BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780653|ref|YP_003065066.1| phosphoglycerate kinase
[Candidatus Liberibacter asiaticus str. psy62]
         (400 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|312127544|ref|YP_003992418.1| triosephosphate isomerase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777563|gb|ADQ07049.1| triosephosphate isomerase [Caldicellulosiruptor hydrothermalis 108]
          Length = 650

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 162/399 (40%), Positives = 247/399 (61%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + E  ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKERDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|312875920|ref|ZP_07735910.1| triosephosphate isomerase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797401|gb|EFR13740.1| triosephosphate isomerase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 650

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 248/399 (62%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|312622371|ref|YP_004023984.1| triosephosphate isomerase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202838|gb|ADQ46165.1| triosephosphate isomerase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 650

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 248/399 (62%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMRKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|312793583|ref|YP_004026506.1| triosephosphate isomerase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180723|gb|ADQ40893.1| triosephosphate isomerase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 650

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 248/399 (62%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|302871797|ref|YP_003840433.1| triosephosphate isomerase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574656|gb|ADL42447.1| triosephosphate isomerase [Caldicellulosiruptor obsidiansis OB47]
          Length = 650

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 248/399 (62%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|222529394|ref|YP_002573276.1| bifunctional phosphoglycerate kinase/triosephosphate isomerase
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222456241|gb|ACM60503.1| triosephosphate isomerase [Caldicellulosiruptor bescii DSM 6725]
          Length = 650

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 248/399 (62%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + EG ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|312135204|ref|YP_004002542.1| triosephosphate isomerase [Caldicellulosiruptor owensensis OL]
 gi|311775255|gb|ADQ04742.1| triosephosphate isomerase [Caldicellulosiruptor owensensis OL]
          Length = 650

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 164/399 (41%), Positives = 251/399 (62%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M +L  +T+ D+ D+ G R L+RVD+NVP   +G + D  RI+  +PTI  L++  AKV+
Sbjct: 1   MPKLNKKTIRDI-DVAGKRVLVRVDFNVPQDENGNITDDRRIKEALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +A + EG ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVAQMKEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASVADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI +++NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVIMNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|146296957|ref|YP_001180728.1| phosphoglycerate kinase., Triose-phosphate isomerase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410533|gb|ABP67537.1| phosphoglycerate kinase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 650

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 162/399 (40%), Positives = 247/399 (61%), Gaps = 4/399 (1%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M RL  +T+ D+ D+ G + L+RVD+NVP   +G + D  RI   +PTI  L++  AKV+
Sbjct: 1   MPRLNKKTIRDI-DVSGKKVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ K D   S+  V      +L K ++   D IG    + +  + E  ++L E
Sbjct: 60  LVSHLGRPKGKFDPKYSMAPVAKRLSELLSKEVILAKDVIGEDAKKCVEQMKEKDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KE+
Sbjct: 120 NVRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ML +  +  ++P VAI+GG+KVS KI ++ NL++KVD L+IGG MA +FL A+G  +G+
Sbjct: 180 EMLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S C+ D  D   +I  +A+     +++P   +VA+E K       V + ++P D + +D+
Sbjct: 240 SKCEDDKLDIAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEYMYVPSDAMPDDMMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + I +A+T++WNGP+GVFE   F + T  +A  VA+  +E   I+I GGGD
Sbjct: 300 GNTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 360 SAAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACL 398


>gi|323701498|ref|ZP_08113171.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
 gi|323533507|gb|EGB23373.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
          Length = 393

 Score =  394 bits (1013), Expect = e-108,   Method: Composition-based stats.
 Identities = 169/399 (42%), Positives = 257/399 (64%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +++ D+ D++G R  +RVD+NVP    K+ D TRI + +PTI  L+++ AKV++ S
Sbjct: 1   MAK-KSVRDI-DVKGKRVFVRVDFNVPLDGDKITDDTRIRKALPTIQYLIDQGAKVILAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +  +   L  V      +L K ++ VN+ +G    Q+IA++  G ++L ENVR
Sbjct: 59  HLGRPKGEVVEKYRLTPVAKRLSELLGKEVIKVNESVGPEPQQAIANMQPGDVLLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++EE +ND  + R L++  D Y+NDAF  +HRAHAS  G++  LP   G  M+KEL ML
Sbjct: 119 FHAEETKNDEKYARQLAQLADVYVNDAFGAAHRAHASTAGIAEYLPGVAGFLMEKELEML 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  VG+SL 
Sbjct: 179 GKAVTNPERPFVAIIGGAKVSDKIGVIENLLTKVDSLIIGGGMANTFLKAQGYNVGKSLL 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D  D   ++   AK    ++++P DVVVA  M+     +VV    +P D ++LD+G  
Sbjct: 239 EQDKVDLARELMERAKSRGVDLLLPTDVVVALAMEPTARQKVVPVAEIPDDWMVLDIGPA 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + E    V+ +A TV+WNGP+GVFE+EPF + T  VA  +A         +I GGGD++ 
Sbjct: 299 SAEKFAAVVQKAATVVWNGPMGVFEMEPFAKGTEAVARALA----NSNATTIVGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++++ T++ST GGA LE+LEGK+LPG+ AL   
Sbjct: 355 AVNKTGVADKITHISTGGGASLEFLEGKELPGVAALQDK 393


>gi|15643452|ref|NP_228498.1| bifunctional phosphoglycerate kinase/triosephosphate isomerase
           [Thermotoga maritima MSB8]
 gi|6226667|sp|P36204|PGKT_THEMA RecName: Full=Bifunctional PGK/TIM; Includes: RecName:
           Full=Phosphoglycerate kinase; Includes: RecName:
           Full=Triosephosphate isomerase; Short=TIM; AltName:
           Full=Triose-phosphate isomerase
 gi|4981212|gb|AAD35771.1|AE001741_4 phosphoglycerate kinase/triose-phosphate isomerase [Thermotoga
           maritima MSB8]
          Length = 654

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 253/400 (63%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ S
Sbjct: 1   MEKM-TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN R
Sbjct: 59  HLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  
Sbjct: 179 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G 
Sbjct: 239 EEDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T+E  KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+ 
Sbjct: 299 ETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G+ ++F++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADK 397


>gi|281411916|ref|YP_003345995.1| phosphoglycerate kinase [Thermotoga naphthophila RKU-10]
 gi|281373019|gb|ADA66581.1| Phosphoglycerate kinase [Thermotoga naphthophila RKU-10]
          Length = 399

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 252/400 (63%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ S
Sbjct: 1   MEKM-TIKDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN R
Sbjct: 59  HLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  +G S  
Sbjct: 179 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEIGSSRV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G 
Sbjct: 239 EEDKIDLAKELLEKAKEKGVEIVLPVDTVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TVE  KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+ 
Sbjct: 299 ETVELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G+ + F++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAVNKFGLEDRFSHVSTGGGASLEFLEGKELPGIASIADK 397


>gi|148269387|ref|YP_001243847.1| phosphoglycerate kinase [Thermotoga petrophila RKU-1]
 gi|166987820|sp|A5IJ98|PGK_THEP1 RecName: Full=Phosphoglycerate kinase
 gi|147734931|gb|ABQ46271.1| Phosphoglycerate kinase [Thermotoga petrophila RKU-1]
          Length = 399

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 252/400 (63%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ S
Sbjct: 1   MEKM-TIKDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN R
Sbjct: 59  HLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  
Sbjct: 179 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G 
Sbjct: 239 EEDKIDLAKELLEKAKEKGVEIVLPVDTVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TVE  KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+ 
Sbjct: 299 ETVELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G+ + F++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAVNKFGLEDRFSHVSTGGGASLEFLEGKELPGIASIADK 397


>gi|294501762|ref|YP_003565462.1| phosphoglycerate kinase [Bacillus megaterium QM B1551]
 gi|295707112|ref|YP_003600187.1| phosphoglycerate kinase [Bacillus megaterium DSM 319]
 gi|129918|sp|P24269|PGK_BACMD RecName: Full=Phosphoglycerate kinase
 gi|39643|emb|CAA38375.1| unnamed protein product [Bacillus megaterium DSM 319]
 gi|143318|gb|AAA73203.1| phosphoglycerate kinase [Bacillus megaterium]
 gi|294351699|gb|ADE72028.1| phosphoglycerate kinase [Bacillus megaterium QM B1551]
 gi|294804771|gb|ADF41837.1| phosphoglycerate kinase [Bacillus megaterium DSM 319]
          Length = 394

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 161/398 (40%), Positives = 246/398 (61%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G R   RVD+NVP  DGKV D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKTLKDI-DVKGKRVFCRVDFNVPMKDGKVTDETRIRAAIPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V    +++L K++   ++  G  + ++I  +SEG +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLNAVAERLQALLGKDVAKADEAFGEEVKKTIDGMSEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAQHIPAVAGFLMEKELDVLS 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AIVGG+KV  KI ++ +L+ KVD L+IGGG++ +F+ A G  VG+SL +
Sbjct: 180 KALSNPERPFTAIVGGAKVKDKIGVIDHLLDKVDNLIIGGGLSYTFIKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK++     +P DVVVA +       QVVS + +P D   LD G KT
Sbjct: 240 EDKIELAKSFMEKAKKNGVNFYMPVDVVVADDFSNDANIQVVSIEDIPSDWEGLDAGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE++ F   T  VA  +A+ T      S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVIWNGPMGVFELDAFANGTKAVAEALAEAT---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++ +++ST GGA LE++EGK+LPG+VAL+  
Sbjct: 357 VEKFNLADKMSHISTGGGASLEFMEGKELPGVVALNDK 394


>gi|170288045|ref|YP_001738283.1| phosphoglycerate kinase [Thermotoga sp. RQ2]
 gi|238688811|sp|B1L8B8|PGK_THESQ RecName: Full=Phosphoglycerate kinase
 gi|170175548|gb|ACB08600.1| Phosphoglycerate kinase [Thermotoga sp. RQ2]
          Length = 399

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 252/400 (63%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV+  S
Sbjct: 1   MEKM-TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVIFLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN R
Sbjct: 59  HLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  
Sbjct: 179 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G 
Sbjct: 239 EEDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TVE  KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+ 
Sbjct: 299 ETVELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G+ ++F++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADK 397


>gi|323701578|ref|ZP_08113250.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
 gi|323533351|gb|EGB23218.1| Phosphoglycerate kinase [Desulfotomaculum nigrificans DSM 574]
          Length = 393

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 162/399 (40%), Positives = 254/399 (63%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M + +++ D+ +++G R  +RVD+NVP     + D TRI + +PTI  L+E+ A+V++ S
Sbjct: 1   MPK-KSVKDI-EVKGKRVFVRVDFNVPLDGEVITDDTRIRKALPTIQYLMEQGARVILAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +  +   L  V      +L K ++ VND +G  + Q+IA++  G ++L ENVR
Sbjct: 59  HLGRPKGEVVEKYRLTPVARRLSELLGKEVIKVNDSVGEEVKQAIAAMQNGDVLLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++EE +ND  + R L+   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL+ML
Sbjct: 119 FHAEETKNDEKYARQLAELADVFVNDAFGAAHRAHASTAGIAKYLPAVAGFLMEKELTML 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG   G+SL 
Sbjct: 179 GQAVTTPRRPFVAIIGGAKVSDKIGVIENLLSKVDTLIIGGGMANTFLRAQGYQTGKSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D   ++   A     E+++P DVVVAR  +     +VV+   +P D ++LD+G  
Sbjct: 239 EPDKVDLARELIERAATRQVELLLPTDVVVARAFEPTAENRVVTVTKIPEDWMVLDIGPA 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T     + + +A TV+WNGP+GVFE++ F + T  VA  +A    +   I+I GGGD++ 
Sbjct: 299 TAAKYAEAVQKAATVVWNGPMGVFEMDVFAKGTEAVAKALA----DSPAITIIGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++++ +++ST GGA LE+LEGK+LPG+  L   
Sbjct: 355 AVNKIGVADKISHISTGGGASLEFLEGKELPGVAVLQSK 393


>gi|52081961|ref|YP_080752.1| phosphoglycerate kinase [Bacillus licheniformis ATCC 14580]
 gi|52787349|ref|YP_093178.1| phosphoglycerate kinase [Bacillus licheniformis ATCC 14580]
 gi|319647826|ref|ZP_08002044.1| phosphoglycerate kinase [Bacillus sp. BT1B_CT2]
 gi|81690874|sp|Q65EM9|PGK_BACLD RecName: Full=Phosphoglycerate kinase
 gi|52005172|gb|AAU25114.1| phosphoglycerate kinase [Bacillus licheniformis ATCC 14580]
 gi|52349851|gb|AAU42485.1| Pgk [Bacillus licheniformis ATCC 14580]
 gi|317390167|gb|EFV70976.1| phosphoglycerate kinase [Bacillus sp. BT1B_CT2]
          Length = 394

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 238/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G     RVD+NVP  DGKV D TRI   +PTI  L E+ AKV++ SH
Sbjct: 1   MNKKSVKDI-DVKGRVVFCRVDFNVPMKDGKVTDDTRIRAALPTIQYLTEQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    ++ K +   ++  G  +   I+ + +G I++ ENVRF
Sbjct: 60  LGRPKGQVSEELRLTPVAARLGELIGKEVKKADEAYGDAVKAQISEMKDGDILVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELSKAFADLADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L++KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIESLLEKVDNLIIGGGLAYTFVKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK       +P DV+VA +      T++V    +P D   LD+G +T
Sbjct: 240 EDKIELAKSFMDRAKEKGVNFYMPTDVLVADDFSNDANTKIVPVSEIPSDWEALDIGEET 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +    VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+        S+ GGGD+  A
Sbjct: 300 RKTYADVIKNSKLVVWNGPMGVFEIDAFAKGTRAVAEALAEA---NDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVKALNDK 394


>gi|222100871|ref|YP_002535439.1| Bifunctional PGK/TIM [Thermotoga neapolitana DSM 4359]
 gi|221573261|gb|ACM24073.1| Bifunctional PGK/TIM [Thermotoga neapolitana DSM 4359]
          Length = 405

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 255/400 (63%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ T+ D+ D++G R ++RVD+NVP  DG V D TRI+  +PTI  ++++ AKV++ S
Sbjct: 3   MEKM-TVRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIKAALPTIKYVLDQGAKVILLS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN R
Sbjct: 61  HLGRPKGQPSPEFSLEPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 121 FHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  +G S  
Sbjct: 181 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKQIGSSKY 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G 
Sbjct: 241 EEDKLDLAKELLDKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TVE  KQ ++ A+TV+WNGP+GVFEI+ F   T ++A  +A LT E+  I++ GGGD+ 
Sbjct: 301 ETVELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQIALAIASLT-EKGAITVVGGGDSA 359

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G+ ++F++VST GGA LE+LEGK+LPGI +++  
Sbjct: 360 AAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADK 399


>gi|307718667|ref|YP_003874199.1| phosphoglycerate kinase [Spirochaeta thermophila DSM 6192]
 gi|306532392|gb|ADN01926.1| phosphoglycerate kinase [Spirochaeta thermophila DSM 6192]
          Length = 392

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 159/397 (40%), Positives = 240/397 (60%), Gaps = 5/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             L+T+ D+ ++RG + L+RVD+NVP  DG + D TRI   +PT+  L+++ A +++ SH
Sbjct: 1   MELKTVKDI-EVRGKKVLVRVDFNVPLKDGVITDDTRIRAALPTLQYLLDQGAALIVMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +   + SL  V      +L + +    DC+G  + +   +L+ G ++L ENVRF
Sbjct: 60  LGRPKGERKPEYSLSPVAERLGELLGREVKMAPDCVGPEVERMAEALTPGEVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EE  NDPDF + L+  G+ Y+NDAF  +HR HAS  G++HLLP+  G  M+KE+  L 
Sbjct: 120 HKEETSNDPDFAKKLASLGEVYVNDAFGSAHRGHASTEGIAHLLPAAAGFLMEKEVKFLS 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 +KP VA++GG+KVSTKI +L +L+ K   +VIGGGMA +FL  QG  +G SL +
Sbjct: 180 YVLENPEKPFVAVIGGAKVSTKIGVLESLLSKCTAMVIGGGMAYTFLKVQGHSIGNSLYE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            + +D       +A     E+I+P D +VA E       + V A  +P   + +D+G +T
Sbjct: 240 EESADTARSFLEKAGELGVEVILPEDHLVASEFSEQAKAEYVDAVDIPEGKVGMDIGPRT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE     I  A+TV+WNGP+GVFE   F   T +VA  +A+     +  ++ GGGD++ A
Sbjct: 300 VEKACARIRGAKTVVWNGPMGVFEFPAFAEGTRKVAEAIAEC----KGTTVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
               G++++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 356 ANAFGVADKMTHVSTGGGASLEFLEGKPLPGIEVLKK 392


>gi|315185803|gb|EFU19569.1| phosphoglycerate kinase [Spirochaeta thermophila DSM 6578]
          Length = 392

