Sbjct: 180 KAMDNPARPMAMVIGGAKVSTKIGVLEHLISRVDFLVIGGAMANTFFKAQGKEVGRSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   ++   A     ++ +P D VVA  +++    Q V  + VP D +ILDVG K+
Sbjct: 240 DDHLETAARLLKAAAEKGVKVYLPVDAVVAPSLESCGDVQQVPVEKVPKDRLILDVGSKS 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E  + V+   RT++WNGPLG FE  PF++ T  +A ++  L      +++ GGGD+  A
Sbjct: 300 IEVFESVLKNCRTIVWNGPLGAFETPPFNKGTFALAEFLGSLDA----LTVIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400
           +  A + ++ +YVST GGAFLE LEG  LPG+ AL   C
Sbjct: 356 VKQANMEDKVSYVSTGGGAFLEMLEGITLPGVAALEECC 394


>gi|220906394|ref|YP_002481705.1| phosphoglycerate kinase [Cyanothece sp. PCC 7425]
 gi|254782201|sp|B8HXQ5|PGK_CYAP4 RecName: Full=Phosphoglycerate kinase
 gi|219863005|gb|ACL43344.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7425]
          Length = 406

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/392 (42%), Positives = 248/392 (63%), Gaps = 8/392 (2%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKS- 69
           D+ G R L+RVD+NVP  D GK+ D TRI   +PTI +L  K AKV++ SH GRP+ ++ 
Sbjct: 13  DLAGKRVLVRVDFNVPLDDQGKITDDTRIRAALPTIQDLTSKGAKVILSSHFGRPKGETF 72

Query: 70  -DKDCSLFKVVSIA---ESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
            ++    F++  +A     +L K +   NDCIG  +   +A++  G ++L ENVRF+  E
Sbjct: 73  AERVKDKFRLTPVAARLSELLGKPVPKPNDCIGEEVKAQVAAMQNGDVLLLENVRFHPGE 132

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCF 184
           E N P+F + L+   D Y+NDAF  +HRAHAS  G++ +L PS  G  ++KEL  L+S  
Sbjct: 133 EANTPEFAQELASVADLYVNDAFGTAHRAHASTEGVTRYLRPSVAGYLIEKELQYLQSAI 192

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              ++PL AIVGGSKVS+KI ++  L++KVDKL++GGGM  +F  A+G+ VG+SL + D 
Sbjct: 193 ENPQRPLAAIVGGSKVSSKIGVIETLLEKVDKLLLGGGMIFTFYKARGLNVGKSLVEEDK 252

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +    +  +AK     +++P DVVVA         Q VS +S+P   + LD+G   V+ 
Sbjct: 253 LELARTLEAKAKERGVALLLPTDVVVADAFAADANAQTVSVESIPDGWMGLDIGPDAVKT 312

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            ++ ++  +TV+WNGP+GVFE + F   T  +AH +A LT  +   +I GGGD++ A+  
Sbjct: 313 FQEALSDCKTVIWNGPMGVFEFDKFAVGTEAIAHSLAGLTG-KGASTIIGGGDSVAAVEK 371

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            G++ + +++ST GGA LE LEGK+LPGIVAL
Sbjct: 372 VGVAEQMSHISTGGGASLELLEGKELPGIVAL 403


>gi|88809813|ref|ZP_01125319.1| phosphoglycerate kinase [Synechococcus sp. WH 7805]
 gi|88786197|gb|EAR17358.1| phosphoglycerate kinase [Synechococcus sp. WH 7805]
          Length = 402

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 157/388 (40%), Positives = 241/388 (62%), Gaps = 3/388 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLDDAGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K +   + CIG      + +++ G ++L ENVRF++EEE+N+ 
Sbjct: 73  DAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMANGDVVLLENVRFFAEEEKNEA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSESKK 189
            F   L+   + Y+NDAF  +HRAHAS  G++ +L P+  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKYLKPAVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        +QV    ++P   + LD+G   V+  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDANSQVADVTAIPDGWMGLDIGPDAVKVFQAAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE E F   T  +A  +A+L+  +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCQTVIWNGPMGVFEFEKFANGTNAIATTLAELSG-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAALN 399


>gi|149183681|ref|ZP_01862094.1| phosphoglycerate kinase [Bacillus sp. SG-1]
 gi|148848608|gb|EDL62845.1| phosphoglycerate kinase [Bacillus sp. SG-1]
          Length = 394

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 159/393 (40%), Positives = 237/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R   RVD+NVP  +G V D TRI+  +PTI  L E+ AKV++ SHLGR
Sbjct: 4   QTIKDI-DLKGKRVFCRVDFNVPMSEGNVTDETRIKAALPTIQYLSEQGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +  ++  L  V      +L K++   ++  G T+   I  +SEG ++L ENVRFY  
Sbjct: 63  PKGQVVEELRLTPVAKRLSELLGKDVAKTDEAYGDTVKAEIEKMSEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +ND D  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL +L    
Sbjct: 123 ETKNDADLAKEFAALADVYVNDAFGAAHRAHASTAGVAEHLPAAAGFLLEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +  ++P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ AQG  VG+SL + D 
Sbjct: 183 TTPERPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKAQGHEVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   Q   +A+    +  +P DVVVA +      T+VV  + +P D   LD+G KT E 
Sbjct: 243 IDLAKQFMKKAEDKGVKFYMPVDVVVADDFSNDANTKVVPIEEIPSDWEALDIGPKTQEQ 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
              VI  +R V+WNGP+GVFEIE F   T         L       S+ GGGD+  A+  
Sbjct: 303 YASVIKNSRLVIWNGPMGVFEIEKFANGT---KAVAQALADAADTYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             ++++ +++ST GGA LE++EGK+LPG+ AL+
Sbjct: 360 FDLADKMSHISTGGGASLEFMEGKELPGVSALN 392


>gi|299115459|emb|CBN75623.1| phosphoglycerate kinase [Ectocarpus siliculosus]
          Length = 444

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 166/395 (42%), Positives = 243/395 (61%), Gaps = 4/395 (1%)

Query: 6   TMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ DL+D  ++G + L+R D NVP  D  + D TRI   +PTI  L+ K A+V + SHLG
Sbjct: 49  SVGDLKDEDLKGKKVLVRCDLNVPLSDKVIGDDTRIRASIPTIEHLLSKGARVALSSHLG 108

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL  V      +L K+     DC+G  +++    L +G ++L ENVRFY 
Sbjct: 109 RPKDGPEDKFSLGPVAERLTKLLGKDCKMAPDCVGDEVAKIADGLGDGEVMLLENVRFYP 168

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLES 182
            E +ND DF   L+   D ++NDAF  +HRAH S  G++  L PS  G  +QKEL  L  
Sbjct: 169 AETKNDKDFAEKLAAPFDLFVNDAFGTAHRAHCSTEGVTKFLSPSVAGFLLQKELDYLAG 228

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
              E K+P  AIVGGSKVS+KI ++ +L+ K DKL+IGGGM  +FL A+G+GVG SL + 
Sbjct: 229 AVQEPKRPFAAIVGGSKVSSKIGVIESLLAKCDKLIIGGGMVFTFLKARGLGVGSSLVEE 288

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  +   ++  +AK +  EII+P DVVVA        TQVV A ++P   + LD G +  
Sbjct: 289 DKLELAKELEEKAKTAGVEIILPSDVVVADAFAADAKTQVVKADAIPDGWMGLDNGPEAT 348

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           + I+  + + +TV+WNGP+GVFE E F + T  +A  +A++T E    +I GGGD++ A+
Sbjct: 349 KEIQAALKECKTVVWNGPMGVFEYEAFAKGTFAIADTLAEITSE-GCTTIVGGGDSVAAV 407

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             A ++++ +++ST GGA LE LEGK LPG+ AL+
Sbjct: 408 EKANLADKMSHISTGGGASLELLEGKVLPGVAALN 442


>gi|332704189|ref|ZP_08424277.1| Phosphoglycerate kinase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554338|gb|EGJ51382.1| Phosphoglycerate kinase [Desulfovibrio africanus str. Walvis Bay]
          Length = 397

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 151/389 (38%), Positives = 239/389 (61%), Gaps = 4/389 (1%)

Query: 9   DLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSK 68
           D  +I+G R L+RVD+NVP  +G V D TRI+  + TI   ++K A +V+ SHLG+P+ K
Sbjct: 7   DQMNIKGKRLLIRVDYNVPIKNGTVQDDTRIKGSLETIQYCLDKGAALVLCSHLGKPKGK 66

Query: 69  SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERN 128
            D+  SL         ++ + +    DC+G  + + + +L  G ++L EN+RF+  E +N
Sbjct: 67  PDQAFSLKPAAQRLSELIGRKVQMAPDCVGPEVEKMVQALKPGDVLLLENLRFHEGETKN 126

Query: 129 DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLESCFSES 187
           DP F   L++ G+ ++NDAF  +HRAHAS+ G++ H+     G  ++KE   +     E 
Sbjct: 127 DPQFSAALAKMGEIFVNDAFGTAHRAHASMVGVTKHISQCCAGFLLKKEWEYIGENLGEP 186

Query: 188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDN 247
           ++P VAI GG+KVS+K+ +L  L+ +VD LVIGG MAN+FL+AQG  VG SL + +  D 
Sbjct: 187 QRPYVAISGGAKVSSKLAVLYRLLSQVDALVIGGAMANTFLLAQGYSVGTSLVESELLDE 246

Query: 248 VHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQ 307
             +I  EA+    ++ +P DVV+   +            S+P D+++LD+G KT E   +
Sbjct: 247 AKKIMNEAETRGVKLHLPTDVVLGHGLDDKHSMGTADVNSIPRDAMVLDIGPKTREQYAK 306

Query: 308 VIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGI 367
            +A+A+TVMWNGP+G FE   F   ++ +A  VA LT     +++ GGGDT   +   G+
Sbjct: 307 AVAKAKTVMWNGPMGAFENPAFAEGSIALAKAVAGLTD---ALTVVGGGDTDALVHKTGM 363

Query: 368 SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +++F+++ST GG+F+E+LEGK+LP   AL
Sbjct: 364 ADKFSFISTGGGSFMEFLEGKELPAFAAL 392


>gi|260061285|ref|YP_003194365.1| phosphoglycerate kinase [Robiginitalea biformata HTCC2501]
 gi|88785417|gb|EAR16586.1| phosphoglycerate kinase [Robiginitalea biformata HTCC2501]
          Length = 396

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 155/393 (39%), Positives = 239/393 (60%), Gaps = 4/393 (1%)

