PSIBLAST alignment of GI: 254780653 and protein with PDB id: 2wzb

>gi|294662288|pdb|2WZB|A Chain A, The Catalytically Active Fully Closed Conformation Of Human Phosphoglycerate Kinase In Complex With Adp, 3pg And Magnesium Trifluoride Length = 416
>gi|294662289|pdb|2WZC|A Chain A, The Catalytically Active Fully Closed Conformation Of Human Phosphoglycerate Kinase In Complex With Adp, 3pg And Aluminium Tetrafluoride Length = 416
 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 150/416 (36%), Positives = 234/416 (56%), Gaps = 22/416 (5%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFS 60
           S   T++ L D++G R ++RVD+NVP  + ++ +  RI+  VP+I   ++  AK VV+ S
Sbjct: 3   SNKLTLDKL-DVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMS 61

Query: 61  HLGRPQSKSDK-DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLGRP         SL  V    +S+L K++LF+ DC+G  + ++ A+ + G +IL EN+
Sbjct: 62  HLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENL 121

Query: 120 RFY---------------SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL 164
           RF+                 E      F   LS+ GD Y+NDAF  +HRAH+S+ G++  
Sbjct: 122 RFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLP 181

Query: 165 LPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMA 224
                G  M+KEL+         ++P +AI+GG+KV+ KI L+ N++ KV++++IGGGMA
Sbjct: 182 Q-KAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMA 240

Query: 225 NSFLV-AQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV 283
            +FL     M +G SL   + +  V  +  +A+++  +I +P D V A +      T   
Sbjct: 241 FTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQA 300

Query: 284 SAQS-VPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAK 342
           +  S +P   + LD G ++ +   + + +A+ ++WNGP+GVFE E F R T  +   V K
Sbjct: 301 TVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVK 360

Query: 343 LTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            T  R  I+I GGGDT T  A     ++ ++VST GGA LE LEGK LPG+ ALS 
Sbjct: 361 AT-SRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 415