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/397 (40%), Positives = 241/397 (60%), Gaps = 5/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             L+T+ D+ ++RG + L+RVD+NVP  DG + D TRI   +PT+  L+++ A +++ SH
Sbjct: 1   MELKTVKDI-EVRGKKVLVRVDFNVPLKDGVITDDTRIRAALPTLQYLLDQGAALIVMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +   + SL  V      +L + +    DC+G  + +   +L+ G ++L ENVRF
Sbjct: 60  LGRPKGERKPEYSLSPVAERLGELLGREVKMAPDCVGPEVERMAEALTPGEVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EE  NDPDF + L+  G+ Y+NDAF  +HRAHAS  G++HLLP+  G  M+KE+  L 
Sbjct: 120 HKEETSNDPDFAKKLASLGEVYVNDAFGSAHRAHASTEGVAHLLPAAAGFLMEKEVKFLS 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 +KP VA++GG+KVSTKI +L +L+ K   +VIGGGMA +FL  QG  +G SL +
Sbjct: 180 YVLENPEKPFVAVIGGAKVSTKIGVLESLLSKCTAMVIGGGMAYTFLKVQGHSIGNSLYE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            + +D       +A     E+I+P D +VA E       + V A  +P   + +D+G +T
Sbjct: 240 EESADTARSFLEKAGELGVEVILPEDHLVASEFSEQAKAEYVDAVDIPEGKVGMDIGPRT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE     I  A+TV+WNGP+GVFE   F   T +VA  +A+     +  ++ GGGD++ A
Sbjct: 300 VEKACARIRGAKTVVWNGPMGVFEFPAFAEGTRKVAEAIAEC----KGTTVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
               G++++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 356 ANAFGVADKMTHVSTGGGASLEFLEGKPLPGIEVLKK 392


>gi|288554076|ref|YP_003426011.1| phosphoglycerate kinase [Bacillus pseudofirmus OF4]
 gi|288545236|gb|ADC49119.1| phosphoglycerate kinase [Bacillus pseudofirmus OF4]
          Length = 393

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 246/398 (61%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G +   RVD+NVP  DG++ D TRI   +PTI  L+EK AKV++ SH
Sbjct: 1   MNKKTVRDI-DLKGKKVFCRVDFNVPMKDGEITDETRIRAALPTIEFLIEKGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L+K++  V++  G+    +  SL +G ++L ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLGELLNKDVKKVDEAHGAEAEAAANSLQDGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDPELAKAFASLADVYVNDAFGAAHRAHASTEGIAKHIPAVAGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ AQG  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKAQGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D       +AK    +  +P DVVVA +      T+VV   S+P D   LD+G KT
Sbjct: 240 EDKIDLARSFMDKAKEKGVKFYMPEDVVVADDFSEEANTEVVDIDSIPADWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +  + VI +++ V+WNGP+GVFE+  F   T  VA  +A         S+ GGGD+  A
Sbjct: 300 RDTYRSVIEESKLVIWNGPMGVFELSVFANGTKAVADALAT----SDAYSVIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++ +++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 VEKFDLADKMSHISTGGGASLEFMEGKQLPGVVALNEK 393


>gi|154687530|ref|YP_001422691.1| phosphoglycerate kinase [Bacillus amyloliquefaciens FZB42]
 gi|154353381|gb|ABS75460.1| Pgk [Bacillus amyloliquefaciens FZB42]
          Length = 394

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 238/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G     RVD+NVP  DG+V D TRI   +PTI  L ++ AKV++ SH
Sbjct: 1   MNKKTVKDI-DVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLADQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K +   ++  G  +   I+ + +G +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLGELLGKEVKKADEAYGDAVKAQISDMKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAVTNPERPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGYEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK    +  +P DV+VA +       Q+V    +P D   +D+G KT
Sbjct: 240 EDKIELAKSFMDRAKEKGVKFYMPEDVLVADDFSNDANVQIVPVSEIPSDLEAIDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E   +VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+        S+ GGGD+  A
Sbjct: 300 RETYAEVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEA---NDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVAALNDK 394


>gi|16080446|ref|NP_391273.1| phosphoglycerate kinase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221311343|ref|ZP_03593190.1| phosphoglycerate kinase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315670|ref|ZP_03597475.1| phosphoglycerate kinase [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221320586|ref|ZP_03601880.1| phosphoglycerate kinase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324870|ref|ZP_03606164.1| phosphoglycerate kinase [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|3123234|sp|P40924|PGK_BACSU RecName: Full=Phosphoglycerate kinase
 gi|2635906|emb|CAB15398.1| phosphoglycerate kinase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|291485921|dbj|BAI86996.1| phosphoglycerate kinase [Bacillus subtilis subsp. natto BEST195]
          Length = 394

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 236/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G     RVD+NVP  DG+V D TRI   +PTI  L ++ AKV++ SH
Sbjct: 1   MNKKTLKDI-DVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLADQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K +   ++  G  +   I+ + +G +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLGELLGKEVKKADEAYGDAVKAQISEMKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAVSNPDRPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGYEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK       +P DV+VA +       ++V    +P D   +D+G KT
Sbjct: 240 EDKIELAKSFMDRAKEKGVNFYMPEDVLVADDFSNDANVKIVPISEIPSDLEAIDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+    +   S+ GGGD+  A
Sbjct: 300 RETYADVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVAALNDK 394


>gi|296330390|ref|ZP_06872871.1| phosphoglycerate kinase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305676005|ref|YP_003867677.1| phosphoglycerate kinase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296152658|gb|EFG93526.1| phosphoglycerate kinase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305414249|gb|ADM39368.1| phosphoglycerate kinase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 394

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 236/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G     RVD+NVP  DG+V D TRI   +PTI  L E+ AKV++ SH
Sbjct: 1   MNKKTLKDI-DVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLAEQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K +   ++  G  +   I+ + +G +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLGELLGKEVKKADEAYGDAVKAQISDMKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAVSNPDRPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK       +P DV+VA +       ++V    +P D   +D+G KT
Sbjct: 240 EDKIELAKSFMDRAKEKGVNFYMPEDVLVADDFSNDANVKIVPISEIPSDLEAIDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+    +   S+ GGGD+  A
Sbjct: 300 RETYADVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVAALNDK 394


>gi|157834149|pdb|1VPE|A Chain A, Crystallographic Analysis Of Phosphoglycerate Kinase From
           The Hyperthermophilic Bacterium Thermotoga Maritima
          Length = 398

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/390 (41%), Positives = 247/390 (63%), Gaps = 3/390 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 4   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 62

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 63  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 122

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 123 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 182

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 183 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 242

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +T+E 
Sbjct: 243 DLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 303 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 361

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIV 394
            G+ ++F++VST GGA LE+LEGK+LPGI 
Sbjct: 362 FGLEDKFSHVSTGGGASLEFLEGKELPGIA 391


>gi|239828276|ref|YP_002950900.1| phosphoglycerate kinase [Geobacillus sp. WCH70]
 gi|259530762|sp|C5D7M4|PGK_GEOSW RecName: Full=Phosphoglycerate kinase
 gi|239808569|gb|ACS25634.1| Phosphoglycerate kinase [Geobacillus sp. WCH70]
          Length = 394

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 159/398 (39%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G R   RVD+NVP  +G + D TRI   +PTI  L+E+ AKV++ SH
Sbjct: 1   MNKKTVRDV-DVKGKRVFCRVDFNVPMENGAITDDTRIRAALPTIRYLMEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L K++   ++  G  + ++I+ ++EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLNAVARRLSELLGKHVTKTDEAYGDAVKEAISKMNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADIYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  +G+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLAYTFVKALGHEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA        T+VVS  ++P D   LD+G KT
Sbjct: 240 EDKIELAKSFMEKAKEKGVNFYMPVDVVVADRFANDANTKVVSIDAIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI +++ V+WNGP+GVFE++ F   T  VA  +A         S+ GGGD+  A
Sbjct: 300 RELYRDVIMKSKLVVWNGPMGVFEMDAFAEGTKAVAQALADAV---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++ +  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 357 VEKFGLAEKMDHISTGGGASLEFMEGKQLPGVVALNDK 394


>gi|311031865|ref|ZP_07709955.1| phosphoglycerate kinase [Bacillus sp. m3-13]
          Length = 394

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 156/398 (39%), Positives = 243/398 (61%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DG+V D TRI   +PTI  LV+  AKV++ SH
Sbjct: 1   MNKKSIRDI-DVKGKRVFCRVDFNVPMKDGQVTDETRIRAALPTIKHLVDNGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +  + +L K++   ++  G ++   +  +SEG ++L ENVRF
Sbjct: 60  LGRPKGQVVEELRLNAVAARLQELLGKDVKKADEAYGDSVKAIVNDMSEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAQHLPAVAGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A+G  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLAYTFIKAKGYDVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D       +AK     + +P DVVVA +      T++V  + +P D   LD G K+
Sbjct: 240 EDKIDLAKSFMEQAKEKGVNMYMPVDVVVADDFSNDANTKIVPIEEIPSDWEGLDCGPKS 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE++ F   T  V   +A+ T      S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVIWNGPMGVFELDAFAGGTKAVGEALAEAT---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++ +++ST GGA LE++EGK+LPG++AL+  
Sbjct: 357 VEKFNLADKMSHISTGGGASLEFMEGKELPGVLALNDK 394


>gi|206900130|ref|YP_002250853.1| phosphoglycerate kinase [Dictyoglomus thermophilum H-6-12]
 gi|226699802|sp|B5YE95|PGK_DICT6 RecName: Full=Phosphoglycerate kinase
 gi|206739233|gb|ACI18291.1| phosphoglycerate kinase [Dictyoglomus thermophilum H-6-12]
          Length = 396

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 163/401 (40%), Positives = 250/401 (62%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +T+ DL+D  ++G R L+RVD+NVP  +G + D  RI   +PTI  L+++ AKV++
Sbjct: 1   MAK-KTILDLQDEELKGKRVLVRVDFNVPIKNGVITDDRRIREALPTIKYLIDRGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+     D  L  V      +L K +  +NDCIG  + + I+++ EG ++L EN
Sbjct: 60  VSHLGRPKG-FQDDLRLDPVAKRLSELLGKPVKKLNDCIGEEVEKEISNMKEGDVVLLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RFY EEE NDP+F + L++  D Y+NDAF  +HRAHAS  G++  +P   G  M+KE+ 
Sbjct: 119 IRFYKEEEANDPEFAKKLAKLADLYVNDAFGTAHRAHASTAGVAQYIPGVAGLLMKKEIE 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ++       ++P + I+GG+KVS KI ++ NL+ KVD  +IGGGM  +FL A G   G+S
Sbjct: 179 IMGKALESPERPFICILGGAKVSDKIGVIKNLMTKVDGFLIGGGMMFTFLKALGYETGKS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + + D  +   +I   AK    E ++P+D VV +E+K   PT +        D I +D+G
Sbjct: 239 IVEDDKLELAKEIMNMAKERGVEFLLPKDAVVVKEIKEDAPTSIKDVDKFEKDDIGVDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT+E  ++ I +ART++WNGP+G+FEI  F   T  +A  +A+    +  ISI GGGD+
Sbjct: 299 PKTIELFREEILKARTIIWNGPMGIFEIPAFANGTRRIAEAIAE---NKNCISIVGGGDS 355

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             A+   G+ ++FT++ST GGA LE+LEGK+LPG+  L   
Sbjct: 356 AAAIQMLGLEDKFTHISTGGGASLEFLEGKELPGVAVLQDK 396


>gi|321312945|ref|YP_004205232.1| phosphoglycerate kinase [Bacillus subtilis BSn5]
 gi|320019219|gb|ADV94205.1| phosphoglycerate kinase [Bacillus subtilis BSn5]
          Length = 394

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 236/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G     RVD+NVP  DG+V D TRI   +PTI  L ++ AKV++ SH
Sbjct: 1   MNKKTLKDI-DVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLADQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K +   ++  G  +   I+ + +G +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAAHLGELLGKEVKKSDEAYGDAVKAQISEMKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAVSNPDRPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGYEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK       +P DV+VA +       ++V    +P D   +D+G KT
Sbjct: 240 EDKIELAKSFMDRAKEKGVNFYMPEDVLVADDFSNDANVKIVPISEIPSDLEAIDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+    +   S+ GGGD+  A
Sbjct: 300 RETYADVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVAALNDK 394


>gi|219847582|ref|YP_002462015.1| phosphoglycerate kinase [Chloroflexus aggregans DSM 9485]
 gi|254782196|sp|B8G4H3|PGK_CHLAD RecName: Full=Phosphoglycerate kinase
 gi|219541841|gb|ACL23579.1| Phosphoglycerate kinase [Chloroflexus aggregans DSM 9485]
          Length = 400

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 240/398 (60%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ D  G R L+RVD+NVP  + G++ D TRI   +PTI  L+E  AKV++ S
Sbjct: 1   MNKKTIRDV-DWAGKRALVRVDFNVPLDEQGQITDDTRIRAALPTIRYLLEHGAKVILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILH--KNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           HLGRP+ K +   SL  VV     +L     +       G     +++ L  G +++ EN
Sbjct: 60  HLGRPKGKPNPKYSLRPVVERLFELLPEATEVKKTEAITGPAAEAAVSMLKPGQVLVLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF   EE NDP     L++ GD ++NDAF  +HRA+AS  G++H LP+  G  M+KEL+
Sbjct: 120 TRFDPREEANDPQMAAELAKLGDVFVNDAFGTAHRANASTEGVAHYLPAVAGFLMEKELT 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            +    S  ++P V ++GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+A+G+ +G S
Sbjct: 180 YIGGALSNPQRPFVTVIGGAKISDKIGVIENLLGKVDALLIGGGMANTFLLAKGLNLGDS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + +      Q+  +A+     +++P DVV+A         QVV   ++P    +LD+G
Sbjct: 240 LVEPESVPVAQQLMAKAEERGARLLLPVDVVIADAFSAEAQRQVVEVTAIPSGWRVLDIG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT+E     I  ARTV+WNGP+GVFE+EPF   T  +A  +A+ +     I+I GGGD+
Sbjct: 300 PKTIELYSAEIRSARTVIWNGPMGVFELEPFAAGTRAIAQAMAEAS-ANGAITIVGGGDS 358

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + A+  AG++ +  +VST GGA LE LEG+ LPG+ AL
Sbjct: 359 VAAVEQAGLAEKMAHVSTGGGASLELLEGRVLPGVAAL 396


>gi|205375131|ref|ZP_03227922.1| phosphoglycerate kinase [Bacillus coahuilensis m4-4]
          Length = 394

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 156/398 (39%), Positives = 245/398 (61%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DG + D TRI   +PTI  L ++ AKV++ SH
Sbjct: 1   MNKQSIKDV-DVKGKRVFCRVDFNVPMKDGSITDETRIRAAIPTIQHLADQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +++K++  V++  G  +   ++ + +G I+L ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLSELMNKDVKKVDEAYGDAVLAEVSKMEDGDILLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  E +NDP+  +  +   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L 
Sbjct: 120 YPGETKNDPELAKNFAVLADVYVNDAFGAAHRAHASTEGIAKHIPAVAGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFVKAQGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   Q   +A+    +  +P DV+VA +       +VVS + +P D   LD+G KT
Sbjct: 240 EDKIDLAKQFMAKAEEKGVKFYMPVDVIVADDFSDSANQKVVSIEEIPADWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI +++ V+WNGP+GVFE+E + + T  VA  +A  T      S+ GGGD+  A
Sbjct: 300 TELYAGVIKESKLVIWNGPMGVFELESYAKGTKGVAEALADST---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++ + +++ST GGA LE++EGK+LPG+VAL+  
Sbjct: 357 VEKFGLAEKMSHISTGGGASLEFMEGKELPGVVALNDK 394


>gi|261420493|ref|YP_003254175.1| phosphoglycerate kinase [Geobacillus sp. Y412MC61]
 gi|319768164|ref|YP_004133665.1| phosphoglycerate kinase [Geobacillus sp. Y412MC52]
 gi|261376950|gb|ACX79693.1| Phosphoglycerate kinase [Geobacillus sp. Y412MC61]
 gi|317113030|gb|ADU95522.1| Phosphoglycerate kinase [Geobacillus sp. Y412MC52]
          Length = 394

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 161/398 (40%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ ++RG R   RVD+NVP  +G + D TRI   +PTI  L+E  AKV++ SH
Sbjct: 1   MNKKTIRDV-EVRGKRVFCRVDFNVPMEEGAITDDTRIRAALPTIRYLIENGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA        T+VV+  ++P D   LD+G KT
Sbjct: 240 EDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVAIDAIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI +++ V+WNGP+GVFE+E F   T  VA  +A+        S+ GGGD+  A
Sbjct: 300 RELYRDVIRESKLVVWNGPMGVFEMEAFAHGTKAVAQALAEAP---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++  ++ST GGA LE++EGK LPG+VAL   
Sbjct: 357 VEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK 394


>gi|89098796|ref|ZP_01171677.1| phosphoglycerate kinase [Bacillus sp. NRRL B-14911]
 gi|89086472|gb|EAR65592.1| phosphoglycerate kinase [Bacillus sp. NRRL B-14911]
          Length = 394