Query: 9   DLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQS 67
           D  D +  + L+RVD+NVP   D +V D  RIE   PTI++++E     V+ SHLGRP+ 
Sbjct: 4   DKFDFKDKKALVRVDFNVPLNEDFQVTDTNRIEAAKPTIIKILEDGGSAVLMSHLGRPKG 63

Query: 68  KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEER 127
             + D SL  +V     I+   + F +DCIG + +  + +L  G I+L EN+RF+ EEE 
Sbjct: 64  SPNPDLSLSHIVDTVSDIIGVEVKFASDCIGDSAAAEVEALQSGEILLLENLRFHGEEEA 123

Query: 128 NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSMLESCFS 185
            D +F R LS+ GD Y+NDAF  +HR HAS T ++   P     G  + +E+  ++    
Sbjct: 124 GDREFARKLSQWGDIYVNDAFGTAHRPHASTTVVAEFFPEKKCFGYLLAREIEAIDKVME 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP+ AI+GG+KVS+KIT++ N++ K+D L+IGGGM  +F+ A+G  VG S+C+ D +
Sbjct: 184 TGEKPVTAILGGAKVSSKITIIENILDKIDHLIIGGGMTYTFVKARGGSVGDSICEPDKT 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
           D    I  +AK     + +P DVV A        +++++  ++      LD G +T+E  
Sbjct: 244 DLALSILEKAKAKGVAVHLPVDVVAADAFDNDAESRIMAVDAIEDGWQGLDAGPETLERF 303

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
           ++VI ++RT++WNGP+GVFE+  F + T+ V +YVA+ T+     S+ GGGD++ A+   
Sbjct: 304 RKVILESRTILWNGPVGVFEMPNFAKGTIAVGNYVAEATR-NGAFSLVGGGDSVAAVKQF 362

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           G   + +YVST GGA LE LEG+ LPGI A+ G
Sbjct: 363 GFDEKVSYVSTGGGAMLESLEGRTLPGIAAIRG 395


>gi|126695553|ref|YP_001090439.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9301]
 gi|166987794|sp|A3PAR3|PGK_PROM0 RecName: Full=Phosphoglycerate kinase
 gi|126542596|gb|ABO16838.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9301]
          Length = 402

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 157/400 (39%), Positives = 247/400 (61%), Gaps = 3/400 (0%)

Query: 1   MSRLRTMN-DLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L   + D   + G + L+RVD+NVP   DG++ D TRI   +PTI  LV   AKV++
Sbjct: 1   MSKLSLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLVNHSAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            +H GRP+ + ++   L  V +    +L +++   N CIG        SLS   ++L EN
Sbjct: 61  AAHFGRPKGQVNEKMRLTPVAARLSELLGQSVALTNSCIGDEAVAKSNSLSNRDVLLLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKEL 177
           VRF+ EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G+++ L PS  G  ++KEL
Sbjct: 121 VRFFGEEEKNDLEFAQKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+       +PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG+
Sbjct: 181 KYLQGAVDSPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DVV+A E      +++    S+  + + LD+
Sbjct: 241 SLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLANEFSPDAESKISQIDSISGNWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGGD
Sbjct: 301 GPDSIKVFQNALAECKTIIWNGPMGVFEFDKFADGTNAIATTLADLSAFSEVCTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 361 SVAAVEKAGLAEKMSHISTGGGASLELLEGKILPGVAALN 400


>gi|325954645|ref|YP_004238305.1| phosphoglycerate kinase [Weeksella virosa DSM 16922]
 gi|323437263|gb|ADX67727.1| Phosphoglycerate kinase [Weeksella virosa DSM 16922]
          Length = 396

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 154/383 (40%), Positives = 240/383 (62%), Gaps = 4/383 (1%)

Query: 17  RCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSL 75
           + L+RVD+NVP   + +V D TRI  V PTI ++++    VV+ SHLGRP+ + ++  SL
Sbjct: 13  KALIRVDFNVPQDANLQVTDATRIVAVKPTIEKILDDGGSVVLMSHLGRPKGQVNEQFSL 72

Query: 76  FKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRM 135
             +V   E +L K ++F  D +G    Q +A L  G I+L ENVRF +EEE+ D +F   
Sbjct: 73  KNIVPKIEEVLGKKVIFSKDTVGEDAQQKVADLQNGEILLLENVRFQAEEEKGDREFAEK 132

Query: 136 LSRNGDFYINDAFSVSHRAHASITGLSHLLPSY--IGRAMQKELSMLESCFSESKKPLVA 193
           LS+ GD Y+NDAF  +HRAHAS   ++   P     G  MQ+EL  +E      + P+ A
Sbjct: 133 LSKFGDIYVNDAFGTAHRAHASTAIVAEFFPDKKAFGYLMQQELEAIEKVLKSGEHPITA 192

Query: 194 IVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAW 253
           I+GG+KVS+KIT++ N++  +D L+IGGGM  +F+ AQG  +G SL + D  +   +I  
Sbjct: 193 ILGGAKVSSKITIINNILPVIDNLIIGGGMTYTFIKAQGGKIGASLVEDDKLELAKEIIE 252

Query: 254 EAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQAR 313
           + K++  ++ +P D V+A +      TQ+VS  ++P + + +DVG +T  +  QVI  ++
Sbjct: 253 DCKKNNVKLYLPIDNVIANKFSNDAETQLVSVNNIPDNWMGMDVGPETSAHFAQVILDSK 312

Query: 314 TVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTY 373
           T++WNGPLGVFE+E F + T+ +   +A+ T ++   S+ GGGD++  +   G  ++ +Y
Sbjct: 313 TILWNGPLGVFEMENFAKGTIALGDAIAEAT-QKGAFSLVGGGDSVAFVKAFGYDDKVSY 371

Query: 374 VSTAGGAFLEWLEGKDLPGIVAL 396
           VST GGA LE LEGK+LPG+ A+
Sbjct: 372 VSTGGGAMLESLEGKELPGVAAI 394


>gi|206895174|ref|YP_002247077.1| phosphoglycerate kinase [Coprothermobacter proteolyticus DSM 5265]
 gi|238057759|sp|B5Y8I0|PGK_COPPD RecName: Full=Phosphoglycerate kinase
 gi|206737791|gb|ACI16869.1| phosphoglycerate kinase [Coprothermobacter proteolyticus DSM 5265]
          Length = 393

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 164/395 (41%), Positives = 238/395 (60%), Gaps = 8/395 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +LR++ D  ++R  R ++RVD+NVP   +G V D  RI   +PTI  LVE  AKV++ SH
Sbjct: 2   KLRSIRD-AEVRNKRVIVRVDFNVPLDAEGNVVDDFRIRAALPTIEYLVENGAKVILISH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K DK  SL  V      +LHK ILF  D +G  +  ++  L  G I+L ENVRF
Sbjct: 61  LGRPKGKRDKKYSLVGVAKRLAELLHKEILFAPDVVGEEVELAVNGLRSGDILLCENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EEE+ND +F + ++  G+ ++NDAFS SHRAHA++ G++  LPSY G  M+KE++ L 
Sbjct: 121 HEEEEKNDAEFAKNIASLGEIFVNDAFSASHRAHATVEGITKFLPSYAGFLMEKEVNYLS 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P   ++GG+KVS K+ LL NL+ KVD +VIGG M  +F  AQG  +G+S+ +
Sbjct: 181 MLTENPQRPYYLVLGGAKVSDKVALLQNLLPKVDGMVIGGAMVFTFWKAQGKEIGKSIVE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D      ++  +A     EI++ +D VVA E K  +  + +S    P D I  D+G ++
Sbjct: 241 DDLVGFAKELLEQATTQNKEIVLAKDFVVADENKEHVEIKAISDFG-PAD-IGYDIGPES 298

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++  K  + +ARTV WNGPLG+FE   F   T +V  ++A          + GGGDT  A
Sbjct: 299 IKEFKNALVKARTVFWNGPLGLFEDAKFAEGTKQVGAFLADFPG----TVVVGGGDTANA 354

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +    +  +F +VST GGA LE+LEGK LPGI  L
Sbjct: 355 VREMELFEKFAHVSTGGGASLEFLEGKVLPGIAPL 389


>gi|312888807|ref|ZP_07748370.1| phosphoglycerate kinase [Mucilaginibacter paludis DSM 18603]
 gi|311298682|gb|EFQ75788.1| phosphoglycerate kinase [Mucilaginibacter paludis DSM 18603]
          Length = 430

 Score =  305 bits (781), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 156/402 (38%), Positives = 237/402 (58%), Gaps = 6/402 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
            S L+ M   DL    G R L+RVD+NVP  D   + D  R+   +PTI ++++    V+
Sbjct: 29  FSLLKIMKTIDLIKFSGKRALIRVDFNVPLDDSFNITDDNRMTAALPTIEKILKDGGSVI 88

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L + + F +DCIG+   Q    L  G ++L E
Sbjct: 89  LMSHLGRPKDGPTNKYSLKHLVPHLSDLLGQQVEFADDCIGADALQKAKDLKPGEVLLLE 148

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS--YIGRAMQK 175
           N+RFY EEE+ D DF   LS+ GD Y+NDAF  +HRAHAS   ++   P   Y G  M  
Sbjct: 149 NLRFYKEEEKGDKDFAEKLSKLGDIYVNDAFGTAHRAHASTAVIAQFFPDAKYFGYLMAG 208

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           EL+  E   + + KP  AI+GG+KVS KI L+  L+ KVD L+IGGGMA +F  AQG  +
Sbjct: 209 ELANAEKVLNGAVKPFTAIMGGAKVSDKIELIEKLLDKVDNLIIGGGMAYTFAKAQGGNI 268

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G+SL + D  D  + +  +AK     +++P D V+A        T+     ++    + L
Sbjct: 269 GKSLVEADKLDLANSLVQKAKDKGVNLLLPTDSVIADNFSNDANTEAAQNNNIKDGWMGL 328

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G +++    +V+ +++T++WNGP+GVFE+E F++ T  +A  V K T E    S+ GG
Sbjct: 329 DIGPESIAAFSKVVEESKTILWNGPMGVFEMEKFEKGTKAIAEAVVKAT-ENGAFSLIGG 387

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           GD+  A+A   ++++ +YVST GGA LE++EGK+LPG+ A++
Sbjct: 388 GDSAAAVAKFNLTDDVSYVSTGGGALLEYMEGKELPGVKAIN 429


>gi|219847582|ref|YP_002462015.1| phosphoglycerate kinase [Chloroflexus aggregans DSM 9485]
 gi|254782196|sp|B8G4H3|PGK_CHLAD RecName: Full=Phosphoglycerate kinase
 gi|219541841|gb|ACL23579.1| Phosphoglycerate kinase [Chloroflexus aggregans DSM 9485]
          Length = 400

 Score =  305 bits (781), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 241/396 (60%), Gaps = 5/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D  G R L+RVD+NVP  + G++ D TRI   +PTI  L+E  AKV++ SHLG
Sbjct: 4   KTIRDV-DWAGKRALVRVDFNVPLDEQGQITDDTRIRAALPTIRYLLEHGAKVILMSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHK--NILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           RP+ K +   SL  VV     +L +   +       G     +++ L  G +++ EN RF
Sbjct: 63  RPKGKPNPKYSLRPVVERLFELLPEATEVKKTEAITGPAAEAAVSMLKPGQVLVLENTRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
              EE NDP     L++ GD ++NDAF  +HRA+AS  G++H LP+  G  M+KEL+ + 
Sbjct: 123 DPREEANDPQMAAELAKLGDVFVNDAFGTAHRANASTEGVAHYLPAVAGFLMEKELTYIG 182

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P V ++GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+A+G+ +G SL +
Sbjct: 183 GALSNPQRPFVTVIGGAKISDKIGVIENLLGKVDALLIGGGMANTFLLAKGLNLGDSLVE 242

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +      Q+  +A+     +++P DVV+A         QVV   ++P    +LD+G KT
Sbjct: 243 PESVPVAQQLMAKAEERGARLLLPVDVVIADAFSAEAQRQVVEVTAIPSGWRVLDIGPKT 302

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E     I  ARTV+WNGP+GVFE+EPF   T  +A  +A+ +     I+I GGGD++ A
Sbjct: 303 IELYSAEIRSARTVIWNGPMGVFELEPFAAGTRAIAQAMAEASA-NGAITIVGGGDSVAA 361

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  AG++ +  +VST GGA LE LEG+ LPG+ AL 
Sbjct: 362 VEQAGLAEKMAHVSTGGGASLELLEGRVLPGVAALQ 397


>gi|150021145|ref|YP_001306499.1| phosphoglycerate kinase [Thermosipho melanesiensis BI429]
 gi|166987819|sp|A6LMG3|PGK_THEM4 RecName: Full=Phosphoglycerate kinase
 gi|149793666|gb|ABR31114.1| Phosphoglycerate kinase [Thermosipho melanesiensis BI429]
          Length = 402

 Score =  305 bits (781), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 244/398 (61%), Gaps = 4/398 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ DI+  + ++RVD+NVP  DGK+ D TRI   +PTI   +E  A V++ S
Sbjct: 1   MEKL-TIRDI-DIKNKKVIMRVDFNVPLKDGKITDDTRIVEALPTIKYAIENNAVVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV +  G  +  +I +   G +IL EN R
Sbjct: 59  HLGRPKGERKPEFSLKPVSERLSELLGKQVTFVPELYGEEVKMAIDNAKPGDVILLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  +  +   D ++NDAF  +HRAHAS  G+S  +PS  G  M+KE+  L
Sbjct: 119 FDKGETKNDPELAKKWADLADIHVNDAFGTAHRAHASNVGISQYIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V I+GG+KVS KI ++ NL+ K DK++IGG M  +FL A G  VG SL 
Sbjct: 179 SKATLNPEKPYVVILGGAKVSDKIGVITNLLNKADKILIGGAMMFTFLKALGKNVGSSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   +I  EAK    E ++P D V A+++++G+ T+       +P   + LD+G 
Sbjct: 239 EEDKLDLAKRILEEAKEKGVEFVLPVDAVCAQKIESGVETKTFRINDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++++  K+ I+ A+T++WNGP+GVFEIE F+  T EVA  +A  T E+   ++ GGGD+ 
Sbjct: 299 ESIKLFKEKISGAKTIVWNGPMGVFEIEDFETGTKEVAISIAAET-EKGATTVIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+A   + N+ ++VST GGA LE+LEGK+LPGI +++
Sbjct: 358 AAIAKFNLKNKVSHVSTGGGASLEFLEGKELPGIASIA 395


>gi|313903098|ref|ZP_07836492.1| phosphoglycerate kinase [Thermaerobacter subterraneus DSM 13965]
 gi|313466600|gb|EFR62120.1| phosphoglycerate kinase [Thermaerobacter subterraneus DSM 13965]
          Length = 424

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 153/395 (38%), Positives = 242/395 (61%), Gaps = 8/395 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           R R++ DL D+RG R L+R D+NVP   G++ D TRI   +PTI  L+E+ A V++ SHL
Sbjct: 2   RKRSVRDL-DVRGRRVLVRADFNVPLEGGRITDDTRIRAALPTIRYLLEQGAAVILCSHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K  ++  L  V    E +L + +  + + +G  + + +A L  G ++L EN+RF+
Sbjct: 61  GRPKGKVVEELRLAPVARRLEELLGRPVRALPEVVGPQVEREVAGLQPGEVVLLENLRFH 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             E  NDP+F   L+R    Y+NDAF  +HRAHAS+ G++  LP+  G  +++EL +L  
Sbjct: 121 PGETANDPEFAAALARLAHVYVNDAFGAAHRAHASVVGVAERLPAAAGFLLERELEVLGG 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                ++P  A++GG+KVS KI ++  L++  D L IGG MAN+ L A+G  VGRSL + 
Sbjct: 181 LLERPRRPFWAVLGGAKVSDKIGVIQRLLEVCDGLAIGGAMANTLLAARGFDVGRSLYEP 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +  +   +  W  + +   +++P DVVV  +++ G P++VV    +P  ++ +DVG  T+
Sbjct: 241 EQVEPARR--W-LETAGDRLLLPADVVVTEKLEPGAPSRVVPVDRIPTGAMAVDVGPATL 297

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              ++ +  A TV WNGPLGVFE+EPF R T  +A ++A L      +++ GGGD++ A+
Sbjct: 298 AAWQERLRGAGTVFWNGPLGVFEVEPFHRGTFALAEFLAGLEA----VTVVGGGDSVAAV 353

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              G++    ++ST GGA LE LEGK+LPG+  L 
Sbjct: 354 QRTGVAGRIDHISTGGGASLELLEGKELPGVAVLP 388


>gi|194015562|ref|ZP_03054178.1| phosphoglycerate kinase [Bacillus pumilus ATCC 7061]
 gi|194012966|gb|EDW22532.1| phosphoglycerate kinase [Bacillus pumilus ATCC 7061]
          Length = 394

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 232/386 (60%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G     RVD+NVP  DGKV D TRI   +PTI  L  + AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKVVFCRVDFNVPMKDGKVTDDTRIRAALPTIEYLTGQGAKVLLASHLGRPKGQVTE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V    + +L + +   ++  G  + + I+ L EG +++ ENVRFY  EE+NDP+
Sbjct: 70  ELRLTPVAKRLQELLGQEVKKADEAYGDNVKKQISDLKEGDVLVLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  MQKEL +L    S   +P 
Sbjct: 130 LSKAFADLADVYVNDAFGAAHRAHASTAGIAAYLPAVSGFLMQKELEVLGKAISNPDRPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL + D  D     
Sbjct: 190 TAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGHEVGKSLLEEDKVDLAKSF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK      ++P DV+VA +      T +V    +P D   LD+G +T+     VI  
Sbjct: 250 MDRAKEKGVNFLIPTDVLVADDFSNDANTSIVPISEIPSDLEALDIGTETIGKYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFEI+ F + T  +A  +A+    +   S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEIDAFAKGTKAIAEALAEA---KDTYSVIGGGDSAAAVEKFGLADQM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+ AL+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVTALN 392


>gi|189424676|ref|YP_001951853.1| phosphoglycerate kinase [Geobacter lovleyi SZ]
 gi|238692139|sp|B3E9Q7|PGK_GEOLS RecName: Full=Phosphoglycerate kinase
 gi|189420935|gb|ACD95333.1| Phosphoglycerate kinase [Geobacter lovleyi SZ]
          Length = 397

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 162/395 (41%), Positives = 240/395 (60%), Gaps = 6/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +R ++ L+D++G +  +RVD+NVP  + G + + TRI   VPTI   VE+ AKVV+ SHL
Sbjct: 3   IRYIDQLKDLKGKKVFIRVDFNVPQDEKGNITEDTRIAGAVPTIKYAVEQGAKVVLASHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +     ++         +L K ++   DC G  +S+ I S+  G +++ ENVRFY
Sbjct: 63  GRPKGEKKSKYTMAPAAKRLSQLLGKKVMQAPDCFGPDVSKIIDSMKPGDVVMLENVRFY 122

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLE 181
             EE+NDP+F + L    + Y+NDAF+VSHRAHAS+  ++ L+P+   G  M+ E++  +
Sbjct: 123 PGEEKNDPEFAQQLVNGCEIYVNDAFAVSHRAHASVEAITKLVPTIAAGFLMKNEMTFFD 182

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +PLVAI+GG+KVS K+ +L  LV KVDK+VIGGGMA +FL A G GVG+SL +
Sbjct: 183 KAMSNPVRPLVAILGGAKVSGKLEVLETLVNKVDKIVIGGGMAFTFLKAMGYGVGKSLVE 242

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +      +I  +AK+      +P D VVA   +      V + Q +P   + LD+G  +
Sbjct: 243 DELIPTAKKIMDKAKKKGVTFYLPVDCVVANAFEANATNFVTTVQEIPEGWMALDIGPAS 302

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
                + +  A+TV+WNGP+GVFE++ F R T  VA  V          ++ GGGDT  A
Sbjct: 303 ATLFAETLRDAKTVIWNGPMGVFEMDAFCRGTFAVAEAVGNC----YATTVIGGGDTDAA 358

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++ + +Y+ST GGAFLE LEGK LPG+ AL
Sbjct: 359 VNKAGVAAKVSYISTGGGAFLELLEGKILPGVKAL 393


>gi|289548832|ref|YP_003473820.1| phosphoglycerate kinase [Thermocrinis albus DSM 14484]
 gi|289182449|gb|ADC89693.1| Phosphoglycerate kinase [Thermocrinis albus DSM 14484]
          Length = 405

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 162/397 (40%), Positives = 243/397 (61%), Gaps = 8/397 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           R +T+ D+ ++ G R L+RVD+NVP  D G + D TRI   +PTI  L++ +AKV++ SH
Sbjct: 4   RKKTLRDV-NLSGKRVLVRVDFNVPMDDLGNIEDDTRIRASLPTIQYLLDARAKVILMSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + D   SL  V       + + +    DC+G+ + + +  + EG ++L EN+RF
Sbjct: 63  LGRPKGR-DPKYSLAPVAKRLSRYIAREVKLAPDCVGAEVKKLVEDMKEGDVLLLENLRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           +  EE+ D DF + L+  G+ Y+ DAF   HR HAS   +  +L P+ +G  ++KE+S  
Sbjct: 122 HQGEEQADVDFAKELASLGEVYVADAFGTCHRKHASTYLVPQILKPAVMGFLLEKEVSYF 181