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 154/398 (38%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DG + D TRI   +PTI  L E+ AKV++ SH
Sbjct: 1   MNKKSVKDI-DLKGKRVFCRVDFNVPMKDGSITDETRITAALPTIQYLTEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V      +L K++   ++  G  +   ++ ++EG ++L ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAKRLSELLGKDVKKADEAYGEAVQGLVSEMAEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AIVGG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL +
Sbjct: 180 KAMSNPERPFTAIVGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKAQGHEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D       +A+    +  +P DV+VA +       + VS + +P D   LD+G KT
Sbjct: 240 EDKIDLADSFMKKAEEKGVKFYMPVDVLVADDFSEDANIKEVSIEEIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
               + VI  ++ V+WNGP+GVFE+  F   T  VA  +A+    +   S+ GGGD+  A
Sbjct: 300 RAIYQDVIKSSKLVIWNGPMGVFELNAFAGGTKAVAEALAE---SQDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFDLADKMSHISTGGGASLEFIEGKELPGVTALNDK 394


>gi|167039950|ref|YP_001662935.1| phosphoglycerate kinase [Thermoanaerobacter sp. X514]
 gi|256751247|ref|ZP_05492127.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915491|ref|ZP_07132803.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X561]
 gi|307724726|ref|YP_003904477.1| phosphoglycerate kinase [Thermoanaerobacter sp. X513]
 gi|166854190|gb|ABY92599.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X514]
 gi|256749802|gb|EEU62826.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888443|gb|EFK83593.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X561]
 gi|307581787|gb|ADN55186.1| Phosphoglycerate kinase [Thermoanaerobacter sp. X513]
          Length = 393

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/396 (42%), Positives = 256/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+   AKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIQYLINNNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K +    D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKVNPEYSLKPVAKRLSELLGKQVSMAEDVIGEDAKAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDPQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPQDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T  +A  +++     + I+I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGTEAIAKALSEC----KGITIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIEVLNDK 393


>gi|217967518|ref|YP_002353024.1| phosphoglycerate kinase [Dictyoglomus turgidum DSM 6724]
 gi|226699803|sp|B8E2D3|PGK_DICTD RecName: Full=Phosphoglycerate kinase
 gi|217336617|gb|ACK42410.1| Phosphoglycerate kinase [Dictyoglomus turgidum DSM 6724]
          Length = 396

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/401 (40%), Positives = 250/401 (62%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +T+ DL   D++G R L+RVD+NVP  +G + D  RI   +PTI  L++K AKV++
Sbjct: 1   MAK-KTILDLRDEDLKGKRVLVRVDFNVPLKNGVITDDRRIREALPTIKYLMDKGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+     D  L  V      +L K +  +NDCIG  + + I+++ EG +IL EN
Sbjct: 60  VSHLGRPKG-FQDDLRLDPVAKRLSELLGKPVKKLNDCIGEEVEREISNMKEGDVILLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           +RFY EEE NDP+F + L+   D Y+NDAF  +HRAHAS  G++  +P   G  M+KE+ 
Sbjct: 119 IRFYKEEEANDPEFAKKLASLADLYVNDAFGTAHRAHASTAGVAQYIPGVAGLLMKKEIE 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ++       ++P + I+GG+KVS KI ++ NL+ KVD  +IGGGM  +FL A G  +G+S
Sbjct: 179 IMGKALESPERPFICILGGAKVSDKIGVIKNLMNKVDGFLIGGGMMFTFLKALGYEIGKS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           + + D  D   +I   AK    + ++P+D VV +E+K   PT +        D I +D+G
Sbjct: 239 IVEEDKLDLAREIMNMAKERGIQFLLPKDAVVVKEIKEDAPTSIKDIDKFEKDDIGVDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT+E  ++ I +A+T++WNGP+G+FEI  F   T ++A  +A+    R  +SI GGGD+
Sbjct: 299 PKTIELFREEILKAKTIIWNGPMGIFEIPAFANGTRKIAEAIAE---NRNCVSIVGGGDS 355

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             A+   G+ ++FT++ST GGA LE+LEGK+LPG+  L   
Sbjct: 356 AAAIQTLGLEDKFTHISTGGGASLEFLEGKELPGVAVLQDK 396


>gi|308175146|ref|YP_003921851.1| phosphoglycerate kinase [Bacillus amyloliquefaciens DSM 7]
 gi|307608010|emb|CBI44381.1| phosphoglycerate kinase [Bacillus amyloliquefaciens DSM 7]
 gi|328555116|gb|AEB25608.1| phosphoglycerate kinase [Bacillus amyloliquefaciens TA208]
 gi|328913471|gb|AEB65067.1| phosphoglycerate kinase [Bacillus amyloliquefaciens LL3]
          Length = 394

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 149/398 (37%), Positives = 238/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G     RVD+NVP  DG+V D TRI   +PTI  L ++ AKV++ SH
Sbjct: 1   MNKKTVKDI-DVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLADQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K +   ++  G  +   I+ + +G +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLGELLGKEVKKADEAYGDAVKAQISDMKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SL +
Sbjct: 180 KAVTNPERPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGYEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK    +  +P DV+VA +       ++V    +P D   +D+G KT
Sbjct: 240 EDKIELAKSFMDRAKEKGVKFYMPEDVLVADDFSNDANVKMVPISEIPSDLEAIDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+    +   S+ GGGD+  A
Sbjct: 300 RETYADVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVAALNDK 394


>gi|228993843|ref|ZP_04153747.1| Phosphoglycerate kinase [Bacillus pseudomycoides DSM 12442]
 gi|228765899|gb|EEM14549.1| Phosphoglycerate kinase [Bacillus pseudomycoides DSM 12442]
          Length = 394

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 154/398 (38%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DGKV D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKDGKVTDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADLFVNDAFGAAHRAHASTAGIADYLPAVSGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   +    AK       +P DVV+  E      T+VV   ++P     +D+G KT
Sbjct: 240 NDKIDLAKEFMELAKEKGVNFYMPVDVVITEEFSETATTKVVGIDAIPETWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 SEIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|282850379|ref|ZP_06259758.1| phosphoglycerate kinase [Veillonella parvula ATCC 17745]
 gi|282579872|gb|EFB85276.1| phosphoglycerate kinase [Veillonella parvula ATCC 17745]
          Length = 393

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 155/397 (39%), Positives = 245/397 (61%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M + +T+  L+ +      +RVD+NVP  DG + D TRI   +PTI  L+EK AKV++ S
Sbjct: 1   MMK-QTIEGLQ-VANKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLIEKGAKVILAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL         +++K + FV+DCIG  + +++ +L  G +++ EN+R
Sbjct: 59  HFGRPKGERKPEMSLAPCAKHLSDLINKPVAFVDDCIGPKVEEAVKALQSGDVLMLENLR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++EE +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L
Sbjct: 119 YHNEETKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIDAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +     K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL 
Sbjct: 179 SAAIVHPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLF 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +         +  EA+ +  +++ P D VVA        T++     +    +ILD+G K
Sbjct: 239 EEGQEVIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIADVDQIEDGWMILDIGPK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   + +A  +T++WNGP+GVFE+E F   T  VA  VA    E   ++I GGGD++ 
Sbjct: 299 TRELYVEALAPMKTIIWNGPMGVFEMENFAAGTNAVAKAVA----ESDAMTIVGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+  +G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 355 AIEKSGLADKISHISTGGGASLEFLEGKILPGIAALS 391


>gi|229543253|ref|ZP_04432313.1| Phosphoglycerate kinase [Bacillus coagulans 36D1]
 gi|229327673|gb|EEN93348.1| Phosphoglycerate kinase [Bacillus coagulans 36D1]
          Length = 394

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 158/398 (39%), Positives = 238/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ +++G R   RVD+NVP  DG V D TRI   +PTI  LVE  AKV++ SH
Sbjct: 1   MNKKSIKDV-ELQGKRVFCRVDFNVPLKDGNVTDDTRIRAALPTIKYLVENGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V      +L K++   N+  G ++   I+ ++ G ++L ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAKRLSELLGKDVKKANEAYGESVKAEISKMNNGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   + Y+NDAF  +HRAHAS  G++H LP+  G  MQKEL +L 
Sbjct: 120 YPGEEKNDPELAKEFASLAELYVNDAFGAAHRAHASTEGIAHHLPAVSGFLMQKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFVKAQGHEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D       +AK       +P D +VA E       + V+ + +P D   LD+G KT
Sbjct: 240 EDKIDLAKSFMAKAKEKGVNFYMPVDAIVADEFSETANKKEVAIEEIPADWQALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE   +VI +++ V+WNGP+GVFE++ +   T  VA  +A  T      SI GGGD+  A
Sbjct: 300 VELYAKVIKESKLVIWNGPMGVFEMDAYANGTKGVAEALADAT---GTYSIIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++ +  ++ST GGA LE++EGK LPG+ AL+  
Sbjct: 357 VEKFHLAEKMDHISTGGGASLEFMEGKTLPGVAALNDK 394


>gi|311069919|ref|YP_003974842.1| phosphoglycerate kinase [Bacillus atrophaeus 1942]
 gi|310870436|gb|ADP33911.1| phosphoglycerate kinase [Bacillus atrophaeus 1942]
          Length = 394

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 238/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G     RVD+NVP  DG+V D TRI   +PTI  L ++ AKV++ SH
Sbjct: 1   MNKKTLKDI-DVKGKVVFCRVDFNVPMKDGEVTDETRIRAALPTIKHLADQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K +   ++  G  +   I+ + +G +++ ENVRF
Sbjct: 60  LGRPKGEVVEELRLTPVAARLGELLGKEVKKADEAYGDAVQAQISDMKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELSKAFAALADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAVSNPERPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGYEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +        AK       +P DV+VA +      T++V    +P D   +D+G KT
Sbjct: 240 EDKIELAKTFMDRAKEKGVNFYMPEDVLVADDFSNDANTKIVPISEIPSDLEAIDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEI+ F + T  VA  +A+    +   S+ GGGD+  A
Sbjct: 300 RETYADVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADKMSHISTGGGASLEFMEGKELPGVSALNDK 394


>gi|297544979|ref|YP_003677281.1| phosphoglycerate kinase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842754|gb|ADH61270.1| Phosphoglycerate kinase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 393

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 167/396 (42%), Positives = 255/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+  KAKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINNKAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K +    D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKFNPEYSLKPVAKRLSELLGKQVSMAEDVIGEDARAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDPQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +A +    +++P D V+A+E+K+G+P +VV    +P D I +D+G +T+E
Sbjct: 242 KIELAKELMEKANQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPKDQIGVDIGPQTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T  +A  +++     +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGTEAIAKALSEC----KGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLNDK 393


>gi|228999869|ref|ZP_04159441.1| Phosphoglycerate kinase [Bacillus mycoides Rock3-17]
 gi|229007423|ref|ZP_04165020.1| Phosphoglycerate kinase [Bacillus mycoides Rock1-4]
 gi|228753811|gb|EEM03252.1| Phosphoglycerate kinase [Bacillus mycoides Rock1-4]
 gi|228759811|gb|EEM08785.1| Phosphoglycerate kinase [Bacillus mycoides Rock3-17]
          Length = 394

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 153/398 (38%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   N+  G  + + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKANEAFGPAVQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADLFVNDAFGAAHRAHASTAGIADYLPAVSGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   +    AK       +P DVV+  E      T+VV   ++P     +D+G KT
Sbjct: 240 NDKIDLAKEFMELAKEKGVNFYMPVDVVITEEFSETATTKVVGIDAIPETWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 SEIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|229087607|ref|ZP_04219737.1| Phosphoglycerate kinase [Bacillus cereus Rock3-44]
 gi|228695723|gb|EEL48578.1| Phosphoglycerate kinase [Bacillus cereus Rock3-44]
          Length = 394

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 155/398 (38%), Positives = 242/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DGKV D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKDGKVTDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADLFVNDAFGAAHRAHASTAGIADYLPAVSGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   +    AK       +P DVV+  E      T++V   S+P D   +D+G KT
Sbjct: 240 NDKIDLAKEFMELAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPTDWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 SEIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|289578742|ref|YP_003477369.1| phosphoglycerate kinase [Thermoanaerobacter italicus Ab9]
 gi|289528455|gb|ADD02807.1| Phosphoglycerate kinase [Thermoanaerobacter italicus Ab9]
          Length = 393

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/396 (42%), Positives = 256/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+  KAKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINNKAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K +    D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKFNPEYSLKPVAKRLSELLGKQVSMAEDVIGEDARAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDPQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPKDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T  +A  +++     +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGTEAIAKALSEC----KGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLNDK 393


>gi|56421592|ref|YP_148910.1| phosphoglycerate kinase [Geobacillus kaustophilus HTA426]
 gi|81675701|sp|Q5KVE4|PGK_GEOKA RecName: Full=Phosphoglycerate kinase
 gi|56381434|dbj|BAD77342.1| 3-phosphoglycerate kinase [Geobacillus kaustophilus HTA426]
          Length = 394

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 161/398 (40%), Positives = 239/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ ++RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SH
Sbjct: 1   MNKKTIRDV-EVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA        T+VV+  ++P D   LD+G KT
Sbjct: 240 EDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVAIDAIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI Q++ V+WNGP+GVFE+E F   T  +A  +A+        S+ GGGD+  A
Sbjct: 300 RELYRDVIRQSKLVVWNGPMGVFEMEAFAHGTKAIAEALAEAP---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++  ++ST GGA LE++EGK LPG+VAL   
Sbjct: 357 VEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK 394


>gi|302390385|ref|YP_003826206.1| phosphoglycerate kinase [Thermosediminibacter oceani DSM 16646]
 gi|302201013|gb|ADL08583.1| phosphoglycerate kinase [Thermosediminibacter oceani DSM 16646]
          Length = 394

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 171/399 (42%), Positives = 248/399 (62%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D  D++G R L+RVD+NVP  D G + D TRI   +PTI  LV ++AKV++ S
Sbjct: 1   MNKKTVEDF-DVKGRRVLVRVDFNVPMDDRGTITDDTRIRAALPTIEYLVNREAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K +   SL  V      +L + ++   DCIG  + +++AS+  G ++L ENVR
Sbjct: 60  HLGRPKGKFNPKYSLAPVARRLSELLGREVIMAEDCIGGKVEKAVASMKPGDVMLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY+EEE ND  F   L++  D YINDAF  +HRAHAS  G++  LP+  G  M+KE+  +
Sbjct: 120 FYAEEEANDRGFAEKLAKLADIYINDAFGTAHRAHASTAGVAEFLPAGAGFLMKKEIETM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +FL + G  +G SL 
Sbjct: 180 GRALENPDRPFVAILGGAKVSDKIGVIKNLLGKVDHLLIGGGMAFTFLKSMGYNIGMSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  EA++   E+++P DVVVA E+K G+  + V    +P D I +D+G  
Sbjct: 240 EEDKVELAASLLEEARKKGVEVLLPVDVVVAPEIKEGVGYRTVPVSEIPDDMIGVDIGEA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   +VI +A TV+WNGP+GVFEI  F   T+ VA  +A    E   ++I GGGD+  
Sbjct: 300 TRERFAEVIKKAGTVVWNGPMGVFEIRAFAEGTLAVARAMA----ESGAVTIVGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G ++  T++ST GGA LE+LEGK+LPG+  L+  
Sbjct: 356 AVEQLGFADSMTHISTGGGASLEFLEGKELPGVAVLNDK 394


>gi|163942822|ref|YP_001647706.1| phosphoglycerate kinase [Bacillus weihenstephanensis KBAB4]
 gi|229014295|ref|ZP_04171414.1| Phosphoglycerate kinase [Bacillus mycoides DSM 2048]
 gi|229062779|ref|ZP_04200084.1| Phosphoglycerate kinase [Bacillus cereus AH603]
 gi|229135939|ref|ZP_04264700.1| Phosphoglycerate kinase [Bacillus cereus BDRD-ST196]
 gi|229169839|ref|ZP_04297535.1| Phosphoglycerate kinase [Bacillus cereus AH621]
 gi|229620032|sp|A9VQ51|PGK_BACWK RecName: Full=Phosphoglycerate kinase
 gi|163865019|gb|ABY46078.1| Phosphoglycerate kinase [Bacillus weihenstephanensis KBAB4]
 gi|228613553|gb|EEK70682.1| Phosphoglycerate kinase [Bacillus cereus AH621]
 gi|228647481|gb|EEL03555.1| Phosphoglycerate kinase [Bacillus cereus BDRD-ST196]
 gi|228716539|gb|EEL68242.1| Phosphoglycerate kinase [Bacillus cereus AH603]
 gi|228746895|gb|EEL96779.1| Phosphoglycerate kinase [Bacillus mycoides DSM 2048]
          Length = 394

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  L+E+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLIEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      TQ+V   S+P     +D+G KT
Sbjct: 240 NDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSTWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|167037150|ref|YP_001664728.1| phosphoglycerate kinase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115569|ref|YP_004185728.1| phosphoglycerate kinase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326390584|ref|ZP_08212140.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus JW 200]
 gi|166855984|gb|ABY94392.1| Phosphoglycerate kinase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928660|gb|ADV79345.1| Phosphoglycerate kinase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993409|gb|EGD51845.1| Phosphoglycerate kinase [Thermoanaerobacter ethanolicus JW 200]
          Length = 393