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E      ++P+VAI+GG+KVS+K+ +L NL+K+VDKL +GG MA +F+ + G  VG SL 
Sbjct: 182 ERAMVNPQRPVVAIIGGAKVSSKLGILKNLLKRVDKLFVGGAMAFTFIKSMGFPVGNSLV 241

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I   A++   +  +P D V+ RE+    PT+VV  Q +P   + LD+G  
Sbjct: 242 EEDLLDTARDILEVARKLDVKFYLPVDFVIGRELSDNTPTRVVPWQEIPSGWMGLDIGPV 301

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V  I++VIA A+T++WNGPLGVFE++ F   T    +  AK+  E   ++IAGGGDT  
Sbjct: 302 SVSLIREVIADAQTIVWNGPLGVFELDRFKEGT----YQTAKMLAESPALTIAGGGDTDH 357

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+  AG+ N   +VST GGAFLE LEG  LP I  L 
Sbjct: 358 AIHRAGVYNSIDFVSTGGGAFLELLEGNTLPCIEVLD 394


>gi|299117170|emb|CBN75134.1| phosphoglycerate kinase [Ectocarpus siliculosus]
          Length = 411

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 156/397 (39%), Positives = 246/397 (61%), Gaps = 5/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGK---VADVTRIERVVPTILELVEKKAKVVIFS 60
           +R + D  D+ G R  +RVD N P        V D TR+    PTI  L +K AKV++ S
Sbjct: 11  VRDLADSTDLTGKRVFVRVDLNAPLSKDSPPAVTDATRLSAACPTITFLADKGAKVILAS 70

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +      +  V +    +L K ++ ++DCIG+T+ + I+S+  G I+L ENVR
Sbjct: 71  HLGRPKKQVVDSLRMDPVAAKLSELLGKEVIKMDDCIGTTVEERISSMGNGEIMLLENVR 130

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSM 179
           F+S EE ND +F + L+   D+Y+NDAF  +HRAHAS  G++  +   + G  M+KEL  
Sbjct: 131 FHSGEESNDEEFSKQLAALCDYYVNDAFGTAHRAHASTEGITKFVDRKVSGMLMEKELKY 190

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+       +P+  IVGG+KVS+KIT++  L++K D +++GGGM  +F  A+G+GVG+SL
Sbjct: 191 LKGAVDSPVRPMACIVGGAKVSSKITVIEALIEKCDVILLGGGMIFTFYKAKGLGVGKSL 250

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D+ D    +  +A+    ++++P DVVVA +      +  V+  S+P + + LDVG 
Sbjct: 251 VEDDYVDLARDLMSKAEAKGVKMLLPEDVVVADKFSPTAESDTVTVDSIPEEWMGLDVGP 310

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT+   +  +A  +T++WNGP+GVFE + F   T  VA  +A LT  +  I+I GGGD++
Sbjct: 311 KTISAFEDALAPCKTIVWNGPMGVFEFDKFAAGTFAVASCLADLTS-KGAITIIGGGDSV 369

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+  A ++++ +++ST GGA LE LEGK+LPG+ A+
Sbjct: 370 AAVEKANLADKMSHISTGGGASLELLEGKELPGVNAI 406


>gi|187735910|ref|YP_001878022.1| Phosphoglycerate kinase [Akkermansia muciniphila ATCC BAA-835]
 gi|229620031|sp|B2UKW8|PGK_AKKM8 RecName: Full=Phosphoglycerate kinase
 gi|187425962|gb|ACD05241.1| Phosphoglycerate kinase [Akkermansia muciniphila ATCC BAA-835]
          Length = 403

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 245/405 (60%), Gaps = 11/405 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++L T+ DL D +G   L+RVD+NVP  DG++ +  RI   +PTI  L+++ A++V+ S
Sbjct: 1   MAKL-TVRDL-DAKGKEVLMRVDFNVPLKDGEITNDARIVAALPTIKFLLDQGARLVLTS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+++ D   SL  V +    +L K++ FV+  IG     + A++ +G ++L ENVR
Sbjct: 59  HLGRPKNEPDPAFSLKPVAARLSELLGKDVKFVSAAIGPEAEAARAAMKDGDVVLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSM 179
           FY  E++NDP+F + L  N   ++NDAF  +HRAHAS  G++H    S +G  +++EL  
Sbjct: 119 FYPGEKKNDPEFAKSLLGNATLFVNDAFGTAHRAHASTEGVTHFAEKSAMGFLIERELEY 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      +KP V I+GG+KVS KI +L  L++K D  +IGG MAN+FL A+G  +G S 
Sbjct: 179 LEGKLENPEKPFVVIMGGAKVSDKIEVLSKLMEKADTFLIGGAMANTFLAAEGYDLGASK 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT----QVVSAQSVPLDSIIL 295
            + D  D   +I   AK    + ++P DV VA + + G  T           VP   + +
Sbjct: 239 IEGDKLDLAREILAAAKAKGVKFLLPADVRVAMKFEDGAETFCTAPFAEGGKVPEGGMAI 298

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G K +E    +I  A+TV+WNGP+GVFE++ F + T EVA  +A  T     ISI GG
Sbjct: 299 DIGDKAIEEFSAIIKDAKTVLWNGPMGVFEMDCFAKGTKEVAEALADST----AISIVGG 354

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400
           GD++TA     + ++ ++ ST GGA LE LEGK LPG+ AL+  C
Sbjct: 355 GDSVTAAKKFKVQDKLSFCSTGGGASLELLEGKVLPGVGALTDKC 399


>gi|94268753|ref|ZP_01291274.1| Phosphoglycerate kinase [delta proteobacterium MLMS-1]
 gi|93451475|gb|EAT02309.1| Phosphoglycerate kinase [delta proteobacterium MLMS-1]
          Length = 392

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 159/394 (40%), Positives = 239/394 (60%), Gaps = 8/394 (2%)

Query: 7   MNDLRDI--RGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           M ++RDI  RG R L+RVD+NVP  + G + D  RI  V+PTI   +++ A V+I SH+G
Sbjct: 1   MKNIRDIDIRGKRVLIRVDFNVPIDEQGNITDDIRIRGVLPTINHALDENAAVIICSHMG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL         +L K +    DC+G  +++  A+LS G ++L EN+RF+ 
Sbjct: 61  RPKGERRPEFSLAPAARRLSRLLDKEVKLAPDCVGPEVAEMAAALSPGEVLLLENLRFHP 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSMLES 182
           EE+ ND  F R L+   + YINDAF+V+HRAHAS+ G+    P+   G  +QKE+     
Sbjct: 121 EEQANDEKFSRELAALAEVYINDAFAVAHRAHASVVGIPRFAPAKGAGFLLQKEMDYFHR 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                 +PL AI+GGSKVS+K+  L NL+ +VDK++IGG MAN+FL +QG+ VGRS  + 
Sbjct: 181 SVGNPMRPLAAIIGGSKVSSKLGALTNLMDRVDKMLIGGAMANTFLRSQGLDVGRSKVED 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  +   ++  +A     ++ +P D +VA E+     T+ V+ Q +P   + LD+G  T 
Sbjct: 241 DLLETARELIAKAHERGVKLYLPVDCIVAPELDAKAETKRVTCQEIPATWMALDIGPATT 300

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
               + +  A+T++WNGP+GVFE++ F R T+ +   V  LT+    ++I GGGDT  A+
Sbjct: 301 MLFTEALDDAKTIIWNGPMGVFEVDAFSRGTMAM---VQTLTRS-HALTIVGGGDTDVAV 356

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             AG S   +Y+ST GGAFL  +EGK LPG+  L
Sbjct: 357 HRAGESANISYISTGGGAFLMLMEGKTLPGVAIL 390


>gi|157693808|ref|YP_001488270.1| phosphoglycerate kinase [Bacillus pumilus SAFR-032]
 gi|166985722|sp|A8FHJ3|PGK_BACP2 RecName: Full=Phosphoglycerate kinase
 gi|157682566|gb|ABV63710.1| phosphoglycerate kinase [Bacillus pumilus SAFR-032]
          Length = 394

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 232/386 (60%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G     RVD+NVP  DGKV D TRI   +PTI  L  + AKV++ SHLGRP+ +  +
Sbjct: 10  DVKGKVVFCRVDFNVPMKDGKVTDDTRIRAALPTIEYLTGQGAKVLLASHLGRPKGQVTE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V    + +L + +   ++  G  + + I+ L +G +++ ENVRFY  EE+NDP+
Sbjct: 70  ELRLTPVAKRLQELLGQEVKKADEAYGDNVKKQISDLKDGDVLVLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  MQKEL +L    S   +P 
Sbjct: 130 LSKAFADLADVYVNDAFGAAHRAHASTAGIAAYLPAVSGFLMQKELEVLGKAISNPDRPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL + D  D     
Sbjct: 190 TAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGHEVGKSLLEEDKVDLAKSF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK      ++P DV+VA +      T +V    +P D   LD+G +T E    VI  
Sbjct: 250 MDRAKEKGVNFLIPTDVLVADDFSNDANTSIVPISEIPSDLEALDIGTETREKYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFEI+ F + T  +A  +A+    +   S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEIDAFAKGTKAIAEALAEA---KDTYSVIGGGDSAAAVEKFGLADQM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+ AL+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVTALN 392


>gi|56750442|ref|YP_171143.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
 gi|81676947|sp|Q5N4Z6|PGK_SYNP6 RecName: Full=Phosphoglycerate kinase
 gi|56685401|dbj|BAD78623.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
          Length = 402

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 162/400 (40%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ RT+  L   D+ G R L+RVD+NVP   +GK+ D TRI   +PTI  L E  AKV+
Sbjct: 1   MSK-RTLASLTAADLEGKRVLVRVDFNVPLDGNGKITDDTRIRAALPTIRYLSESGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L  V      +L + ++   D +G+     +A+ S G ++L E
Sbjct: 60  LVSHFGRPKGKPVESMRLTPVAERLSELLGRPVVKTTDAVGAGAEAQVAATSNGQVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKE 176
           NVRF++EEE ND +F + L+   D Y+NDAF  +HRAHA   G++ +L P   G  ++KE
Sbjct: 120 NVRFHAEEEANDAEFAKALASLADIYVNDAFGAAHRAHAPTAGVTEYLSPCVAGYLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+ VG
Sbjct: 180 LQYLQAAIDNPQRPLAAIVGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +A+    ++++P DVVVA +       + V+  ++P   + LD
Sbjct: 240 GSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  +  +A  R+V+WNGP+GVFE + F   T  +A  +A LT+ +   +I GGG
Sbjct: 300 IGPESVKQFEGALADCRSVIWNGPMGVFEFDQFAVGTEAIARSLAGLTR-KGATTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++E +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|149195103|ref|ZP_01872195.1| phosphoglycerate kinase [Caminibacter mediatlanticus TB-2]
 gi|149134816|gb|EDM23300.1| phosphoglycerate kinase [Caminibacter mediatlanticus TB-2]
          Length = 404

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 236/399 (59%), Gaps = 8/399 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +L +  DL   +G R  +R D+NVP  + G + D  RI   +PTI  L++ + K+VI SH
Sbjct: 2   KLNSPKDLPLKKGDRVFVRCDFNVPIDEFGNITDDRRIRMALPTIKYLLDNECKIVIASH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + ++  SL  V      +L ++++  ND +G       ++L +G ++L ENVRF
Sbjct: 62  LGRPKGEFNEKYSLKPVAKRLSHLLKQDVIMANDVVGPDAKSKASNLKDGEVLLLENVRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS---YIGRAMQKELS 178
            S E +ND  F + LS  GDFYINDAF VSHRAHAS+  ++          G  + KE++
Sbjct: 122 DSRETKNDEGFAKELSEFGDFYINDAFGVSHRAHASVEAITRFYDECHKAAGFLLLKEIN 181

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
                     +P VA+VGGSKVS K+  LINL+ KVDK+++GGGMA +FL A G  VG S
Sbjct: 182 FFYKLLKNPVRPFVAVVGGSKVSGKLQALINLLPKVDKMIVGGGMAFTFLKAMGYNVGNS 241

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  D   +I  EAKR   +  +P D+V+A +       + V+ Q +P   + LD+G
Sbjct: 242 LVEDDLIDEALKIMAEAKRLGVKFYLPVDIVIADKFSEDAIVKYVTYQEIPDGWMGLDIG 301

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             +V    +V+  A+T++WNGP+GV+E++ F R T +++H +A+       I + GGGDT
Sbjct: 302 PASVRLFGEVLWDAQTILWNGPMGVYEMDKFSRGTFKISHEIAR----SHGIKVVGGGDT 357

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             A+  AG   E T++ST GGA LE LEGK LPG+ AL 
Sbjct: 358 ADAVQRAGDDEEMTFISTGGGASLELLEGKKLPGVAALE 396


>gi|313585890|gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
          Length = 481

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 162/396 (40%), Positives = 246/396 (62%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   +++G    +R D NVP  D + + D TRI   VPTI  L+   AKV++ +H
Sbjct: 79  KSVGDLTAAELKGKNVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVILSTH 138

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   ++ V DCIG  + + +ASL EGG++L ENVRF
Sbjct: 139 LGRPKGVTPK-YSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLENVRF 197

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 198 YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 257

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 258 VGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 317

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  
Sbjct: 318 EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD 377

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGGD++ 
Sbjct: 378 SVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSG-KGVTTIIGGGDSVA 436

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK LPG+VAL
Sbjct: 437 AVEKVGVASVMSHISTGGGASLELLEGKVLPGVVAL 472


>gi|33866859|ref|NP_898418.1| phosphoglycerate kinase [Synechococcus sp. WH 8102]
 gi|46576725|sp|Q7U3V0|PGK_SYNPX RecName: Full=Phosphoglycerate kinase
 gi|33639460|emb|CAE08844.1| phosphoglycerate kinase [Synechococcus sp. WH 8102]
          Length = 402

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/388 (40%), Positives = 241/388 (62%), Gaps = 3/388 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNEAGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K +   + CIG      + ++++G ++L ENVRF++EEE+ND 
Sbjct: 73  DAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVNAMADGDVVLLENVRFFAEEEKNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   + Y+NDAF  +HRAHAS  G++  L P+  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        +QV    ++P   + LD+G   V+  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDANSQVADVTAIPDGWMGLDIGPDAVKVFQDAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              +TV+WNGP+GVFE E F   T  +A  +A+L+  +   +I GGGD++ A+  AG+++
Sbjct: 313 GDCQTVIWNGPMGVFEFEKFATGTNAIATTLAELSG-KGCCTIIGGGDSVAAVEKAGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAALN 399


>gi|56417296|ref|YP_154370.1| phosphoglycerate kinase [Anaplasma marginale str. St. Maries]
 gi|56388528|gb|AAV87115.1| phosphoglycerate kinase [Anaplasma marginale str. St. Maries]
          Length = 385

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/388 (42%), Positives = 241/388 (62%), Gaps = 9/388 (2%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M  ++T+  +++  +RG R LLRVD+NVP   G+V D TRIERV PT+  LV+  AKV++
Sbjct: 1   MKSIKTLPWVQNSSVRGCRVLLRVDFNVPVEHGQVRDRTRIERVAPTVDYLVKAGAKVIM 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP S  D D SL  +V     +L   + FV DC G  +   + +L  G ++L EN
Sbjct: 61  VSHFGRP-SCVDADFSLEPLVGTISEVLGVPVTFVGDCFGERVCTVVNALPWGSVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RF++ EE+NDP F + L+   D Y+NDAFS +HR HASI  ++  LP+  G  +Q EL 
Sbjct: 120 LRFHAGEEKNDPAFAKQLASMADLYVNDAFSCAHRLHASIDAITKFLPAAAGLNLQDELH 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +  SE   P+ A++GG+K S+KI +L NL +KVD LV+GGG++NSFL A G  +G S
Sbjct: 180 YLGNIVSE--HPVAAVIGGAKTSSKIPMLRNLAQKVDFLVLGGGLSNSFLRASGHKIGSS 237

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + +    D VH +   A++S C +IVPRD VVAR +     T+    + V  +  I D+G
Sbjct: 238 VYE-PCDDAVHAVLESARKSNCCVIVPRDHVVARNLDCSAQTK--QNKDVGEEDCIFDIG 294

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T   + +V+ + +TV WNGP+GVFE   F   T ++   +  L KE+ + +I GGGD+
Sbjct: 295 TQTSAEVAEVLGKCKTVFWNGPMGVFERAAFATGTSDLIRNLVCLKKEKGVSTIVGGGDS 354

Query: 359 ITALAHAGISNE-FTYVSTAGGAFLEWL 385
           I A+  +G S E F+YVST GGA L++L
Sbjct: 355 IFAIKASGYSAEDFSYVSTGGGALLQFL 382


>gi|168047403|ref|XP_001776160.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162672535|gb|EDQ59071.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 475

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 162/391 (41%), Positives = 236/391 (60%), Gaps = 11/391 (2%)

Query: 12  DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           + +G    +R D NVP  D  ++ D TRI   +PTI  L +  AKVV+ SHLGRP+   +
Sbjct: 87  EFQGKVVFVRADLNVPLNDACEITDDTRIRASLPTIQHLTKAGAKVVLASHLGRPKKGPE 146

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
              SL  V      +L + +    DCIG+ +   IA+L  G ++L ENVRFY EEE+ND 
Sbjct: 147 DKFSLKPVAGRLTELLGQTVELAPDCIGAEVESKIAALKNGEVLLLENVRFYKEEEKNDS 206

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRA-----MQKELSMLESCFS 185
           +F + L++  D ++NDAF  +HRAH+S  G++     Y+G+      ++KEL+ L     
Sbjct: 207 EFSQKLAKGVDIFVNDAFGTAHRAHSSTAGIAE----YVGKTVAGFLLEKELAYLAGAVK 262

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
              +P VAIVGGSKVS+KIT++ +L+   DK+++GGGM  +F  A G  VG SL + D  
Sbjct: 263 APARPFVAIVGGSKVSSKITVIESLMNVCDKVILGGGMIFTFFKADGKDVGSSLVEDDKI 322

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYI 305
           D    +   AK+   E+I+P DV  A +      TQV S+ ++P   + LD+G K ++  
Sbjct: 323 DLAKDLVALAKKKGVELILPVDVTAADKFSPEANTQVCSSSNIPAGWMGLDIGPKAIDQF 382

Query: 306 KQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHA 365
           +  +  A+TV+WNGP+GVFE E F   T  VA  +A LTKE   I+I GGGD++ A+  A
Sbjct: 383 QDALKGAKTVLWNGPMGVFEFEKFADGTTAVAKTLAGLTKE-GAITIIGGGDSVAAVEKA 441

Query: 366 GISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           G++++ ++VST GGA LE LEGK LPG+ AL
Sbjct: 442 GLADQMSHVSTGGGASLELLEGKVLPGVAAL 472


>gi|295696726|ref|YP_003589964.1| Phosphoglycerate kinase [Bacillus tusciae DSM 2912]
 gi|295412328|gb|ADG06820.1| Phosphoglycerate kinase [Bacillus tusciae DSM 2912]
          Length = 399

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/392 (39%), Positives = 240/392 (61%), Gaps = 6/392 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ +++G R  +RVD+NVP  DG+V D  RI   +PTI  L+   A++++ SHLGRP
Sbjct: 5   TIRDV-EVQGKRVFVRVDFNVPIEDGRVVDDGRIRAALPTIEYLIRGGARLILASHLGRP 63

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + + D+   L  V      +L + +  V+  +G  + Q++A +  G ++L ENVRF   E
Sbjct: 64  KGRVDERYRLDPVARRLRELLGRPVHKVDAVVGPEVEQAVAGMGPGDVLLLENVRFEPGE 123

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
           E+NDP   R  +   D Y+NDAF  +HRAHAS  GL+  LP+  G  M++EL++L    S
Sbjct: 124 EKNDPALARAWAGLADLYVNDAFGAAHRAHASTAGLAQFLPAVAGLLMERELTVLARALS 183

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             + P  A++GG+KVS KI ++  L++KVD+L+IGGGMAN+FL A+G  +G S  + D  
Sbjct: 184 HPEHPFAAVLGGAKVSDKIGVVARLLEKVDRLLIGGGMANTFLAARGYRMGSSSVEEDRL 243

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGFKTVEY 304
           +   +    A+     +++P D+V+A         + V  ++ VP   + LD+G +TVE 
Sbjct: 244 ETARETLRAAEGRGTALLLPVDLVIADRFSADAQRRTVRVEAGVPEGWMALDIGPETVER 303

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + ++A A TV+WNGP+GVFE+EPF   T+ VA  +A +    +  +I GGGD+  A+  
Sbjct: 304 FRAMLADAHTVIWNGPMGVFEMEPFAAGTLAVAQAMAGV----KGTTIVGGGDSAAAVTK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            G++   T+VST GGA LE+LEG+ LPG+ AL
Sbjct: 360 MGLAERMTHVSTGGGASLEFLEGRVLPGVAAL 391