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 167/396 (42%), Positives = 255/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+   AKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINHNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K ++   D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKVNPEYSLKPVAKRLSELLGKQVIMAEDVIGDDAKTKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDTQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPQDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T  +A  +++     +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGTEAIAKALSEC----KGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLNDK 393


>gi|229164075|ref|ZP_04292012.1| Phosphoglycerate kinase [Bacillus cereus R309803]
 gi|228619458|gb|EEK76347.1| Phosphoglycerate kinase [Bacillus cereus R309803]
          Length = 394

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G+SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGQSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      TQ+V   S+P     +D+G KT
Sbjct: 240 NDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSTWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|152977356|ref|YP_001376873.1| phosphoglycerate kinase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189036807|sp|A7GUS0|PGK_BACCN RecName: Full=Phosphoglycerate kinase
 gi|152026108|gb|ABS23878.1| Phosphoglycerate kinase [Bacillus cytotoxicus NVH 391-98]
          Length = 394

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 153/398 (38%), Positives = 239/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKDGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V      +L K++   ++  G  + + +A+++EG I++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAVRLGELLGKDVKKADEAFGPAVQEMVAAMNEGDILVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVAGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMALAKEKGVNFYMPVDVVITEEFSETATTKIVDIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSNGTRAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|212640337|ref|YP_002316857.1| phosphoglycerate kinase [Anoxybacillus flavithermus WK1]
 gi|226699789|sp|B7GL27|PGK_ANOFW RecName: Full=Phosphoglycerate kinase
 gi|212561817|gb|ACJ34872.1| 3-phosphoglycerate kinase [Anoxybacillus flavithermus WK1]
          Length = 394

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G R   RVD+NVP  +G V D TRI   +PTI  L+E+ AKV++ SH
Sbjct: 1   MNKKTVRDI-DVKGKRVFCRVDFNVPMQNGVVTDDTRIRAALPTIQYLMEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L K ++  ++  G T+  +IA ++EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEEMRLNAVAERLSELLGKRVVKTDEAYGDTVKAAIAEMNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTEGIAHHLPAVAGFLMEKEIEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  +G+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKALGHEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D       +AK       +P D VVA +       +VV+   +P D   LD+G KT
Sbjct: 240 EDKIDLAKSFMEKAKEKGVNFYMPVDAVVADDFSNDANKKVVNIDEIPSDWEGLDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI +++ V+WNGP+GVFE++ F   T  VA  +A     +   ++ GGGD+  A
Sbjct: 300 RELYRDVILKSKLVIWNGPMGVFEMDAFAEGTKAVAQALADA---KDTYTVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++N+  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 357 VEKFGLANKMDHISTGGGASLEFMEGKQLPGVVALNDK 394


>gi|313893606|ref|ZP_07827175.1| phosphoglycerate kinase [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441877|gb|EFR60300.1| phosphoglycerate kinase [Veillonella sp. oral taxon 158 str. F0412]
          Length = 393

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 155/397 (39%), Positives = 245/397 (61%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M + +T+  L+ +      +RVD+NVP  DG + D TRI   +PTI  LVE+ AKV++ S
Sbjct: 1   MMK-QTIEGLQ-VANKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLVEQGAKVILAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL         +++K + FV+DCIG  + +++ +L  G I++ EN+R
Sbjct: 59  HFGRPKGERKPEMSLAPCAKHLSELINKPVAFVDDCIGPKVEEAVKALQPGDILMLENLR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++EE +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L
Sbjct: 119 YHNEETKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIDAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +     K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL 
Sbjct: 179 SAAVVHPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLF 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +         +  EA+ +  +++ P D VVA        T++V    +    ++LD+G K
Sbjct: 239 EEGQEAIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIVDVDQIEDGWMVLDIGPK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   + +A  +T++WNGP+GVFE+E F   T  VA  V     E   ++I GGGD++ 
Sbjct: 299 TRELYVEALAPMKTIIWNGPMGVFEMENFAAGTNAVAKAVV----ESDAMTIVGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           A+  +G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 355 AIEKSGLADKISHISTGGGASLEFLEGKILPGIAALS 391


>gi|229158702|ref|ZP_04286760.1| Phosphoglycerate kinase [Bacillus cereus ATCC 4342]
 gi|228624686|gb|EEK81455.1| Phosphoglycerate kinase [Bacillus cereus ATCC 4342]
          Length = 394

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVATMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|297531310|ref|YP_003672585.1| phosphoglycerate kinase [Geobacillus sp. C56-T3]
 gi|297254562|gb|ADI28008.1| Phosphoglycerate kinase [Geobacillus sp. C56-T3]
          Length = 394

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 161/398 (40%), Positives = 239/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ ++RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SH
Sbjct: 1   MNKKTIRDV-EVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA        T+VV+  ++P D   LD+G KT
Sbjct: 240 EDKIELAKSFMKKAKEKGVRFYMPVDVVVADRFANDANTKVVAIDAIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI Q++ V+WNGP+GVFE+E F   T  +A  +A+        S+ GGGD+  A
Sbjct: 300 RELYRDVIRQSKLVVWNGPMGVFEMEAFAHGTRAIAEALAEAP---DTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++  ++ST GGA LE++EGK LPG+VAL   
Sbjct: 357 VEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK 394


>gi|89897587|ref|YP_521074.1| hypothetical protein DSY4841 [Desulfitobacterium hafniense Y51]
 gi|89337035|dbj|BAE86630.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 395

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/399 (41%), Positives = 251/399 (62%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIF 59
           M   + + D+  ++G R  +RVD+NVP  D G + + TRI   +PTI  L+++ AK+++ 
Sbjct: 1   MMNKKGLKDIA-VQGKRVFVRVDFNVPMDDHGNITNDTRIRAALPTIDYLIDEGAKIILA 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+ K D + SL  V      +L + +    DCIG  + ++ A L EG ++L ENV
Sbjct: 60  SHLGRPKGKPDPNYSLAPVAKRLGELLKRPVAMATDCIGPEVEKAAAQLQEGEVLLLENV 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+++EEE+N+P+FV+ L+R  + Y+NDAF  +HRAHAS  G++H LP   G  +QKE+  
Sbjct: 120 RYHAEEEKNEPEFVKQLARLAEVYVNDAFGTAHRAHASTEGIAHHLPGVAGFLLQKEIES 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL
Sbjct: 180 MGKALENPERPFVAIIGGAKVSDKIGVIENLLHKVDALIIGGGMANTFLKAQGYSLGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D      +I  + +    +I++P+DVV A+E K   P +V   + +  D + LD+G 
Sbjct: 240 VEGDKLSLAQEILEQGRELQVDILLPQDVVAAKEFKADAPYRVTPVREIAEDEMALDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++       I +ART++WNGP+GVFE+E F + T +VA  VA        ++I GGGD++
Sbjct: 300 ESAGLFSARIQKARTIVWNGPMGVFEMEQFAKGTEKVAQAVALCPG----LTIVGGGDSV 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            A+   G+  + +++ST GGA L+ LEGK LPGI AL  
Sbjct: 356 AAVEKMGVGEQMSHISTGGGASLKLLEGKTLPGIAALQN 394


>gi|47567345|ref|ZP_00238058.1| phosphoglycerate kinase [Bacillus cereus G9241]
 gi|229094224|ref|ZP_04225303.1| Phosphoglycerate kinase [Bacillus cereus Rock3-42]
 gi|47555966|gb|EAL14304.1| phosphoglycerate kinase [Bacillus cereus G9241]
 gi|228689216|gb|EEL43038.1| Phosphoglycerate kinase [Bacillus cereus Rock3-42]
          Length = 394

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|217962607|ref|YP_002341179.1| phosphoglycerate kinase [Bacillus cereus AH187]
 gi|229141860|ref|ZP_04270387.1| Phosphoglycerate kinase [Bacillus cereus BDRD-ST26]
 gi|226699793|sp|B7HW55|PGK_BACC7 RecName: Full=Phosphoglycerate kinase
 gi|217066927|gb|ACJ81177.1| phosphoglycerate kinase [Bacillus cereus AH187]
 gi|228641616|gb|EEK97920.1| Phosphoglycerate kinase [Bacillus cereus BDRD-ST26]
          Length = 394

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V+  S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVNIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF + T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSQGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|229099562|ref|ZP_04230490.1| Phosphoglycerate kinase [Bacillus cereus Rock3-29]
 gi|229105737|ref|ZP_04236366.1| Phosphoglycerate kinase [Bacillus cereus Rock3-28]
 gi|229118627|ref|ZP_04247979.1| Phosphoglycerate kinase [Bacillus cereus Rock1-3]
 gi|228664819|gb|EEL20309.1| Phosphoglycerate kinase [Bacillus cereus Rock1-3]
 gi|228677626|gb|EEL31874.1| Phosphoglycerate kinase [Bacillus cereus Rock3-28]
 gi|228683858|gb|EEL37808.1| Phosphoglycerate kinase [Bacillus cereus Rock3-29]
          Length = 394

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      TQ+V   S+P     +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSTWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|218900259|ref|YP_002448670.1| phosphoglycerate kinase [Bacillus cereus G9842]
 gi|228903611|ref|ZP_04067732.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 4222]
 gi|228910946|ref|ZP_04074755.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 200]
 gi|228968218|ref|ZP_04129217.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|229032750|ref|ZP_04188710.1| Phosphoglycerate kinase [Bacillus cereus AH1271]
 gi|226699791|sp|B7IP23|PGK_BACC2 RecName: Full=Phosphoglycerate kinase
 gi|218541560|gb|ACK93954.1| phosphoglycerate kinase [Bacillus cereus G9842]
 gi|228728577|gb|EEL79593.1| Phosphoglycerate kinase [Bacillus cereus AH1271]
 gi|228791481|gb|EEM39084.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228848897|gb|EEM93742.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 200]
 gi|228856040|gb|EEN00579.1| Phosphoglycerate kinase [Bacillus thuringiensis IBL 4222]
          Length = 394

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      TQ+V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|134298012|ref|YP_001111508.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
 gi|134050712|gb|ABO48683.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
          Length = 393

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/395 (42%), Positives = 250/395 (63%), Gaps = 5/395 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ ++  ++G R  +RVD+NVP    K+ D TRI++ +PTI  LVE+ A+V++ SH
Sbjct: 1   MNKKTLREIA-VKGKRVFVRVDFNVPLDGDKITDDTRIQKALPTIQYLVEQGARVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  +   L  V      +L K +L VND +G  + Q +A + EG ++L ENVRF
Sbjct: 60  LGRPKGEVVEKYRLTPVAQRLSELLGKQVLKVNDSVGQEVLQVVAGMDEGDVVLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ E +ND  + R L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KELSML 
Sbjct: 120 YAAETKNDEQYARQLAELADIYVNDAFGAAHRAHASTAGIARFLPAVAGFLMEKELSMLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL+AQG  +G SL +
Sbjct: 180 QAVTTPQRPFVAIIGGAKVSDKIGVIENLLNKVDVLIIGGGMANTFLMAQGYRIGNSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D      ++   AK    ++++P DV+VA+ M+  +  QVV    +P   + LD+G +T
Sbjct: 240 ADKVKLAAELIERAKARQVQLLLPTDVLVAQTMEPEVEQQVVPVTGIPEQWMALDIGPET 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
                  +  A TV+WNGP+GVFE+E F + T  VA  +A+        SI GGGD++ A
Sbjct: 300 AANFAAAVKSAATVVWNGPMGVFEMEAFAKGTEAVAKALAEAP----ATSIVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G++++ +++ST GGA LE+LEGK+LPG+ AL
Sbjct: 356 INKIGLAHKISHISTGGGASLEFLEGKELPGVAAL 390


>gi|42784287|ref|NP_981534.1| phosphoglycerate kinase [Bacillus cereus ATCC 10987]
 gi|52783759|sp|P62409|PGK_BACC1 RecName: Full=Phosphoglycerate kinase
 gi|42740218|gb|AAS44142.1| phosphoglycerate kinase [Bacillus cereus ATCC 10987]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V+  S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVNIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|228988361|ref|ZP_04148453.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228771342|gb|EEM19816.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF + T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSQGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|30265164|ref|NP_847541.1| phosphoglycerate kinase [Bacillus anthracis str. Ames]
 gi|47530678|ref|YP_022027.1| phosphoglycerate kinase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187974|ref|YP_031227.1| phosphoglycerate kinase [Bacillus anthracis str. Sterne]
 gi|65317110|ref|ZP_00390069.1| COG0126: 3-phosphoglycerate kinase [Bacillus anthracis str. A2012]
 gi|165869870|ref|ZP_02214527.1| phosphoglycerate kinase [Bacillus anthracis str. A0488]
 gi|167635299|ref|ZP_02393614.1| phosphoglycerate kinase [Bacillus anthracis str. A0442]
 gi|170687994|ref|ZP_02879207.1| phosphoglycerate kinase [Bacillus anthracis str. A0465]
 gi|170707816|ref|ZP_02898267.1| phosphoglycerate kinase [Bacillus anthracis str. A0389]
 gi|177652962|ref|ZP_02935289.1| phosphoglycerate kinase [Bacillus anthracis str. A0174]
 gi|190567685|ref|ZP_03020597.1| phosphoglycerate kinase [Bacillus anthracis Tsiankovskii-I]
 gi|227817897|ref|YP_002817906.1| phosphoglycerate kinase [Bacillus anthracis str. CDC 684]
 gi|229603934|ref|YP_002869358.1| phosphoglycerate kinase [Bacillus anthracis str. A0248]
 gi|254686435|ref|ZP_05150294.1| phosphoglycerate kinase [Bacillus anthracis str. CNEVA-9066]
 gi|254724434|ref|ZP_05186218.1| phosphoglycerate kinase [Bacillus anthracis str. A1055]
 gi|254735641|ref|ZP_05193348.1| phosphoglycerate kinase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254744272|ref|ZP_05201952.1| phosphoglycerate kinase [Bacillus anthracis str. Kruger B]
 gi|254755570|ref|ZP_05207603.1| phosphoglycerate kinase [Bacillus anthracis str. Vollum]
 gi|254757025|ref|ZP_05209053.1| phosphoglycerate kinase [Bacillus anthracis str. Australia 94]
 gi|46576770|sp|Q81X75|PGK_BACAN RecName: Full=Phosphoglycerate kinase
 gi|254782185|sp|C3P0A6|PGK_BACAA RecName: Full=Phosphoglycerate kinase
 gi|254782186|sp|C3LDI3|PGK_BACAC RecName: Full=Phosphoglycerate kinase
 gi|30259841|gb|AAP29027.1| phosphoglycerate kinase [Bacillus anthracis str. Ames]
 gi|47505826|gb|AAT34502.1| phosphoglycerate kinase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181901|gb|AAT57277.1| phosphoglycerate kinase [Bacillus anthracis str. Sterne]
 gi|164714193|gb|EDR19713.1| phosphoglycerate kinase [Bacillus anthracis str. A0488]
 gi|167529342|gb|EDR92094.1| phosphoglycerate kinase [Bacillus anthracis str. A0442]
 gi|170127373|gb|EDS96249.1| phosphoglycerate kinase [Bacillus anthracis str. A0389]
 gi|170668103|gb|EDT18853.1| phosphoglycerate kinase [Bacillus anthracis str. A0465]
 gi|172081737|gb|EDT66807.1| phosphoglycerate kinase [Bacillus anthracis str. A0174]
 gi|190561101|gb|EDV15074.1| phosphoglycerate kinase [Bacillus anthracis Tsiankovskii-I]
 gi|227003270|gb|ACP13013.1| phosphoglycerate kinase [Bacillus anthracis str. CDC 684]
 gi|229268342|gb|ACQ49979.1| phosphoglycerate kinase [Bacillus anthracis str. A0248]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI L+ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGLIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|118480175|ref|YP_897326.1| phosphoglycerate kinase [Bacillus thuringiensis str. Al Hakam]
 gi|196032767|ref|ZP_03100180.1| phosphoglycerate kinase [Bacillus cereus W]
 gi|196039403|ref|ZP_03106708.1| phosphoglycerate kinase [Bacillus cereus NVH0597-99]
 gi|196045582|ref|ZP_03112812.1| phosphoglycerate kinase [Bacillus cereus 03BB108]
 gi|218906311|ref|YP_002454145.1| phosphoglycerate kinase [Bacillus cereus AH820]
 gi|225867084|ref|YP_002752462.1| phosphoglycerate kinase [Bacillus cereus 03BB102]
 gi|228948841|ref|ZP_04111116.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229124639|ref|ZP_04253824.1| Phosphoglycerate kinase [Bacillus cereus 95/8201]
 gi|229187347|ref|ZP_04314490.1| Phosphoglycerate kinase [Bacillus cereus BGSC 6E1]
 gi|166985644|sp|A0RKS6|PGK_BACAH RecName: Full=Phosphoglycerate kinase
 gi|226699790|sp|B7JFG6|PGK_BACC0 RecName: Full=Phosphoglycerate kinase
 gi|254782187|sp|C1EZA3|PGK_BACC3 RecName: Full=Phosphoglycerate kinase
 gi|118419400|gb|ABK87819.1| phosphoglycerate kinase [Bacillus thuringiensis str. Al Hakam]
 gi|195994196|gb|EDX58151.1| phosphoglycerate kinase [Bacillus cereus W]
 gi|196023413|gb|EDX62090.1| phosphoglycerate kinase [Bacillus cereus 03BB108]
 gi|196029563|gb|EDX68165.1| phosphoglycerate kinase [Bacillus cereus NVH0597-99]
 gi|218535171|gb|ACK87569.1| phosphoglycerate kinase [Bacillus cereus AH820]
 gi|225786464|gb|ACO26681.1| phosphoglycerate kinase [Bacillus cereus 03BB102]
 gi|228596051|gb|EEK53728.1| Phosphoglycerate kinase [Bacillus cereus BGSC 6E1]
 gi|228658979|gb|EEL14634.1| Phosphoglycerate kinase [Bacillus cereus 95/8201]
 gi|228810803|gb|EEM57149.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|229026574|ref|ZP_04182923.1| Phosphoglycerate kinase [Bacillus cereus AH1272]
 gi|228734751|gb|EEL85396.1| Phosphoglycerate kinase [Bacillus cereus AH1272]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQKMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      TQ+V   S+P     +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSTWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|323141817|ref|ZP_08076683.1| triose-phosphate isomerase [Phascolarctobacterium sp. YIT 12067]
 gi|322413709|gb|EFY04562.1| triose-phosphate isomerase [Phascolarctobacterium sp. YIT 12067]
          Length = 641