>gi|222055980|ref|YP_002538342.1| phosphoglycerate kinase [Geobacter sp. FRC-32]
 gi|254782204|sp|B9M2C3|PGK_GEOSF RecName: Full=Phosphoglycerate kinase
 gi|221565269|gb|ACM21241.1| Phosphoglycerate kinase [Geobacter sp. FRC-32]
          Length = 399

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 158/392 (40%), Positives = 234/392 (59%), Gaps = 5/392 (1%)

Query: 7   MNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           +++++D+R     +RVD+NVP  D G + + TRI   VPTI   +E  AKV++ SHLGRP
Sbjct: 6   IDEIKDLREKLVFIRVDFNVPQDDNGNITEDTRIVGAVPTIKYAIENGAKVILASHLGRP 65

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +     ++         +L K +    DC G  +   +A+L  G +++ ENVRFY  E
Sbjct: 66  KGEKKPKYTMAPAARRLSELLGKEVKQATDCFGPDVDAMVAALQPGDVLMLENVRFYPGE 125

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLESCF 184
           E+NDPDF   L+   + Y+NDAF+VSHRAHAS+  ++  +P    G  M+ E++  E   
Sbjct: 126 EKNDPDFACKLANGCEIYVNDAFAVSHRAHASVHAITKCIPVIAAGFLMKNEMTFFEKAM 185

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           +   +PL AI+GG+KVS K+ +L  LV KVD ++IGGGMA +FL A+G+ VG+SL + D 
Sbjct: 186 TRPVRPLAAILGGAKVSGKLEVLETLVGKVDIIIIGGGMAFTFLKARGLSVGKSLVEDDL 245

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +I   A +   E ++P D VVA         + VS   +P + + LDVG  +   
Sbjct: 246 IDTAKRILDNAAKRGIEFLLPEDCVVADRFAADADCKTVSVNDIPSEWMALDVGPASTAR 305

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
               + +A TV+WNGP+GVFE++ F + T  +A  VA L     II   GGGDT +A+  
Sbjct: 306 FSDALKEANTVIWNGPMGVFEMDRFAKGTFAIADVVAGLKNATTII---GGGDTDSAVRK 362

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AG++++ +Y+ST GGAFLE LEGK LPG+  L
Sbjct: 363 AGVADKVSYISTGGGAFLELLEGKKLPGVEVL 394


>gi|194337872|ref|YP_002019666.1| Phosphoglycerate kinase [Pelodictyon phaeoclathratiforme BU-1]
 gi|238693426|sp|B4SHF6|PGK_PELPB RecName: Full=Phosphoglycerate kinase
 gi|194310349|gb|ACF45049.1| Phosphoglycerate kinase [Pelodictyon phaeoclathratiforme BU-1]
          Length = 397

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/395 (42%), Positives = 250/395 (63%), Gaps = 4/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++++D+  I+G R L+RVD+NVP   + K+ D  RI   +P+I +++E   ++++ SHLG
Sbjct: 4   KSLSDIA-IQGKRVLMRVDFNVPLDSNKKITDDKRIIESLPSIKKVLENGGRLILMSHLG 62

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + D SL  V +    +L   +    +CIG+   Q + +L +G +IL EN+RF+ 
Sbjct: 63  RPKGKVNADYSLAPVATRLAELLDCPVTMAKECIGTETMQQVLALQDGEVILLENLRFHP 122

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLES 182
           EEE NDPDF R L+  G+ Y+NDAF  +HRAHAS  G++H + + + G  +++EL  L  
Sbjct: 123 EEEANDPDFARELASLGEVYVNDAFGTAHRAHASTEGITHYVQTAVAGFLIERELLYLGK 182

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
              E ++P VAI+GGSK+S KI +L NL KKVD ++IGG M  +F  AQG  +G SL + 
Sbjct: 183 ALQEPERPFVAILGGSKISGKIDVLENLFKKVDTVLIGGAMVFTFFKAQGYEIGNSLVEE 242

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              +   +I  EAK    ++++P DV+VA E+            ++P + I +D+G  T 
Sbjct: 243 SKIELALKILDEAKNKGIKLLLPVDVIVAPEISATADCHSEMITAIPEEMIGVDIGPLTA 302

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E  +  I  ARTV+WNGP+GVFEI+ F   T+ VA  +A+ T E    +I GGGD+  A+
Sbjct: 303 EIYRNEILSARTVLWNGPMGVFEIDNFAAGTMAVAQAMAEATAEGA-TTIIGGGDSAAAV 361

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A AG++NE T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 362 AKAGLANEMTHISTGGGASLEFLEGKELPGIAALN 396


>gi|129915|sp|P12782|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|21833|emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 gi|3293043|emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
          Length = 480

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 245/396 (61%), Gaps = 6/396 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSH 61
           +++ DL   D+ G R L+R D NVP  D + + D TRI   +PTI  L+   AKV++ SH
Sbjct: 76  KSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVILTSH 135

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+  + K  SL  +V     +L   +    D IG  + + +A L+ G ++L ENVRF
Sbjct: 136 LGRPKGVTPK-FSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLENVRF 194

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSML 180
           Y EEE+NDP+F + L+   D ++NDAF  +HRAHAS  G++  L PS  G  +QKEL  L
Sbjct: 195 YKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 254

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +   S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL 
Sbjct: 255 DGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 314

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK     +++P DV++A +      +Q V A ++P   + LD+G  
Sbjct: 315 EEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASAIPDGWMGLDIGPD 374

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+     +   +T++WNGP+GVFE + F   T  +A  +A+L+K + + +I GGGD++ 
Sbjct: 375 SVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSK-KGVTTIIGGGDSVA 433

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 434 AVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 469


>gi|193214500|ref|YP_001995699.1| phosphoglycerate kinase [Chloroherpeton thalassium ATCC 35110]
 gi|238692709|sp|B3QWD9|PGK_CHLT3 RecName: Full=Phosphoglycerate kinase
 gi|193087977|gb|ACF13252.1| Phosphoglycerate kinase [Chloroherpeton thalassium ATCC 35110]
          Length = 397

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 158/396 (39%), Positives = 245/396 (61%), Gaps = 3/396 (0%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           + +T++D+    G R L+RVD+NVP  DG V D  RI   +P+I +++     V++ SHL
Sbjct: 2   KKKTVDDVS-FAGKRVLMRVDFNVPLKDGAVTDDIRIRGALPSIQKVLSDGGCVILMSHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K   + SL         +L K +    DCIG  +    A++  G +++ EN+RF+
Sbjct: 61  GRPKGKPVAEMSLKPAADRLAELLGKPVQMAPDCIGDEVKNMAAAMKAGDVLMLENLRFH 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLS-HLLPSYIGRAMQKELSMLE 181
            EEE NDP+F + L+  G+ ++NDAF  +HRAHAS  G++ ++  S  G  + KEL+ L 
Sbjct: 121 KEEEANDPEFAKSLASLGEVFVNDAFGTAHRAHASTEGVTNYVAESVAGYLIGKELTYLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +   +P VAI+GG+K+S KI +L NL+ KVD +++GG M  +F  AQG  +G+SL +
Sbjct: 181 EATANPVRPFVAILGGAKISGKIDVLENLLGKVDTVLVGGAMVFTFFKAQGYNIGKSLVE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +    I  +AK S  + ++P DVV+A +      T++ +  S+  D + LD+G +T
Sbjct: 241 DDKLELAKSILEKAKTSGVKFLLPTDVVLADKFDQDANTKIATIDSIEDDWMGLDIGPET 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
               ++ +  A+TV+WNGP+GVFE+E F + T+ VA  +A  TK+   I++ GGGD+  A
Sbjct: 301 ANCFREEVVNAKTVIWNGPMGVFEMEKFAKGTMAVAQALADATKQGA-ITVIGGGDSAAA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +A AG+ +  T+VST GGA LE+LEGK+LPGI ALS
Sbjct: 360 IAVAGLEDSVTHVSTGGGASLEFLEGKELPGIAALS 395


>gi|87123533|ref|ZP_01079384.1| Phosphoglycerate kinase [Synechococcus sp. RS9917]
 gi|86169253|gb|EAQ70509.1| Phosphoglycerate kinase [Synechococcus sp. RS9917]
          Length = 402

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 244/387 (63%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLLGKGAKVILAAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           +   L  V +    +L K ++  + CIG      +A+++ G ++L ENVRF++EEE+ND 
Sbjct: 73  EGMRLTPVAARLGELLGKPVVKTDSCIGPDAEAKVAAMANGDVVLLENVRFFAEEEKNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   D Y+NDAF  +HRAHAS  G++  L P+  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAGLADVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEDDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +A     ++++P DVV+A        +QV S  ++P   + LD+G  +++  ++ +
Sbjct: 253 ELEAKAAAKGVQLLLPTDVVLADNFAPDANSQVASINAIPDGWMGLDIGPDSIKVFQEAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A L+  +   +I GGGD++ A+  AG+++
Sbjct: 313 ADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSG-KGCCTIIGGGDSVAAVEKAGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|218900259|ref|YP_002448670.1| phosphoglycerate kinase [Bacillus cereus G9842]
 gi|228903611|ref|ZP_04067732.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 4222]
 gi|228910946|ref|ZP_04074755.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 200]
 gi|228968218|ref|ZP_04129217.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|229032750|ref|ZP_04188710.1| Phosphoglycerate kinase [Bacillus cereus AH1271]
 gi|226699791|sp|B7IP23|PGK_BACC2 RecName: Full=Phosphoglycerate kinase
 gi|218541560|gb|ACK93954.1| phosphoglycerate kinase [Bacillus cereus G9842]
 gi|228728577|gb|EEL79593.1| Phosphoglycerate kinase [Bacillus cereus AH1271]
 gi|228791481|gb|EEM39084.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228848897|gb|EEM93742.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 200]
 gi|228856040|gb|EEN00579.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 4222]
          Length = 394

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 236/386 (61%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SHLGRP+ ++ +
Sbjct: 10  DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQAVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRFY+ EE+ND +
Sbjct: 70  ELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+ D  +   + 
Sbjct: 190 TAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCEDDKIELAKEF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK       +P DVV+  E      TQ+V   S+P +   +D+G KT E    VI  
Sbjct: 250 MQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSNWEGVDIGPKTREIYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAAVEKFGMADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+V L+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVVCLN 392


>gi|317123044|ref|YP_004103047.1| phosphoglycerate kinase [Thermaerobacter marianensis DSM 12885]
 gi|315593024|gb|ADU52320.1| phosphoglycerate kinase [Thermaerobacter marianensis DSM 12885]
          Length = 437

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/395 (38%), Positives = 245/395 (62%), Gaps = 8/395 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           R R++ DL ++RG R L+R D+NVP   G++ D TRI   +PT+  L+E+ A V++ SHL
Sbjct: 2   RKRSVRDL-EVRGRRVLVRADFNVPLEGGRITDDTRIRAALPTVRYLLEQGAAVILCSHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ K  ++  L  V    E +L + +  + + +G  + + +A L  G + L EN+RF+
Sbjct: 61  GRPKGKVVEELRLAPVARRLEELLGRPVRALTEVVGPEVERRLADLEPGQVALLENLRFH 120

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             E  NDP F   L+R  + Y+NDAF  +HRAHAS+ G++  LP+  G  +++EL +L S
Sbjct: 121 PGETANDPAFAEALARLAEVYVNDAFGAAHRAHASVVGVAERLPAAAGFLLERELEVLGS 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
              + ++P  A++GG+KVS KI ++  L++  D L IGG MAN+ LVA+G  VGRSL + 
Sbjct: 181 LLEKPRRPFWAVLGGAKVSDKIGVIQRLLEICDGLAIGGAMANTLLVARGFAVGRSLYEP 240

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           +  +   +  W  + +   +++P D+VV   ++ G  ++VV    +P +++ +DVG  T+
Sbjct: 241 EQVEPARR--W-LEAAGDRLLLPADLVVTERLEPGASSRVVPVDRIPAEAMAVDVGPATL 297

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              ++ +  A TV WNGPLGVFE+EPF R T  +A ++A L      +++ GGGD++ A+
Sbjct: 298 AAWQERLGAAGTVFWNGPLGVFEVEPFHRGTFALAEFLAGLDA----VTVVGGGDSVAAV 353

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              G+++   ++ST GGA LE+LEGK+LPG+  L 
Sbjct: 354 RRTGVADRIDHISTGGGASLEFLEGKELPGVAVLP 388


>gi|159901356|ref|YP_001547603.1| phosphoglycerate kinase [Herpetosiphon aurantiacus ATCC 23779]
 gi|229620379|sp|A9B312|PGK_HERA2 RecName: Full=Phosphoglycerate kinase
 gi|159894395|gb|ABX07475.1| Phosphoglycerate kinase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 394

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 240/391 (61%), Gaps = 7/391 (1%)

Query: 10  LRDI--RGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQ 66
           +RD+   G R L+RVD+NVP     KV D TRI   +PTI  L+E+ A V++ SHLGRP+
Sbjct: 6   IRDVAWSGKRALVRVDFNVPLDQARKVTDDTRIRAALPTINYLLEQGASVILMSHLGRPK 65

Query: 67  SKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEE 126
            K  ++  L  V    +S+L   + ++    G+    +  +L  G ++L EN RF   EE
Sbjct: 66  KKVAEEFRLKPVADHLQSLLDAPVNYIQTTTGAEAEAAAQALQAGQVLLLENTRFDPREE 125

Query: 127 RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSE 186
            NDP     L++ GD Y+NDAF  +HRAHAS  GL+  LP+  G  M+ EL+ L     +
Sbjct: 126 SNDPAMAEELAKLGDIYVNDAFGAAHRAHASTEGLAKFLPAVAGFLMEAELAALGKALDD 185

Query: 187 SKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSD 246
            ++P V I+GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+AQ   VG SL + D   
Sbjct: 186 PQRPFVTIIGGAKISDKIGVIENLLGKVDSLLIGGGMANTFLLAQNKAVGASLVEADSVA 245

Query: 247 NVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIK 306
              ++  EA+    ++++P DVVVA        TQV+S   VP    ILD+G +T +   
Sbjct: 246 EAGRLIDEAQGRGVKLLLPSDVVVADAFSAEANTQVLSIDDVPDGWRILDIGPETRQTYS 305

Query: 307 QVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAG 366
           QV+++A+TV+WNGP+GVFE+EPF   T  VA  +A    +   I+I GGGD++ A+   G
Sbjct: 306 QVVSEAKTVIWNGPMGVFELEPFAAGTRAVAQALA----DSSAITIIGGGDSVAAIEQMG 361

Query: 367 ISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++ + +++ST GGA LE LEGK LPGI AL+
Sbjct: 362 LAEKMSHISTGGGASLELLEGKVLPGIAALN 392


>gi|297588468|ref|ZP_06947111.1| phosphoglycerate kinase [Finegoldia magna ATCC 53516]
 gi|297573841|gb|EFH92562.1| phosphoglycerate kinase [Finegoldia magna ATCC 53516]
          Length = 395

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 162/392 (41%), Positives = 242/392 (61%), Gaps = 9/392 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ DL ++   R L+RVD+NVP  DG + D  RIE  + TI  L++  AKV++ SHLGR
Sbjct: 4   KTLKDL-NVENKRVLVRVDFNVPIKDGIITDTNRIEASIATIKYLIDNNAKVILMSHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFV-NDCI--GSTLSQSIASLSEGGIILAENVRF 121
           P+ +   + SL  V      IL + + FV ND +   S + QS   L    I+L +N R+
Sbjct: 63  PKGEPKPEFSLKPVAEKLSEILGQEVKFVDNDKVVDNSVIEQS-KQLQPKEIMLIQNTRY 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EEE+ND +F + LS+  D Y+NDAF  SHRAHAS  G+S  LPS +G  +QKE+ ++ 
Sbjct: 122 RKEEEKNDEEFSKELSQLADLYVNDAFGTSHRAHASNVGVSKFLPSAVGFLVQKEIEIMG 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + ++P  AI+GG+KVS KI ++ NL++KVD ++IGG MA +F+ +QG  VG+SL +
Sbjct: 182 KALEDPERPFTAILGGAKVSDKIGVIENLLEKVDTILIGGAMAYTFIKSQGKNVGKSLIE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D    +  +A+    +I +P D V A+EM     ++V+       D    D+G KT
Sbjct: 242 EDKLDLAKSLLEKAQEKGVKIFLPVDFVAAKEMTEESDSKVIGVDEFTDDIAGFDIGTKT 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++   + I +++TV+WNGP+GVFEI+ F + T EVA+ + K        +I GGGD+ +A
Sbjct: 302 IKIFDEEIQKSKTVVWNGPMGVFEIKQFSKGTFEVANSLVK----SDATTIVGGGDSASA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGI 393
           +A +G  ++ T+VST GGA LE+LEGK LPGI
Sbjct: 358 IAKSGNKDKVTHVSTGGGASLEFLEGKVLPGI 389


>gi|329928012|ref|ZP_08282016.1| phosphoglycerate kinase [Paenibacillus sp. HGF5]
 gi|328938116|gb|EGG34513.1| phosphoglycerate kinase [Paenibacillus sp. HGF5]
          Length = 393

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 154/386 (39%), Positives = 226/386 (58%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           ++ G R  +RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH+GRP+ +  +
Sbjct: 10  EVSGKRVFVRVDFNVPLEDGKITDDTRIRETLPTIKYLVEQGAKVILASHMGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L         +L K +   ++ +G  +   +  L  G +++ ENVRFY  EE+NDP+
Sbjct: 70  SLRLTPASQRLSELLGKPVAKADEAVGEAVKAQVEKLQNGDVLVLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L    S   +P 
Sbjct: 130 LTKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELSVLGKALSNPDRPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  ++  D     
Sbjct: 190 TAIIGGSKVKDKIDVIDNLLTLADNVIIGGGLAYTFFKAQGHEIGQSLLDKEKLDVALGF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK       +P D+VV  E      T+VV    +P D   +D+G KT     +VI  
Sbjct: 250 IEKAKELGKNFYLPEDIVVTDEFSADANTKVVDIDGIPADWEGVDIGPKTRAKYAEVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFEI PF   T EVA   A    E    +I GGGD+  A    G++++ 
Sbjct: 310 SKLVVWNGPMGVFEIAPFSNGTREVAQACA----ETEAYTIIGGGDSAAAAEKFGLADKM 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
            ++ST GGA LE++EGK LPG+VAL+
Sbjct: 366 DHISTGGGASLEFMEGKALPGVVALN 391


>gi|116074041|ref|ZP_01471303.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
 gi|116069346|gb|EAU75098.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
          Length = 401

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 240/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K ++  + CIG      + ++++G ++L ENVRF++EEE+ND 
Sbjct: 73  DSMRLTPVAARLSELLGKPVVKTDSCIGPDAEAKVGAMADGDVVLLENVRFFAEEEKNDA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   + Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+      K+
Sbjct: 133 GFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPSVGGFLMEKELQYLQGAIDAPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK+++GGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLEALMDKCDKILVGGGMIFTFYKARGLAVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK    E+++P DVV+A        +Q     ++P   + LD+G  +V+  +  +
Sbjct: 253 ELEAKAKAKGVELLLPTDVVLADNFAPDANSQTAPVTAIPDGWMGLDIGPDSVKVFQNAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A L+  +   +I GGGD++ A+  AG+++
Sbjct: 313 ADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSG-KGCCTIIGGGDSVAAVEKAGLAD 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|45657939|ref|YP_002025.1| phosphoglycerate kinase [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|52783763|sp|P62414|PGK_LEPIC RecName: Full=Phosphoglycerate kinase
 gi|45601180|gb|AAS70662.1| phosphoglycerate kinase [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 396

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 157/385 (40%), Positives = 240/385 (62%), Gaps = 4/385 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D+ G R  LRVD+NVP  +GKV D TRIE+ +PTI  L++K A+++I SHLGRP+ + + 
Sbjct: 10  DLSGKRVFLRVDFNVPVENGKVTDKTRIEKTLPTIELLIKKGARIIIASHLGRPKGQVNP 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           + SL  VV   +S++   + F    IG    +    L  G I++ ENVRF+ EEE NDP 
Sbjct: 70  EFSLAPVVETFQSLVKSKVYFSKTVIGEDAIKLSKELKNGEILVIENVRFHKEEEENDPG 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
           F + L+   D Y+NDAF  +HRAH+S  G++ LLP+Y G  M KE+  L +   +  +P 
Sbjct: 130 FSKKLAALADIYVNDAFGAAHRAHSSTEGIARLLPAYAGLLMHKEILELSALLHKPARPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
           VAI+GGSKVSTKI +L NL  KV+ L+IGGGMA +FL ++ + +G SL +++F     Q+
Sbjct: 190 VAIIGGSKVSTKIKVLTNLFDKVNHLLIGGGMAYTFLKSRAIPIGNSLVEKEFEVQAFQL 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +A  +  ++ +P D ++  +      T+ V    +    + +D+G KTV   +++I  
Sbjct: 250 IEKAGVAGIDLQLPVDHIIGDQFNEKAKTKSVDKMGILDGWMGMDIGSKTVSNYEKIIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           A T+ WNGP+GVFE++ F   T+ +A  VAK        ++ GGGD+I A+  A ++++ 
Sbjct: 310 AGTIFWNGPMGVFEMDKFASGTMAIAKAVAKSKA----KTVVGGGDSIAAINKARVADKI 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVAL 396
           T++ST GGA LE++EG+ LPG+ AL
Sbjct: 366 THISTGGGASLEFMEGRKLPGVEAL 390