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/396 (41%), Positives = 246/396 (62%), Gaps = 6/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ DL D+ G + L+RVD+NVP  D G++ D TRI   +PTI  L+E+KA V++ +
Sbjct: 1   MDKKTVRDL-DVAGKKVLVRVDFNVPLNDKGEITDDTRITASLPTIQYLLEQKAAVILMA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K ILF  DC+G     + + L  G I+L EN+R
Sbjct: 60  HLGRPKGQVKPELSLAPVAKHLGKLLGKKILFAPDCVGEAAQAAASKLKPGHILLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+ND +F   L+   D Y+ND F VSHRAHAS+ G++H LP+  G  ++KE+  +
Sbjct: 120 FHKEEEKNDMEFAEKLASLADLYVNDGFGVSHRAHASVEGVTHFLPAAAGFLLEKEIQYV 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +    P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL 
Sbjct: 180 GQAVTNPLHPFVAIIGGAKVSDKIGVISNLLDKVDTLLIGGGMANTFLAAQGYKMGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D   ++  +AK++   +++P D+V+A              +++    + LD+G +
Sbjct: 240 EEDKLDLAKELLAKAKKNKVNMLLPTDLVMAAAFAPDAEHVTEKVKNLNQAYMALDIGAE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T +   + +A A+ ++WNGP+GVFE++ F + T  VA  VAK     R  SI GGGD++ 
Sbjct: 300 TSKAYAEALADAKMIVWNGPMGVFEMDAFCKGTEAVAKAVAK----SRATSIVGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++   T++ST GGA LE+LEGK LPG+ AL
Sbjct: 356 AIEKLGLAKRITHISTGGGASLEYLEGKVLPGVAAL 391


>gi|219670714|ref|YP_002461149.1| phosphoglycerate kinase [Desulfitobacterium hafniense DCB-2]
 gi|219540974|gb|ACL22713.1| Phosphoglycerate kinase [Desulfitobacterium hafniense DCB-2]
          Length = 395

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/399 (41%), Positives = 251/399 (62%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIF 59
           M   + + D+  ++G R  +RVD+NVP  D G + + TRI   +PTI  L+++ AK+++ 
Sbjct: 1   MMNKKGLKDIA-VQGKRVFVRVDFNVPMDDHGNITNDTRIRAALPTIHYLIDEGAKIILA 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+ K D + SL  V      +L + +    DCIG  + ++ A L EG ++L ENV
Sbjct: 60  SHLGRPKGKPDPNYSLAPVAKRLGELLKRPVAMATDCIGPEVEKAAAQLQEGEVLLLENV 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+++EEE+N+P+FV+ L+R  + Y+NDAF  +HRAHAS  G++H LP   G  +QKE+  
Sbjct: 120 RYHAEEEKNEPEFVKQLARLAEVYVNDAFGTAHRAHASTEGIAHHLPGVAGFLLQKEIES 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL
Sbjct: 180 MGKALENPERPFVAIIGGAKVSDKIGVIENLLHKVDALIIGGGMANTFLKAQGYSLGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D      +I  + +    +I++P+DVV A+E K   P +V   + +  D + LD+G 
Sbjct: 240 VEGDKLSLAQEILEQGRELQVDILLPQDVVAAKEFKADAPYRVTPVREIAEDEMALDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++       I +ART++WNGP+GVFE+E F + T +VA  VA        ++I GGGD++
Sbjct: 300 ESAGLFSARIQKARTIVWNGPMGVFEMEQFAKGTEKVAQAVALCPG----LTIVGGGDSV 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            A+   G+  + +++ST GGA L+ LEGK LPGI AL  
Sbjct: 356 AAVEKMGVGEQMSHISTGGGASLKLLEGKTLPGIAALQN 394


>gi|20808180|ref|NP_623351.1| phosphoglycerate kinase [Thermoanaerobacter tengcongensis MB4]
 gi|22095976|sp|Q8R965|PGK_THETN RecName: Full=Phosphoglycerate kinase
 gi|20516772|gb|AAM24955.1| 3-phosphoglycerate kinase [Thermoanaerobacter tengcongensis MB4]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 170/399 (42%), Positives = 255/399 (63%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFS 60
            + +T+ D+ D+ G R L+RVD+NVP  + K + D  RI   +PTI  L+   AKV++ S
Sbjct: 1   MKKKTVRDI-DVSGKRVLVRVDFNVPMDENKNITDDRRIREALPTIEYLINHNAKVILVS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K + D SL  V      +L K ++   D IG       A+L EG ++L ENVR
Sbjct: 60  HLGRPKGKFNPDYSLKPVAKRLSELLKKPVIMAEDVIGEDAKVKAAALKEGEVLLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KELS++
Sbjct: 120 FHAEEEKNDPEFAKELASLADIYVNDAFGTAHRAHASTAGVAKYLPAVAGFLIEKELSIM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL 
Sbjct: 180 GEALENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   +I  +AK+     ++P D V+A+E+K+G+P +VV    +P D I +D+G K
Sbjct: 240 EEDKIELAKEIMEKAKQKGVNFMLPVDTVIAKELKSGVPYEVVDIDKMPEDQIGVDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+E   +VI  A TV+WNGP+GVFEI  F + T  +A  +++     +  +I GGGD+  
Sbjct: 300 TIEEYSKVIKHAMTVVWNGPMGVFEIPEFAKGTKAIAKALSEC----KGTTIVGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 356 AIEQLGYADKVTHISTGGGASLEFLEGKVLPGIDILNDK 394


>gi|229175801|ref|ZP_04303307.1| Phosphoglycerate kinase [Bacillus cereus MM3]
 gi|228607752|gb|EEK65068.1| Phosphoglycerate kinase [Bacillus cereus MM3]
          Length = 394

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++  L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRYLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      TQ+V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTQIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---ENTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|450686|emb|CAA53187.1| 3-phosphoglycerate kinase [Thermotoga maritima MSB8]
          Length = 390

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 158/392 (40%), Positives = 248/392 (63%), Gaps = 4/392 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ S
Sbjct: 1   MEKM-TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN R
Sbjct: 59  HLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V ++GG+KVS KI ++ NL++K ++++IGG M  +FL A G  VG S  
Sbjct: 179 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKANRILIGGAMMFTFLKALGKEVGSSRV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G 
Sbjct: 239 EEDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T+E  KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+ 
Sbjct: 299 ETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLP 391
            A+   G+ ++F++VST GGA LE+LEGK+LP
Sbjct: 358 AAVNKFGLEDKFSHVSTGGGASLEFLEGKELP 389


>gi|238019089|ref|ZP_04599515.1| hypothetical protein VEIDISOL_00951 [Veillonella dispar ATCC 17748]
 gi|237864344|gb|EEP65634.1| hypothetical protein VEIDISOL_00951 [Veillonella dispar ATCC 17748]
          Length = 392

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 154/395 (38%), Positives = 248/395 (62%), Gaps = 6/395 (1%)

Query: 4   LR-TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ T++ L+ +      +RVD+NVP  DG + D TRI   +PTI  L+EK AKV++ SH 
Sbjct: 1   MKLTIDGLQ-VDNKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLIEKGAKVILASHF 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + SL         +++K + FV+DCIG  + +++ +L  G +++ EN+R++
Sbjct: 60  GRPKGERKPEMSLAPCAKHLSELINKPVAFVDDCIGHKVEEAVKALQPGDVLMLENLRYH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           +EE +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +
Sbjct: 120 NEETKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIEALSA 179

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL + 
Sbjct: 180 AVVHPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLFEE 239

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                   +  EA+ +  +++ P D VVA        T++V  +++    ++LD+G KT 
Sbjct: 240 GQEAIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIVDVENIEDGWMVLDIGPKTR 299

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           E   + +A  +T++WNGP+GVFE+E F   T  VA  VA    E   ++I GGGD++ A+
Sbjct: 300 ELYVEALAPMKTIIWNGPMGVFEMENFAAGTNAVAKAVA----ESDAMTIVGGGDSVAAI 355

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             +G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 356 EKSGLADKISHISTGGGASLEFLEGKILPGIAALS 390


>gi|218233044|ref|YP_002369909.1| phosphoglycerate kinase [Bacillus cereus B4264]
 gi|228923847|ref|ZP_04087125.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228955367|ref|ZP_04117373.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|229049791|ref|ZP_04194348.1| Phosphoglycerate kinase [Bacillus cereus AH676]
 gi|229072585|ref|ZP_04205787.1| Phosphoglycerate kinase [Bacillus cereus F65185]
 gi|229082344|ref|ZP_04214807.1| Phosphoglycerate kinase [Bacillus cereus Rock4-2]
 gi|229112546|ref|ZP_04242083.1| Phosphoglycerate kinase [Bacillus cereus Rock1-15]
 gi|229130383|ref|ZP_04259341.1| Phosphoglycerate kinase [Bacillus cereus BDRD-Cer4]
 gi|229147664|ref|ZP_04276007.1| Phosphoglycerate kinase [Bacillus cereus BDRD-ST24]
 gi|229153288|ref|ZP_04281466.1| Phosphoglycerate kinase [Bacillus cereus m1550]
 gi|229181393|ref|ZP_04308721.1| Phosphoglycerate kinase [Bacillus cereus 172560W]
 gi|229193866|ref|ZP_04320789.1| Phosphoglycerate kinase [Bacillus cereus ATCC 10876]
 gi|296505557|ref|YP_003667257.1| phosphoglycerate kinase [Bacillus thuringiensis BMB171]
 gi|226699792|sp|B7HED5|PGK_BACC4 RecName: Full=Phosphoglycerate kinase
 gi|218161001|gb|ACK60993.1| phosphoglycerate kinase [Bacillus cereus B4264]
 gi|228589604|gb|EEK47500.1| Phosphoglycerate kinase [Bacillus cereus ATCC 10876]
 gi|228601968|gb|EEK59461.1| Phosphoglycerate kinase [Bacillus cereus 172560W]
 gi|228629892|gb|EEK86543.1| Phosphoglycerate kinase [Bacillus cereus m1550]
 gi|228635677|gb|EEK92164.1| Phosphoglycerate kinase [Bacillus cereus BDRD-ST24]
 gi|228653082|gb|EEL08962.1| Phosphoglycerate kinase [Bacillus cereus BDRD-Cer4]
 gi|228670926|gb|EEL26233.1| Phosphoglycerate kinase [Bacillus cereus Rock1-15]
 gi|228700776|gb|EEL53299.1| Phosphoglycerate kinase [Bacillus cereus Rock4-2]
 gi|228710561|gb|EEL62534.1| Phosphoglycerate kinase [Bacillus cereus F65185]
 gi|228722704|gb|EEL74092.1| Phosphoglycerate kinase [Bacillus cereus AH676]
 gi|228804314|gb|EEM50927.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228835976|gb|EEM81339.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|296326609|gb|ADH09537.1| phosphoglycerate kinase [Bacillus thuringiensis BMB171]
          Length = 394

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|56964784|ref|YP_176515.1| phosphoglycerate kinase [Bacillus clausii KSM-K16]
 gi|81678804|sp|Q5WDK6|PGK_BACSK RecName: Full=Phosphoglycerate kinase
 gi|56911027|dbj|BAD65554.1| 3-phosphoglycerate kinase [Bacillus clausii KSM-K16]
          Length = 394

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 159/398 (39%), Positives = 242/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D  D  G     RVD+NVP  DGK+ D TRI+  +PTI  L E+ A+V++ SH
Sbjct: 1   MNKKTLYD-YDFAGKTVFCRVDFNVPMKDGKITDETRIQAALPTIKYLSEQGARVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  +   L  V +    +L K +  V +  G    Q++  L +GG++L ENVRF
Sbjct: 60  LGRPKGEVVESLRLAPVATRLSELLGKEVQAVQEAHGPVAKQAVEGLEDGGVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LPS  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFASLADIFVNDAFGAAHRAHASTEGIAHYLPSAAGFLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  A++GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  VG+SL +
Sbjct: 180 KALSNPERPFTAVIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFVKAQGYEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   Q   +A++   +  +P DV+VA +       + V+   +P D   LD+G KT
Sbjct: 240 EDKLDLAKQFMEKAEQKGVKFYMPEDVIVADDFSDDANKKEVAISGIPADWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +  + V+  ++ V+WNGP+GVFE+E F   T  VA+ +A+        S+ GGGD+  A
Sbjct: 300 RKTYEAVLKASKLVIWNGPMGVFELESFAGGTKAVANALAEA---SDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+VALS  
Sbjct: 357 VEQFGLADKMSHISTGGGASLEFMEGKELPGVVALSEK 394


>gi|49478894|ref|YP_039126.1| phosphoglycerate kinase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|81696598|sp|Q6HBF0|PGK_BACHK RecName: Full=Phosphoglycerate kinase
 gi|49330450|gb|AAT61096.1| phosphoglycerate kinase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 394

 Score =  384 bits (987), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 242/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF + T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSQGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|228917741|ref|ZP_04081282.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228961359|ref|ZP_04122974.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|301056597|ref|YP_003794808.1| phosphoglycerate kinase [Bacillus anthracis CI]
 gi|228798317|gb|EEM45315.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228841978|gb|EEM87084.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|300378766|gb|ADK07670.1| phosphoglycerate kinase [Bacillus cereus biovar anthracis str. CI]
          Length = 394

 Score =  384 bits (987), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF + T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSQGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|58613477|gb|AAW79325.1| phosphoglycerate kinase [Isochrysis galbana]
          Length = 436

 Score =  384 bits (987), Expect = e-105,   Method: Composition-based stats.
 Identities = 165/399 (41%), Positives = 250/399 (62%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +++ DL   D+ G R L+R D NVP     + D TRI   +PTI  L++  AKV++
Sbjct: 37  MAK-KSVGDLTKADLEGKRVLVRCDLNVPLDGKTITDDTRIRASIPTIKYLIDNGAKVLL 95

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+   +   SL  V      +L K +    DCIG  ++  +  ++ G ++L EN
Sbjct: 96  SSHLGRPKGGPEDKFSLGPVAPRLSELLGKEVTMAPDCIGDAVADCVTKMANGDVLLLEN 155

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            RFY EEE+NDP+F   L+ N D ++NDAF  +HRAH S  G++    PS  G  +QKEL
Sbjct: 156 TRFYKEEEKNDPEFAEKLAANADMFVNDAFGTAHRAHGSTEGVTKFLSPSVAGFLLQKEL 215

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+   S+ K+P  AIVGGSKVS+KI ++ +L++KVDK+VIGGGM  +FL A+G+  G 
Sbjct: 216 DYLDGAVSDPKRPFAAIVGGSKVSSKIGVIESLMEKVDKIVIGGGMVFTFLKARGLETGS 275

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +   ++   AK    + I+P DV+VA +      TQ+VS  ++P   + LD 
Sbjct: 276 SLVEEDQLELAKKLEVIAKEKGIDFILPTDVIVADKFAADAATQIVSVDAIPEGWMGLDN 335

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G ++ + I+Q +++ +T++WNGP+GVFE E F + T +VA  +A+LT  +   +I GGGD
Sbjct: 336 GPESTKMIQQKLSECKTIIWNGPMGVFEFEAFAKGTFDVADTLAELTG-KGCTTIIGGGD 394

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 395 SVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 433


>gi|52140431|ref|YP_086398.1| phosphoglycerate kinase [Bacillus cereus E33L]
 gi|81685510|sp|Q631L9|PGK_BACCZ RecName: Full=Phosphoglycerate kinase
 gi|51973900|gb|AAU15450.1| phosphoglycerate kinase [Bacillus cereus E33L]
          Length = 394

 Score =  384 bits (987), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|325291298|ref|YP_004267479.1| phosphoglycerate kinase [Syntrophobotulus glycolicus DSM 8271]
 gi|324966699|gb|ADY57478.1| phosphoglycerate kinase [Syntrophobotulus glycolicus DSM 8271]
          Length = 394

 Score =  384 bits (987), Expect = e-105,   Method: Composition-based stats.
 Identities = 161/396 (40%), Positives = 251/396 (63%), Gaps = 6/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +++ D  D++G R L+RVD+NVP  D GK+ D TRI   +PTI  L EK A+V++ S
Sbjct: 1   MNKKSI-DQVDVKGKRVLVRVDFNVPLDDSGKITDDTRITAALPTIKYLREKGARVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K +   SL  V      +L  ++L   DCIG  +++    LS G ++L ENVR
Sbjct: 60  HLGRPKGKFNPKYSLAPVAGRLSELLKTDVLMAKDCIGPEVAEQAKELSGGQVMLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY EEE+ND  F   L+   + ++NDAF  +HRAHAS  G++  +P+Y G  M+KE+ ++
Sbjct: 120 FYEEEEKNDRSFAGKLAGLAEIFVNDAFGTAHRAHASTEGIAGFIPAYAGFLMKKEVEIM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P VAI+GG+KVS KI ++ +L+ KVD L+IGGGMAN+F+ AQG   G+SL 
Sbjct: 180 GKALENPERPFVAIIGGAKVSDKIAVIDHLISKVDTLIIGGGMANTFIKAQGYETGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +++ +    ++  +AK+   + ++P DVV A++      +++ S + + LD   LD+G  
Sbjct: 240 EKEKTGLAQELLAKAKQKGIKFLLPTDVVAAKDFAPDAQSRITSVKEIALDEQALDIGPD 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +     + I  A+T++WNGP+GVFE+  F + T +VA  VA+     + ++I GGGD++ 
Sbjct: 300 SAAKFAEEIRPAKTLIWNGPMGVFEMPKFAQGTEKVAIAVAEC----QGVTIVGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++++ T+VST GGA LE+LEGK LPG+ AL
Sbjct: 356 AVEKMGVADKITHVSTGGGASLEFLEGKLLPGVAAL 391


>gi|228942271|ref|ZP_04104810.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228975201|ref|ZP_04135759.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981839|ref|ZP_04142134.1| Phosphoglycerate kinase [Bacillus thuringiensis Bt407]
 gi|228777951|gb|EEM26223.1| Phosphoglycerate kinase [Bacillus thuringiensis Bt407]
 gi|228784480|gb|EEM32501.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228817315|gb|EEM63401.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326942926|gb|AEA18822.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 394

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 241/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ ++ ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQAVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALADA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|206976668|ref|ZP_03237573.1| phosphoglycerate kinase [Bacillus cereus H3081.97]
 gi|222098575|ref|YP_002532633.1| phosphoglycerate kinase [Bacillus cereus Q1]
 gi|229199247|ref|ZP_04325924.1| Phosphoglycerate kinase [Bacillus cereus m1293]
 gi|254782188|sp|B9J4M7|PGK_BACCQ RecName: Full=Phosphoglycerate kinase
 gi|206745154|gb|EDZ56556.1| phosphoglycerate kinase [Bacillus cereus H3081.97]
 gi|221242634|gb|ACM15344.1| phosphoglycerate kinase [Bacillus cereus Q1]
 gi|228584229|gb|EEK42370.1| Phosphoglycerate kinase [Bacillus cereus m1293]
 gi|324329041|gb|ADY24301.1| phosphoglycerate kinase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 394

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF + T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSQGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|220932418|ref|YP_002509326.1| Phosphoglycerate kinase [Halothermothrix orenii H 168]
 gi|219993728|gb|ACL70331.1| Phosphoglycerate kinase [Halothermothrix orenii H 168]
          Length = 394

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 168/393 (42%), Positives = 251/393 (63%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D +G R L+RVD+NVP  DGK+ D TRIE  +PTI  LV++ AKV++ SHLGR
Sbjct: 3   KTLKDV-DFKGKRTLVRVDFNVPLEDGKITDDTRIEAALPTIKYLVDEGAKVILMSHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K      L  V      +L K +  V+DCIG    ++++ +  G ++L EN RF++ 
Sbjct: 62  PKGKVVDSLRLDPVAQRLAELLGKEVTKVDDCIGDEPKEAVSEMENGDVLLLENTRFHAG 121

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E++NDPDF R L+   + ++NDAF  +HRAHAS  G++  LPS  G  +Q+EL+ L    
Sbjct: 122 EKKNDPDFARQLAELAEVFVNDAFGAAHRAHASTVGVTEHLPSVAGFLLQRELNALGEAM 181

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
                P VAI+GG+KVS KI ++ NL+ KVD L++GGG+AN+FL+A+G  VG SL + D 
Sbjct: 182 ENPGHPFVAILGGAKVSDKIGVIKNLLDKVDYLLVGGGIANTFLLAKGYEVGDSLVEEDK 241

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV-GFKTVE 303
            +   ++  EA+    ++++P DVV+A E K     +VVSA S+P    ILD  G KT+E
Sbjct: 242 VELAKELLKEAEEKGVDLVLPEDVVIAEEFKEDANHKVVSADSIPEGWQILDSGGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
               +IA+A TV+WNGP+GVFE++ F + T  +A  +A+        ++ GGGD+  A+ 
Sbjct: 302 KYSDIIAKAETVIWNGPIGVFEMDTFAKGTNALAEAMAR----SSARTVIGGGDSAAAVK 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG+ ++ +++ST GGA L + EGK LPG+ AL
Sbjct: 358 KAGLEDKMSHISTGGGASLMFFEGKPLPGVEAL 390


>gi|172058403|ref|YP_001814863.1| phosphoglycerate kinase [Exiguobacterium sibiricum 255-15]
 gi|229620368|sp|B1YLE1|PGK_EXIS2 RecName: Full=Phosphoglycerate kinase
 gi|171990924|gb|ACB61846.1| Phosphoglycerate kinase [Exiguobacterium sibiricum 255-15]
          Length = 394

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 152/399 (38%), Positives = 240/399 (60%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DGK+ D TRI   +PTI  LV+  AKV++ SH
Sbjct: 1   MNKKSIRDI-DVKGKRVFTRVDFNVPLEDGKITDDTRIRAALPTIKHLVDGGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           +GRP+ + + + SL  VV+    +L K+I  V +  G    ++++ L EG +I+ ENVRF
Sbjct: 60  MGRPKGEKNPEFSLAPVVARLSELLGKDIKLVEEAYGPVAEEAVSKLEEGDVIVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSML 180
           Y  E +NDP+     ++  D ++NDAF  +HRAHAS  G++H + + + G  ++KEL +L
Sbjct: 120 YPGETKNDPELAEGFAKLADVFVNDAFGAAHRAHASTEGIAHHVETAVAGLLIEKELQVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S   +P  AI+GGSKV+ KI ++ +L+  VD L+IGGG++ +FL AQG  VG SL 
Sbjct: 180 GKALSNPDRPFTAIIGGSKVADKIGVIDHLLDIVDTLIIGGGLSYTFLKAQGYEVGTSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   +   +A+    + ++P D V+ +E             S+P D + LD+G K
Sbjct: 240 EVDKIEQAKEFMKKAEDKGVKFLMPVDCVITKEFGEETYVGSRDIDSIPADHMSLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVE   + I  ++ V+WNGP+GVFE++ +   T  VA  +A    +    SI GGGD+  
Sbjct: 300 TVELYAEAIKASKLVVWNGPMGVFELDKYANGTKGVAQALA----DSDAYSIIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A    G++++ +++ST GGA LE++EGK LPG+ AL+  
Sbjct: 356 AAEKFGLADKMSHISTGGGASLEFMEGKALPGVEALNDK 394


>gi|217077667|ref|YP_002335385.1| phosphoglycerate kinase [Thermosipho africanus TCF52B]
 gi|226699807|sp|B7IDG7|PGK_THEAB RecName: Full=Phosphoglycerate kinase
 gi|217037522|gb|ACJ76044.1| pgk phosphoglycerate kinase [Thermosipho africanus TCF52B]
          Length = 402

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 249/400 (62%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ D++G R ++RVD+NVP  DG++ D TRI   +PTI   +E  A V++ S
Sbjct: 1   MEKL-TIRDI-DLKGKRVIMRVDFNVPMKDGEITDDTRIVEALPTIKYAIENGAIVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + F+ +  G  +++ + +  EG +IL EN R
Sbjct: 59  HLGRPKGERKPEFSLLPVAKRLSELLGKEVTFIPELYGEIVNEKVKNAKEGDVILLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FDKGETKNDPELAKKWAELADIHVNDAFGTAHRAHASNVGIAQYIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  +KP V ++GG+KVS KI ++ NL+ K DK++IGG M  +FL + G  VG SL 
Sbjct: 179 SKATTNPEKPYVVVLGGAKVSDKIGVITNLLDKADKILIGGAMMFTFLKSLGYNVGSSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   +I  +AK    EI++P D V A++++ G+ T+ +  +  +P   + LD+G 
Sbjct: 239 EDDKLDLAKRILEQAKEKGTEIVLPVDTVCAQKIEAGVETKTIDIKDGLPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KTVE  +  I+ A+T++WNGP+GVFEIE F   T EVA  +A+ T  +   +I GGGD+ 
Sbjct: 299 KTVELFRNSISGAKTIVWNGPMGVFEIEDFSNGTKEVAIAIAEET-SKGATTIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+A  G+ ++ ++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAIAKFGLKDKVSHVSTGGGASLEFLEGKELPGIASIANK 397


>gi|307266212|ref|ZP_07547754.1| Phosphoglycerate kinase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918742|gb|EFN48974.1| Phosphoglycerate kinase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 393

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 167/396 (42%), Positives = 255/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G R L+RVD+NVP  + K + D TRI+  +PTI  L+   AKV++ SHLG
Sbjct: 3   KTVRDI-DVAGKRVLVRVDFNVPMDENKNITDDTRIKAALPTIEYLINHNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + SL  V      +L K ++   D IG       A+L EG ++L ENVRF++
Sbjct: 62  RPKGKVNPEYSLKPVAKRLSELLGKQVIMAEDVIGDDAKAKAAALKEGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND  F + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL+++   
Sbjct: 122 EEEKNDTQFAKELASLADIYVNDAFGTAHRAHASTAGVAAYLPAVSGFLIEKELTIMGEA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGGMAYTFIKAKGYEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   ++  +AK+    +++P D V+A+E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KIELAKELMEKAKQKGVNLMLPVDTVIAKELKSGVPYEVVDIDKMPQDQIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A TV+WNGP+GVFEI  F + T  +A  +++     +  +I GGGD+  A+ 
Sbjct: 302 EYSKVIKHAMTVVWNGPMGVFEIPEFAKGTEAIAKALSEC----KGTTIVGGGDSAAAIE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 358 QLGYADKVTHISTGGGASLEFLEGKVLPGIDVLNDK 393


>gi|228936422|ref|ZP_04099220.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228823254|gb|EEM69088.1| Phosphoglycerate kinase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 394

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 242/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G  + + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF + T  V   +A         S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFSQGTKAVGQALADA---EGTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|218249062|ref|YP_002374433.1| phosphoglycerate kinase [Cyanothece sp. PCC 8801]
 gi|257062149|ref|YP_003140037.1| phosphoglycerate kinase [Cyanothece sp. PCC 8802]
 gi|226699799|sp|B7JVE4|PGK_CYAP8 RecName: Full=Phosphoglycerate kinase
 gi|218169540|gb|ACK68277.1| Phosphoglycerate kinase [Cyanothece sp. PCC 8801]
 gi|256592315|gb|ACV03202.1| Phosphoglycerate kinase [Cyanothece sp. PCC 8802]
          Length = 400

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/399 (40%), Positives = 257/399 (64%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +++ +L   D+ G R L+RVD+NVP     + D TRI   +PTI +L+EK AKV++
Sbjct: 1   MTK-KSIVNLSPADVAGKRVLVRVDFNVPLDGATITDDTRIRAALPTIKDLIEKGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP+ +  +   L  V +    +L + ++  +DCIG +++ +I  L  G + L EN
Sbjct: 60  CSHFGRPKGQVVESMRLTPVATRLSELLGQPVVMCDDCIGDSVTAAINQLQNGQVALLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           +RF++EEE NDP+F + L+ N D Y+NDAF  +HRAHAS  G++H   P+  G  ++KEL
Sbjct: 120 LRFHAEEEANDPEFAQKLAANADLYVNDAFGTAHRAHASTEGVTHYLSPNVAGYLIEKEL 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
           + L++     ++PLVAI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG+
Sbjct: 180 NYLQAAIENPQRPLVAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    + ++P DVV+A         + VS  ++    + LD+
Sbjct: 240 SLVEDDKLELAKSLEAKAKEKGVDFLLPTDVVLADNFAPDANAKTVSIDAIEDGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G ++V+  +  +A  ++V+WNGP+GVFE + F + T  +AH +A+LT  +  I+I GGGD
Sbjct: 300 GPESVKVFQAALADCKSVIWNGPMGVFEFDKFAKGTEAIAHTLAELTG-KGTITIIGGGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+   G++++ +++ST GGA LE LEGK LPGI AL
Sbjct: 359 SVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|51241761|dbj|BAD36768.1| phosphoglycerate kinase, chloroplast precursor [Cyanidioschyzon
           merolae]
          Length = 477

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 170/398 (42%), Positives = 249/398 (62%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
            R+R++ DL+D  IRG R  +R D NVP    ++ D TRI   VPTI  L +K AKV++ 
Sbjct: 78  MRVRSIRDLQDAEIRGKRVFVRSDLNVPLDGKRITDDTRIRASVPTIKYLADKGAKVIVV 137

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   +   SL  V      +L K +    DCIG  ++  +A++S G ++L ENV
Sbjct: 138 SHLGRPKGGFEDKYSLAPVAERLSELLGKKVRMAKDCIGDAVATEVAAMSPGDVVLLENV 197

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELS 178
           RFY EEE+NDPDF R L+ N D Y+NDAF  +HRAHAS  G++  L   + G  ++KEL 
Sbjct: 198 RFYPEEEKNDPDFARKLAANADLYVNDAFGTAHRAHASTEGVTAFLKPAVAGFLLEKELD 257

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +     K+P  AIVGGSKVSTKI +L  L++K D ++IGGGM  +FL A+G+  G S
Sbjct: 258 YLSNAIESPKRPFAAIVGGSKVSTKIAVLEKLLQKCDTIIIGGGMVFTFLRARGLKTGSS 317

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  +    I  EA++   E+++P DVVVA +      T+VV  + +P   + LD G
Sbjct: 318 LVEEDKIELARVIEEEARKRGIELLLPLDVVVADKFANDANTKVVPVEEIPDGWMGLDNG 377

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T   I++ +   +TV+WNGPLGVFE+  F + T  +A  +A++T+    I+I GGGD+
Sbjct: 378 PETTRMIQEKLRTMKTVLWNGPLGVFEMPNFAKGTFAIAETLAEITQ-NGCITIVGGGDS 436

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + A+  +G +++ +++ST GGA LE +EG+ LPG+ AL
Sbjct: 437 VAAMEQSGKADKVSHISTGGGAALELIEGRVLPGVAAL 474


>gi|194015562|ref|ZP_03054178.1| phosphoglycerate kinase [Bacillus pumilus ATCC 7061]
 gi|194012966|gb|EDW22532.1| phosphoglycerate kinase [Bacillus pumilus ATCC 7061]
          Length = 394

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/398 (38%), Positives = 237/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G     RVD+NVP  DGKV D TRI   +PTI  L  + AKV++ SH
Sbjct: 1   MNKKSVKDI-DVKGKVVFCRVDFNVPMKDGKVTDDTRIRAALPTIEYLTGQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V    + +L + +   ++  G  + + I+ L EG +++ ENVRF
Sbjct: 60  LGRPKGQVTEELRLTPVAKRLQELLGQEVKKADEAYGDNVKKQISDLKEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  MQKEL +L 
Sbjct: 120 YPGEEKNDPELSKAFADLADVYVNDAFGAAHRAHASTAGIAAYLPAVSGFLMQKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAISNPDRPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D        AK      ++P DV+VA +      T +V    +P D   LD+G +T
Sbjct: 240 EDKVDLAKSFMDRAKEKGVNFLIPTDVLVADDFSNDANTSIVPISEIPSDLEALDIGTET 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +     VI  ++ V+WNGP+GVFEI+ F + T  +A  +A+    +   S+ GGGD+  A
Sbjct: 300 IGKYADVIKNSKLVVWNGPMGVFEIDAFAKGTKAIAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADQMSHISTGGGASLEFMEGKELPGVTALNDK 394


>gi|157693808|ref|YP_001488270.1| phosphoglycerate kinase [Bacillus pumilus SAFR-032]
 gi|166985722|sp|A8FHJ3|PGK_BACP2 RecName: Full=Phosphoglycerate kinase
 gi|157682566|gb|ABV63710.1| phosphoglycerate kinase [Bacillus pumilus SAFR-032]
          Length = 394