>gi|315644537|ref|ZP_07897669.1| Phosphoglycerate kinase [Paenibacillus vortex V453]
 gi|315280044|gb|EFU43341.1| Phosphoglycerate kinase [Paenibacillus vortex V453]
          Length = 393

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 153/386 (39%), Positives = 227/386 (58%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           ++ G R  +RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH+GRP+ +  +
Sbjct: 10  EVSGKRVFVRVDFNVPLEDGKITDDTRIRETLPTINYLVEQGAKVILASHMGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L         +L K +   ++ +G  +   +  L  G +++ ENVRFY  EE+NDP+
Sbjct: 70  SLRLTPASERLSELLGKPVAKADEAVGEAVKAQVNQLQNGDVLVLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L    S   +P 
Sbjct: 130 LAKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELSVLGKALSNPDRPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  ++  D     
Sbjct: 190 TAIIGGSKVKDKIDVIDNLLTLADNVIIGGGLAYTFFKAQGHEIGQSLLDKEKLDVALGF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK       +P D+VV  E      T++V    +P D   +D+G KT     +VI  
Sbjct: 250 IEKAKELGKNFYLPEDIVVTDEFSADANTKIVGIDGIPADWEGVDIGPKTRAKYAEVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFEI PF   T EVA   A    E    +I GGGD+  A    G++++ 
Sbjct: 310 SKLVVWNGPMGVFEIAPFSNGTREVAQACA----ETEAYTIIGGGDSAAAAEKFGLADKM 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
            ++ST GGA LE++EGK+LPG+VAL+
Sbjct: 366 DHISTGGGASLEFMEGKELPGVVALN 391


>gi|261404073|ref|YP_003240314.1| phosphoglycerate kinase [Paenibacillus sp. Y412MC10]
 gi|261280536|gb|ACX62507.1| Phosphoglycerate kinase [Paenibacillus sp. Y412MC10]
          Length = 393

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 154/386 (39%), Positives = 226/386 (58%), Gaps = 4/386 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           ++ G R  +RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH+GRP+ +  +
Sbjct: 10  EVSGKRVFVRVDFNVPLEDGKITDDTRIRETLPTIKYLVEQGAKVILASHMGRPKGEVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
              L         +L K +   ++ +G  +   +  L  G +++ ENVRFY  EE+NDP+
Sbjct: 70  SLRLTPASQRLSELLGKPVAKADEAVGEAVKAQVEKLQNGDVLVLENVRFYPGEEKNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L    S   +P 
Sbjct: 130 LAKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELSVLGKALSNPDRPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  ++  D     
Sbjct: 190 TAIIGGSKVKDKIDVIDNLLTLADNVIIGGGLAYTFFKAQGHEIGQSLLDKEKLDVALGF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
             +AK       +P D+VV  E      T+VV    +P D   +D+G KT     +VI  
Sbjct: 250 IEKAKELGKNFYLPEDIVVTDEFSADANTKVVDIDGIPADWEGVDIGPKTRAKYAEVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFEI PF   T EVA   A    E    +I GGGD+  A    G++++ 
Sbjct: 310 SKLVVWNGPMGVFEIAPFSNGTREVAQACA----ETEAYTIIGGGDSAAAAEKFGLADKM 365

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
            ++ST GGA LE++EGK LPG+VAL+
Sbjct: 366 DHISTGGGASLEFMEGKALPGVVALN 391


>gi|78213967|ref|YP_382746.1| phosphoglycerate kinase [Synechococcus sp. CC9605]
 gi|123577418|sp|Q3AGU1|PGK_SYNSC RecName: Full=Phosphoglycerate kinase
 gi|78198426|gb|ABB36191.1| Phosphoglycerate kinase [Synechococcus sp. CC9605]
          Length = 401

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 154/387 (39%), Positives = 240/387 (62%), Gaps = 3/387 (0%)

Query: 12  DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV++ +H GRP+ + +
Sbjct: 13  DLSGKRVLVRVDFNVPLNDTGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVN 72

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
               L  V +    +L K +   + CIG      + +++ G ++L ENVRF++EEE+N+ 
Sbjct: 73  DAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMANGDVVLLENVRFFAEEEKNEA 132

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
            F   L+   + Y+NDAF  +HRAHAS  G++  L PS  G  M+KEL  L+    E K+
Sbjct: 133 GFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKELQYLQGAVDEPKR 192

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG+SL + D  +   
Sbjct: 193 PLAAIVGGSKVSSKIGVLDTLIDKCDKVLIGGGMIFTFYKARGLSVGKSLVEEDKLELAK 252

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +AK +  ++++P DVV+A        +Q     ++P   + LD+G  +++  ++ +
Sbjct: 253 ELEAKAKANGVQLLLPTDVVLADNFAPDANSQTADINAIPDGWMGLDIGPDSIKVFQEAL 312

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
           A  +TV+WNGP+GVFE + F   T  +A  +A L+  +   +I GGGD++ A+  AG++ 
Sbjct: 313 ADCQTVIWNGPMGVFEFDKFATGTNSIATTLADLSG-KGCCTIIGGGDSVAAVEKAGLAE 371

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + +++ST GGA LE LEGK LPG+ AL
Sbjct: 372 KMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|317052403|ref|YP_004113519.1| phosphoglycerate kinase [Desulfurispirillum indicum S5]
 gi|316947487|gb|ADU66963.1| Phosphoglycerate kinase [Desulfurispirillum indicum S5]
          Length = 395

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 236/387 (60%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D +G R  +RVD+NVP  DG V D TRIE  VPT+  +     KV++ SHLGRP+ K D 
Sbjct: 10  DFQGKRVFVRVDFNVPIKDGVVQDATRIEAAVPTVEYIAGMGGKVILASHLGRPKGKPDA 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
             SL  V +     + + ++FV DC+G  + Q++AS+  G ++L EN RFY EEE+NDP+
Sbjct: 70  TFSLEPVAAELAKRMGRPVVFVPDCVGPKVVQAVASMRAGDVVLLENTRFYREEEQNDPE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSMLESCFSESKKP 190
           F R L+ + D Y+ DAF  +HRAHAS  G++  +   + G  M+KEL  L    S+++ P
Sbjct: 130 FSRKLAESADIYVCDAFGSAHRAHASTAGMTAYIAQRVTGFLMEKELEYLSVRISQAEAP 189

Query: 191 LVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQ 250
            VAI+GG+KVS KI ++ NL  KV  ++IGG MA +FL AQG+  G+S+ +    +   Q
Sbjct: 190 FVAILGGAKVSDKIPVIENLFDKVHHIIIGGAMAYTFLSAQGIRTGKSMVEESMKEYSLQ 249

Query: 251 IAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIA 310
           +   A+R   ++ +P D V  RE        +     +P   + LD+G +T +  +++IA
Sbjct: 250 LLATAQRKGVKVHLPVDHVAGREFSEVTEKLITPDAHIPDGYMGLDIGPRTRQAFQEIIA 309

Query: 311 QARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNE 370
           +ARTV+WNGP+GVFE + F   T  +A  +A  T    I+   GGGD+++A+  +G+++ 
Sbjct: 310 EARTVLWNGPMGVFEWQSFAEGTFAIAAAMANNTAATTIV---GGGDSVSAIQQSGLADR 366

Query: 371 FTYVSTAGGAFLEWLEGKDLPGIVALS 397
            +++ST GGA LE L G DLPG+  LS
Sbjct: 367 VSHISTGGGASLELLSGVDLPGVACLS 393


>gi|229164075|ref|ZP_04292012.1| Phosphoglycerate kinase [Bacillus cereus R309803]
 gi|228619458|gb|EEK76347.1| Phosphoglycerate kinase [Bacillus cereus R309803]
          Length = 394

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 235/386 (60%), Gaps = 3/386 (0%)

Query: 12  DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDK 71
           D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SHLGRP+ +  +
Sbjct: 10  DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVE 69

Query: 72  DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPD 131
           +  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRFY+ EE+ND +
Sbjct: 70  EMRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAE 129

Query: 132 FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPL 191
             +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L    S  ++P 
Sbjct: 130 LAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLGKALSNPERPF 189

Query: 192 VAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQI 251
            AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+ D  +   + 
Sbjct: 190 TAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCENDKIELAKEF 249

Query: 252 AWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQ 311
              AK       +P DVV+  E      TQ+V   S+P     +D+G KT E    VI  
Sbjct: 250 MQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSTWEGVDIGPKTREIYADVIKN 309

Query: 312 ARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEF 371
           ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A+   G++++ 
Sbjct: 310 SKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAAVEKFGMADKM 366

Query: 372 TYVSTAGGAFLEWLEGKDLPGIVALS 397
           +++ST GGA LE++EGK+LPG+V L+
Sbjct: 367 SHISTGGGASLEFMEGKELPGVVCLN 392


>gi|94265672|ref|ZP_01289412.1| Phosphoglycerate kinase [delta proteobacterium MLMS-1]
 gi|93453799|gb|EAT04168.1| Phosphoglycerate kinase [delta proteobacterium MLMS-1]
          Length = 393

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 239/394 (60%), Gaps = 8/394 (2%)

Query: 7   MNDLRDI--RGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           M ++RDI  RG R L+RVD+NVP  + G + D  RI  V+PTI   +++ A V+I SH+G
Sbjct: 1   MKNIRDIDIRGKRVLIRVDFNVPIDEQGNITDDIRIRGVLPTINHALDENAAVIICSHMG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL         +L K +    DC+G  +++  A+L+ G ++L EN+RF+ 
Sbjct: 61  RPKGERRPEFSLAPAARRLSRLLDKEVKLAPDCVGPEVAEMAAALAPGEVLLLENLRFHP 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSMLES 182
           EE+ ND  F R L+   + YINDAF+V+HRAHAS+ G+    P+   G  +QKE+     
Sbjct: 121 EEQANDEKFSRELAALAEVYINDAFAVAHRAHASVVGIPRFAPAKGAGFLLQKEMDYFHR 180

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                 +PL AI+GGSKVS+K+  L NL+ +VDK++IGG MAN+FL +QG+ VGRS  + 
Sbjct: 181 SVGNPMRPLAAIIGGSKVSSKLGALTNLMDRVDKMLIGGAMANTFLRSQGLDVGRSKVED 240

Query: 243 DFSDNVHQ