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/398 (38%), Positives = 237/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G     RVD+NVP  DGKV D TRI   +PTI  L  + AKV++ SH
Sbjct: 1   MNKKSVKDI-DVKGKVVFCRVDFNVPMKDGKVTDDTRIRAALPTIEYLTGQGAKVLLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V    + +L + +   ++  G  + + I+ L +G +++ ENVRF
Sbjct: 60  LGRPKGQVTEELRLTPVAKRLQELLGQEVKKADEAYGDNVKKQISDLKDGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  MQKEL +L 
Sbjct: 120 YPGEEKNDPELSKAFADLADVYVNDAFGAAHRAHASTAGIAAYLPAVSGFLMQKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KAISNPDRPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D        AK      ++P DV+VA +      T +V    +P D   LD+G +T
Sbjct: 240 EDKVDLAKSFMDRAKEKGVNFLIPTDVLVADDFSNDANTSIVPISEIPSDLEALDIGTET 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEI+ F + T  +A  +A+    +   S+ GGGD+  A
Sbjct: 300 REKYADVIKNSKLVVWNGPMGVFEIDAFAKGTKAIAEALAEA---KDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFGLADQMSHISTGGGASLEFMEGKELPGVTALNDK 394


>gi|319650514|ref|ZP_08004654.1| phosphoglycerate kinase [Bacillus sp. 2_A_57_CT2]
 gi|317397695|gb|EFV78393.1| phosphoglycerate kinase [Bacillus sp. 2_A_57_CT2]
          Length = 394

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 156/398 (39%), Positives = 237/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ +++G R   RVD+NVP  DG+V D TRI   +PTI  L  + AKV++ SH
Sbjct: 1   MNKKSVKDV-ELKGKRVFCRVDFNVPMKDGQVTDETRIRAALPTIEYLTNQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+    ++  L  V      +L K +   ++  G ++   + +LSEG ++L ENVRF
Sbjct: 60  LGRPKGSVVEELRLTPVAKRLSELLGKEVKKADEAYGDSVKAMVDTLSEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+ND +  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDSELAKAFAELADVYVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ AQG  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIENLLEKVDNLIIGGGLAYTFVKAQGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA +       + V+ + +P D   LD+G KT
Sbjct: 240 EDKIELAKSFMEKAKEKGVNFYMPVDVVVADDFSEEANIKTVAIEEIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE++ F   T  VA  +A+        S+ GGGD+  A
Sbjct: 300 REIYSDVIQNSKLVIWNGPMGVFELKKFAGGTRAVAEALAEA---NDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    +++  +++ST GGA LE++EGK LPG+VAL+  
Sbjct: 357 VEKFHLADRMSHISTGGGASLEFMEGKALPGVVALNDK 394


>gi|206970177|ref|ZP_03231130.1| phosphoglycerate kinase [Bacillus cereus AH1134]
 gi|206734754|gb|EDZ51923.1| phosphoglycerate kinase [Bacillus cereus AH1134]
          Length = 394

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/398 (37%), Positives = 239/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +GK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSIRDV-DLKGKRVFCRVDFNVPMKEGKITDETRIRAALPTIQYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +    +L K++   ++  G    + +A+++EG +++ ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 YAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ +L+ KVD L+IGGG+A +F+ A G  +G SLC+
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIRHLLDKVDNLIIGGGLAYTFVKALGHEIGLSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   +    AK       +P DVV+  E      T++V   S+P +   +D+G KT
Sbjct: 240 DDKIELAKEFMQLAKEKGVNFYMPVDVVITEEFSETATTKIVGIDSIPSNWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFE+ PF   T  V   +          S+ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEMTPFAEGTKAVGQALVDA---EDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++ +++ST GGA LE++EGK+LPG+V L+  
Sbjct: 357 VEKFGMADKMSHISTGGGASLEFMEGKELPGVVCLNDK 394


>gi|269798150|ref|YP_003312050.1| phosphoglycerate kinase [Veillonella parvula DSM 2008]
 gi|269094779|gb|ACZ24770.1| phosphoglycerate kinase [Veillonella parvula DSM 2008]
          Length = 392

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/393 (39%), Positives = 244/393 (62%), Gaps = 5/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+  L+ +      +RVD+NVP  DG + D TRI   +PTI  L+EK AKV++ SH GR
Sbjct: 3   QTIEGLQ-VANKTVFVRVDFNVPMKDGVITDDTRIRSALPTINYLIEKGAKVILASHFGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ +   + SL         +++K + FV+DCIG  + +++ +L  G +++ EN+R+++E
Sbjct: 62  PKGERKPEMSLAPCAKHLSDLINKPVAFVDDCIGPKVEEAVKALQSGDVLMLENLRYHNE 121

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +  
Sbjct: 122 ETKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMAAGFLLKKEIDALSAAI 181

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
              K P+ AI+GG+KV+ KI+++ +L+ KVD ++IGGGMAN+F+ AQG  +G SL +   
Sbjct: 182 VHPKTPMAAIIGGAKVTDKISVISSLLPKVDVMIIGGGMANAFIKAQGCNIGSSLFEEGQ 241

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
                 +  EA+ +  +++ P D VVA        T++V    +    +ILD+G KT E 
Sbjct: 242 EVIATDLVMEARVAGAKLLTPIDAVVADAFSNDANTKIVDVDQIEDGWMILDIGPKTREL 301

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
             + +A  +T++WNGP+GVFE+E F   T  VA  VA    E   ++I GGGD++ A+  
Sbjct: 302 YVEALAPMKTIIWNGPMGVFEMENFAAGTNAVAKAVA----ESDAMTIVGGGDSVAAIEK 357

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +G++++ +++ST GGA LE+LEGK LPGI ALS
Sbjct: 358 SGLADKISHISTGGGASLEFLEGKILPGIAALS 390


>gi|302338946|ref|YP_003804152.1| phosphoglycerate kinase [Spirochaeta smaragdinae DSM 11293]
 gi|301636131|gb|ADK81558.1| Phosphoglycerate kinase [Spirochaeta smaragdinae DSM 11293]
          Length = 395

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/398 (42%), Positives = 247/398 (62%), Gaps = 6/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEK-KAKVVIFS 60
             +RT+ DL D+RG R L+RVD+NVP  +G + D TRI+  +PT+  ++E+  + +VI S
Sbjct: 1   MSIRTVKDL-DLRGKRVLIRVDFNVPLKEGVITDDTRIKAALPTLKYILEQEGSSLVIMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L + +    DCIG  ++   ASL  G I+L ENVR
Sbjct: 60  HLGRPKGEKKPEFSLAPVAKRLSELLGRPVEMAADCIGDAVTSRAASLKAGEILLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +Y+ E +NDPDF + L+  GD Y+NDAF  +HRAHAS  G++  LPS  G  ++KE++  
Sbjct: 120 YYAGETKNDPDFAKKLASLGDVYVNDAFGTAHRAHASTEGVTKFLPSAAGFLIEKEVAFF 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E      + P VAI+GG+KVSTKI +L NL+ K D LVIGGGM  +FL A G  +G+SL 
Sbjct: 180 EPLLKNPEHPFVAIIGGAKVSTKIGVLENLIDKCDTLVIGGGMCYTFLKATGKSIGKSLF 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +F      +  +A++   ++I+P D V A+          V   ++P D I +D+G +
Sbjct: 240 EEEFLKTATDLLKKAEQKGTKVILPLDHVCAKAFSEKETPIAVDGANIPEDLIGMDIGVQ 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+  IK  +A AR+++WNGP+GVFE E + + TVEVA  VA      +  ++ GGGD++ 
Sbjct: 300 TLAEIKNALAGARSIVWNGPMGVFEFEAYAKGTVEVAEMVASC----KGTTVVGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           A+   G ++   +VST GGA LE+LEGK LPGI AL G
Sbjct: 356 AVNKFGFADRIDHVSTGGGASLEFLEGKVLPGIAALEG 393


>gi|304317441|ref|YP_003852586.1| phosphoglycerate kinase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778943|gb|ADL69502.1| Phosphoglycerate kinase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 393

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 164/396 (41%), Positives = 255/396 (64%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D+ G + L+RVD+NVP   +  + D TRI+  +PTI  L++  AKV++ SHLG
Sbjct: 3   KTVRDV-DVSGKKVLVRVDFNVPMDSEKNITDDTRIKAALPTIKYLIDNNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + S+  V      +L+K ++  +D IG        SL +G ++L ENVRF++
Sbjct: 62  RPKGKFNPEYSMKPVAKRLSELLNKPVIMADDVIGEDAKSKANSLKDGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+ND +F + L+   D Y+NDAF  +HRAHAS TG++  LP+  G  ++KEL+ +   
Sbjct: 122 EEEKNDTNFSKELASLADIYVNDAFGTAHRAHASTTGVASYLPAVSGFLIEKELNFMGGA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               K+P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPKRPFVAILGGAKVSDKIGVITNLLDKVDSLLIGGGMAYTFIKAEGHEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  +A++   ++++P D VV  E+K G+P +VV    +P D I +D+G KTVE
Sbjct: 242 KLELAKDLIEKARQKGVKLLLPVDTVVCEELKPGVPYEVVDIDKMPQDKIGVDIGPKTVE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
               VI  A+TV+WNGP+GVFEI+ F + T  +A  +++ +      +I GGGD+  A+ 
Sbjct: 302 AFSNVIKDAKTVVWNGPMGVFEIKEFAKGTEAIAKAMSECSG----TTIIGGGDSAAAVE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ +++ST GGA LE+LEGK LPGI AL+  
Sbjct: 358 QLGYADKVSHISTGGGASLEFLEGKVLPGIAALNDK 393


>gi|220927024|ref|YP_002502326.1| phosphoglycerate kinase [Methylobacterium nodulans ORS 2060]
 gi|219951631|gb|ACL62023.1| phosphoglycerate kinase [Methylobacterium nodulans ORS 2060]
          Length = 398

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 206/396 (52%), Positives = 273/396 (68%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+R RT++D  D++G R L+RVD NVP  +G+V D TRI RV+PTI E+ E   +VV+ +
Sbjct: 1   MTRFRTLDDAGDLKGKRVLVRVDLNVPMENGRVTDATRITRVLPTIREIAEAGGRVVLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  +       L + + F  DCIG   ++++A+L +GG+ + EN R
Sbjct: 61  HFGRPKGKPDPKESLRPIAEAVAKDLGRPVAFAEDCIGPKAAEAVAALGDGGVAMLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP FV+ L+ NGD Y+N+AFS SHRAHAS  GL+H+LP+Y GR MQ E+  L
Sbjct: 121 FHAGEEKNDPAFVQALAANGDVYVNEAFSASHRAHASTEGLAHVLPAYAGRLMQAEIEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P+VAIVGGSKVSTKI LL+NLV KVD LVIGGGMAN+FL A G+GVGRSLC
Sbjct: 181 TKGLEAPARPVVAIVGGSKVSTKIDLLVNLVGKVDALVIGGGMANTFLHATGLGVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +RD +    +I   A+   C II+P D VVA E K   P       ++P   +ILDVG +
Sbjct: 241 ERDLAGTALRIIEAAREKNCAIILPVDAVVAEEFKANAPHHTYGIDAIPESGMILDVGAQ 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +   +  A+T++WNGPLG FE  PFD+ TV  A + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SVERVAAALNDAKTLVWNGPLGAFEFPPFDQGTVAAARHAAERTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++  FTYVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 361 ALNHAGVAEAFTYVSTAGGAFLEWLEGKPLPGVDAL 396


>gi|317130209|ref|YP_004096491.1| phosphoglycerate kinase [Bacillus cellulosilyticus DSM 2522]
 gi|315475157|gb|ADU31760.1| Phosphoglycerate kinase [Bacillus cellulosilyticus DSM 2522]
          Length = 394

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 160/396 (40%), Positives = 239/396 (60%), Gaps = 4/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DG V D TRI   +PTI  L E+ AKV++ SH
Sbjct: 1   MNKKSVRDI-DVKGKRVFCRVDFNVPMSDGAVTDDTRIRAALPTIQHLAEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V      +L K ++  +   G    ++I++L+EG ++L ENVRF
Sbjct: 60  LGRPKGEVVEELRLDAVAKRLSDLLGKTVVKTDTVYGDEPKEAISNLAEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
            + EE+NDP+  + L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M+KEL +L 
Sbjct: 120 EAGEEKNDPELAKELAALADVYVNDAFGAAHRAHASTEGIAQHLPAVGGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL+  VD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIDNLLDNVDNLIIGGGLAYTFVKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   Q   +AK    +  +P D +VA +      TQVV   S+P D   LD+G KT
Sbjct: 240 EDKIDLAKQFMDKAKEKGVKFYMPLDAIVADDFGADATTQVVDIDSIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++  + VI  ++ V+WNGP+GVFE+EPF   T+ VA  +A         ++ GGGD+  A
Sbjct: 300 IDAYRDVILNSKLVIWNGPMGVFELEPFANGTISVAKALADA---NDAYTVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +   G +    ++ST GGA LE++EGK LPG+ AL+
Sbjct: 357 VEKFGFAENMDHISTGGGASLEFMEGKVLPGVAALN 392


>gi|307298983|ref|ZP_07578785.1| triosephosphate isomerase [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915408|gb|EFN45793.1| triosephosphate isomerase [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 655

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 175/400 (43%), Positives = 257/400 (64%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID--GKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+  T+ D+ D+ G R L+RVD+NVP     G+V+D TRI   +PTI E++E+  K ++
Sbjct: 1   MSKTLTLKDI-DLAGKRVLVRVDFNVPLDKETGEVSDDTRIVAALPTINEIIERGGKAIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+ K D   SL KV    +S++ K + FV DCIG  + ++++ ++ G I+L EN
Sbjct: 60  VSHLGRPKGKRDPKYSLEKVAERLQSLIGKPVTFVPDCIGEEVEKAVSKMNNGDILLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRFYSEEE+NDPDF R LS   D ++NDAF  +HR+HAS  G++  L S  G  MQKE+ 
Sbjct: 120 VRFYSEEEKNDPDFSRRLSSIADIHVNDAFGTAHRSHASNVGVARYLTSVPGFLMQKEIE 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ML       + P V I+GG+KVS KI ++ NL++K D+++IGG M  +FL AQG  VG S
Sbjct: 180 MLGMAIENPEHPYVVILGGAKVSDKIGVITNLLEKADRILIGGAMMFTFLKAQGKSVGDS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDV 297
           L + D  D   +I  +A+    E ++P D V+A+E+  G  ++VV  +  VP     LD+
Sbjct: 240 LVEEDKIDLAREILQKAREKNVEFVLPVDTVIAKEIAAGSESKVVDLEEGVPAGWKGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+E   + ++ A+TV+WNGP+GVFEI+ F + T  +A  +A L      ++I GGGD
Sbjct: 300 GPSTIELFNKKLSDAKTVVWNGPMGVFEIDDFAKGTESIARTLASL---NDAVTIIGGGD 356

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  A+   G++ + ++VST GGA LE LEGK++PGI +LS
Sbjct: 357 SAAAINKFGLAEKVSHVSTGGGASLEMLEGKEMPGIKSLS 396


>gi|28210135|ref|NP_781079.1| phosphoglycerate kinase [Clostridium tetani E88]
 gi|46576799|sp|Q898R3|PGK_CLOTE RecName: Full=Phosphoglycerate kinase
 gi|28202571|gb|AAO35016.1| phosphoglycerate kinase [Clostridium tetani E88]
          Length = 401

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/400 (37%), Positives = 239/400 (59%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D+ D++G + L+R D+NVP  DGK+ D  R+   +PTI  ++EK  KV++ SHL
Sbjct: 7   NKKTIEDI-DVKGRKVLVRCDFNVPLKDGKITDENRLMGALPTIKYIMEKGGKVILCSHL 65

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIG--STLSQSIASLSEGGIILAENVR 120
           G+P+ +  ++ SL  V      +L+K +LF  D         +++ ++ +G +IL +N R
Sbjct: 66  GKPKGEPKQELSLAPVAKRLSELLNKEVLFPADNEVVGENAKKAVENMKDGDVILLQNTR 125

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           +  EE +N+  F + L+   D ++NDAF  +HRAH S  G++     S  G  +QKEL  
Sbjct: 126 YRKEETKNEETFSKELASLADIFVNDAFGTAHRAHCSTVGVTEFVATSVCGYLIQKELKF 185

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +     ++P ++I+GG+KVS KI ++ NL++KVD L+IGGGM+ +F  AQG  +G SL
Sbjct: 186 LGNAVENPQRPFISILGGAKVSDKINVINNLLEKVDTLIIGGGMSYTFQKAQGYTIGSSL 245

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +AK    ++++P D V A +        +   Q++    + LD+G 
Sbjct: 246 LEEDKIDYAKEMIEKAKEKGVKLLLPVDNVAAEKFAEDAEAIITEDQNIKEGYMGLDIGP 305

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +   Q +  A+TV+WNGP+GVFE E F + T+EVA  +A    E +  +I GGGD+ 
Sbjct: 306 KTSKLYSQEVQSAKTVVWNGPMGVFEFEKFAKGTIEVAKAMA----ESQATTIIGGGDSA 361

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 362 AAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 401


>gi|164686787|ref|ZP_02210815.1| hypothetical protein CLOBAR_00382 [Clostridium bartlettii DSM
           16795]
 gi|164604177|gb|EDQ97642.1| hypothetical protein CLOBAR_00382 [Clostridium bartlettii DSM
           16795]
          Length = 400

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 226/402 (56%), Gaps = 7/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T+ D+ ++ G + L+R D+NVP  DG + D  R+   +PTI  L+ + AKV++ S
Sbjct: 3   MLNKKTIEDI-NVAGKKVLVRCDFNVPLQDGVITDENRLVGALPTIKYLIAQGAKVILCS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + ++F  D   +G     +++++ +G ++L EN
Sbjct: 62  HLGKPKGEPKPELSLAPVAKRLSEMLGQEVVFAADANVVGENAKAAVSNMKDGDVVLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N+ +F + L+   D ++NDAF  +HRAH S  G          G  +QKEL
Sbjct: 122 TRYRKEETKNEENFSKELASLADIFVNDAFGTAHRAHCSTVGAGQFLEERACGYLIQKEL 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L    +   +P  AI+GG+KVS KI ++  L+ KVD L+IGGGMA +FL +QG  +G 
Sbjct: 182 KFLGEAVANPVRPFTAILGGAKVSDKINVINQLLDKVDNLIIGGGMAYTFLKSQGYEIGD 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  D   ++  +A+    ++ +P D   A          +   Q++      LD+
Sbjct: 242 SLLEADKVDYAKEMIEKAEAKGVKLYLPVDFKTADRFAADAEVAITEDQNIADGYQGLDI 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KTVE    V+  ++T++WNGP+GVFE E F   T+ +A  +A L       ++ GGGD
Sbjct: 302 GPKTVEKFVDVVNNSKTIVWNGPMGVFEFEAFAGGTLAIAKAMAAL---EDATTVIGGGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T+VST GGA LE+LEGK+LPGI AL   
Sbjct: 359 SAAAVNQLGFGDKMTHVSTGGGASLEFLEGKELPGIAALDNK 400


>gi|78044457|ref|YP_359153.1| phosphoglycerate kinase [Carboxydothermus hydrogenoformans Z-2901]
 gi|123577044|sp|Q3AFD1|PGK_CARHZ RecName: Full=Phosphoglycerate kinase
 gi|77996572|gb|ABB15471.1| phosphoglycerate kinase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 394

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 164/399 (41%), Positives = 262/399 (65%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFS 60
              +++ D+ +++G +  +RVD+NVP  +  ++ D TRI   +PT+  L E+ AK+++ S
Sbjct: 1   MNKKSIRDV-EVKGKKVFVRVDFNVPLNENREITDDTRIRAALPTLQYLREQGAKLIVAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + ++  SL  V      +L   +    D +G  + +    L  G ++L ENVR
Sbjct: 60  HLGRPKGQFNEKYSLKPVAKRLAELLGIEVKMAPDVVGPEVEKMAGELRPGEVLLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY EEE+NDP+F R L+R  + +++DAF  +HRAHAS  G++  LP+  G  M+KE++ L
Sbjct: 120 FYPEEEKNDPEFARKLARLAEIFVSDAFGAAHRAHASTAGIASYLPAVAGFLMEKEINFL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL A G   G+SL 
Sbjct: 180 SRALNNPERPFVAIIGGAKVSDKIGVIENLLGKVDVLLIGGGMANTFLKAMGYETGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   ++  +AK    ++++P DVVVA  ++ G+P+++V+  S+P + + LD+G K
Sbjct: 240 EEDKVNLAGELMNKAKEVGVKLLLPSDVVVAPRIEAGVPSKIVAVDSIPAEEMALDIGEK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T ++ ++ I +A+TV+WNGP+GVFE+EPFDR TV VA  VA    E   +S+ GGGD++ 
Sbjct: 300 TAKHFREEILKAKTVVWNGPMGVFEVEPFDRGTVAVAEAVA----ESGALSVVGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+  AG++++ T++ST GGA LE+LEGK LPG+  L+  
Sbjct: 356 AVEKAGVADKITHISTGGGASLEFLEGKKLPGVEVLNDK 394


>gi|226314823|ref|YP_002774719.1| phosphoglycerate kinase [Brevibacillus brevis NBRC 100599]
 gi|254782191|sp|C0Z6L6|PGK_BREBN RecName: Full=Phosphoglycerate kinase
 gi|226097773|dbj|BAH46215.1| phosphoglycerate kinase [Brevibacillus brevis NBRC 100599]
          Length = 394

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 161/398 (40%), Positives = 249/398 (62%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R   RVD+NVP  DG + D TRI   VPTI  ++E  AKV++ SH
Sbjct: 1   MNKKSIRDV-ELAGKRVFCRVDFNVPMQDGVITDDTRIRAAVPTIRFMMEAGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ +  ++  L  V +   S+L K++  + DC G+ +  ++  +  G +IL ENVRF
Sbjct: 60  FGRPKGQVVEEMRLTPVAAHLSSLLGKDVRKLEDCQGADVEAAVERMESGDVILLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           ++ EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++  +P+  G  M+KE+  + 
Sbjct: 120 HAGEEKNDPELAKSFAALADLFVNDAFGTAHRAHASTAGIAEYIPAVAGLLMEKEIRFMG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AIVGG+KV  KI ++ NL+ KVD L+IGGGMAN+FL AQG G+G SLC+
Sbjct: 180 GALSNPERPFTAIVGGAKVKDKIAVIENLLTKVDHLIIGGGMANTFLKAQGYGIGASLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D    +  +AK    ++++P DVVVA         QVV+  ++P   + LD+G KT
Sbjct: 240 DDKLDLARTLMEQAKERGVQLLMPVDVVVADRFAADAEKQVVAIDAIPEGWMALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE    VI  ++TV+WNGP+GVFE++ F   T+ VA  +A  +      +I GGGD++ A
Sbjct: 300 VEQYHSVIVDSKTVVWNGPMGVFEMDAFAGGTIGVAKAMAACSG----TTIIGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  AG++ + T++ST GGA LE++EGK+LPG+  L+ +
Sbjct: 356 VEKAGVAEQMTHISTGGGASLEFMEGKELPGVAVLADN 393


>gi|220929670|ref|YP_002506579.1| bifunctional phosphoglycerate kinase/triosephosphate isomerase
           [Clostridium cellulolyticum H10]
 gi|219999998|gb|ACL76599.1| phosphoglycerate kinase [Clostridium cellulolyticum H10]
          Length = 646

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 240/397 (60%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIF 59
           M   +T+ D+ D+ G R ++RVD+NVP  +  K+ D  RI   +PTI  LV+K AK ++ 
Sbjct: 3   MMNKKTIEDI-DVAGKRVIVRVDFNVPLDENRKITDDKRIVGALPTIKYLVDKGAKTILV 61

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   +   S+         +L K I+   D +G       A+L +G +++ ENV
Sbjct: 62  SHLGRPKEGFEDKFSMKPTAVRLGELLGKEIIMAKDVVGEDAKSKAAALKDGEVLMLENV 121

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EE +ND +F + L+   + ++NDAF  +HRAHAS  GL+  LP+  G  ++KE+  
Sbjct: 122 RFHKEETKNDANFAKELASMAEIFVNDAFGTAHRAHASTAGLADYLPAVCGFLIKKEIEF 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +    +   +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +FL A+G  +G S+
Sbjct: 182 MGKALANPARPFVAILGGAKVSDKIAVIENLIDKVDTLIIGGGMAYTFLKAKGYHIGNSI 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ D  D    +  +A+    EI++P   +VA+E K     + V + ++P   + +D+G 
Sbjct: 242 CEEDKIDLAKTLMEKAEAKGVEIMLPIGSMVAQEFKNDTEIKYVPSDAMPDGWMGMDIGS 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            T+E   + I +A+TV+WNGP+GVFE   F   T E+A  VA    E   +SI GGGD+ 
Sbjct: 302 LTIENFAKEIKKAKTVIWNGPMGVFEFPNFATGTKEIAKAVA----ESGALSIVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G +++ T++ST GGA LE+LEGK+LPGI  L
Sbjct: 358 AAVEQLGFADKITHISTGGGASLEFLEGKELPGIAVL 394


>gi|110635765|ref|YP_675973.1| phosphoglycerate kinase [Mesorhizobium sp. BNC1]
 gi|122965543|sp|Q11CR7|PGK_MESSB RecName: Full=Phosphoglycerate kinase
 gi|110286749|gb|ABG64808.1| phosphoglycerate kinase [Chelativorans sp. BNC1]
          Length = 398

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 214/398 (53%), Positives = 291/398 (73%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL+D+ G R LLRVD NVP  DG+V D TRIERV PTI EL +K AKV++ +
Sbjct: 1   MAGFKTLDDLKDVAGKRVLLRVDLNVPVKDGEVTDTTRIERVAPTITELSDKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D + SL  +    E++L + + F + CIG    +++  ++ G I+L EN R
Sbjct: 61  HFGRPKGKPDAEASLQPIAHAVEAVLDRRVHFASSCIGEPAKKAVDEMTGGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP+F + L+ NGD Y+NDAFS +HRAHAS  GL+HLLP+Y GR +Q EL  L
Sbjct: 121 FHAGEEKNDPEFTKALAANGDIYVNDAFSAAHRAHASTEGLAHLLPAYAGRTIQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +    + K+P+VAIVGG+KVSTKI LL NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 QRGLGDPKRPVVAIVGGAKVSTKIDLLTNLVKKVDCLVIGGGMANTFLAARGTSVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   QI  +A  + C II+P D VVAR+ + G  T+ V   +VP D++ILDVG K
Sbjct: 241 EHDLRETAKQIMIDAAEAGCAIILPVDAVVARKFEAGAETETVDIDAVPEDAMILDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +K+ + +A T++WNGPLG FE+ PFD+AT+EVA Y A+ T+E  ++S+AGGGDT+ 
Sbjct: 301 SVEKVKEWLDRADTLVWNGPLGAFELSPFDKATMEVAKYAARRTRESLLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AL  A +S++F+YVSTAGGAFLEW+EGKDLPG+ AL  
Sbjct: 361 ALNQADVSDDFSYVSTAGGAFLEWMEGKDLPGVAALQK 398


>gi|121535413|ref|ZP_01667224.1| Phosphoglycerate kinase [Thermosinus carboxydivorans Nor1]
 gi|121306012|gb|EAX46943.1| Phosphoglycerate kinase [Thermosinus carboxydivorans Nor1]
          Length = 394

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 161/399 (40%), Positives = 238/399 (59%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+  + G +  +RVD+NVP    G + D TRI   +PTI  L+++ A V++ S
Sbjct: 1   MNKKTVKDIA-VTGKKVFVRVDYNVPMDKSGHITDDTRIRATLPTIRYLLDQGAAVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+     + SL  V      +L + +LF  DC+G+      A L  G ++L EN+R
Sbjct: 60  HLGRPKGAPAPEYSLAPVAKRLSELLGQEVLFAADCVGAEAEAKAAQLKPGQVLLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+ND  F + L+R  D  +NDAF VSHRAHAS+ G++  +P   G  M+KE++ L
Sbjct: 120 FHKEEEKNDERFAQSLARLADVAVNDAFGVSHRAHASVEGITKFVPMVAGFLMEKEIAFL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +   +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG   G+SL 
Sbjct: 180 GQAVTNPTRPFVAIIGGAKVSDKIGVIENLLGKVDTLIIGGGMANTFLRAQGFATGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK    ++++P DVV+A         +V     +  + ++LD+G +
Sbjct: 240 EEDKVELAATLIDQAKAKGLKLLLPTDVVIADRFAADAAWRVAGVAEIDPEWMVLDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T +   + +  A+TV+WNGP+GVFE + F + T  VA  VA         SI GGGD+I 
Sbjct: 300 TAKAFGEAVQGAKTVVWNGPMGVFEFDAFAKGTEAVAKAVAG----SGATSIVGGGDSIA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           AL   G++   T++ST GGA LE+LEGK LPGI AL+  
Sbjct: 356 ALEKVGLAARITHISTGGGASLEFLEGKVLPGIAALADK 394


>gi|255657121|ref|ZP_05402530.1| phosphoglycerate kinase [Clostridium difficile QCD-23m63]
 gi|296452043|ref|ZP_06893756.1| phosphoglycerate kinase [Clostridium difficile NAP08]
 gi|296879561|ref|ZP_06903542.1| phosphoglycerate kinase [Clostridium difficile NAP07]
 gi|296259116|gb|EFH05998.1| phosphoglycerate kinase [Clostridium difficile NAP08]
 gi|296429443|gb|EFH15309.1| phosphoglycerate kinase [Clostridium difficile NAP07]
          Length = 400

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 149/402 (37%), Positives = 230/402 (57%), Gaps = 7/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T+ D+ D+ G + L+R D+NVP  DG + D  R+   +PTI  L+ K AKV++ S
Sbjct: 3   MLNKKTIEDI-DVCGKKVLVRCDFNVPLQDGVITDENRLNGALPTIQYLISKGAKVILCS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L K ++F  D   +G    ++   +  G ++L EN
Sbjct: 62  HLGKPKGEAKPELSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKATEEMENGDVVLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N+ +F + L+   + ++NDAF  +HRAH S  G          G  +QKEL
Sbjct: 122 TRYRKEETKNEENFSKELASLAEIFVNDAFGTAHRAHCSTVGAGEFLQERVCGYLIQKEL 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L    +   +P  AI+GG+KVS K+ ++  L++KVD L+IGGGMA +FL AQG  VG 
Sbjct: 182 KFLGEAVANPVRPFTAILGGAKVSDKLAVINELLEKVDNLIIGGGMAYTFLKAQGYEVGT 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +   ++  +AK     +++P DVV+A          V    +V    + LD+
Sbjct: 242 SLLEIDKVEYAKEMMEKAKNKGVNLLLPVDVVMADHFAPDATPIVTEDANVKEGYMGLDM 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT+    + I +++T++WNGP+GVFE E F   T+ VA  +A+LT      ++ GGGD
Sbjct: 302 GPKTIANFVKTIKESKTIVWNGPMGVFEFENFANGTLSVARAMAELT---DATTVIGGGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T+VST GGA LE+LEGK+LPGI AL   
Sbjct: 359 SAAAVNQLGFGDKMTHVSTGGGASLEFLEGKELPGIAALDNK 400


>gi|254976762|ref|ZP_05273234.1| phosphoglycerate kinase [Clostridium difficile QCD-66c26]
 gi|255094146|ref|ZP_05323624.1| phosphoglycerate kinase [Clostridium difficile CIP 107932]
 gi|255315898|ref|ZP_05357481.1| phosphoglycerate kinase [Clostridium difficile QCD-76w55]
 gi|255518558|ref|ZP_05386234.1| phosphoglycerate kinase [Clostridium difficile QCD-97b34]
 gi|255651678|ref|ZP_05398580.1| phosphoglycerate kinase [Clostridium difficile QCD-37x79]
 gi|260684712|ref|YP_003215997.1| phosphoglycerate kinase [Clostridium difficile CD196]
 gi|260688370|ref|YP_003219504.1| phosphoglycerate kinase [Clostridium difficile R20291]
 gi|306521478|ref|ZP_07407825.1| phosphoglycerate kinase [Clostridium difficile QCD-32g58]
 gi|260210875|emb|CBA66021.1| phosphoglycerate kinase [Clostridium difficile CD196]
 gi|260214387|emb|CBE06789.1| phosphoglycerate kinase [Clostridium difficile R20291]
          Length = 400

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 150/402 (37%), Positives = 230/402 (57%), Gaps = 7/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T+ D+ D+ G + L+R D+NVP  DG + D  R+   +PTI  L+ K AKV++ S
Sbjct: 3   MLNKKTIEDI-DVCGKKVLVRCDFNVPLQDGVITDENRLNGALPTIQYLISKGAKVILCS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L K ++F  D   +G    ++   +  G ++L EN
Sbjct: 62  HLGKPKGEAKPELSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKATEKMENGDVVLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N+ +F + L+   + ++NDAF  +HRAH S  G          G  +QKEL
Sbjct: 122 TRYRKEETKNEENFSKELASLAEIFVNDAFGTAHRAHCSTVGAGEFLQERVCGYLIQKEL 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L    +   +P  AI+GG+KVS K+ ++  L++KVD L+IGGGMA +FL AQG  VG 
Sbjct: 182 KFLGEAVANPVRPFTAILGGAKVSDKLAVINELLEKVDNLIIGGGMAYTFLKAQGYEVGT 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +   ++  +A      +++P DVV+A          V    +V  D + LD+
Sbjct: 242 SLLEIDKVEYAKEMMEKANNKGVNLLLPVDVVMADHFAPDATPIVTEDANVKEDYMGLDM 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT+    + I +++TV+WNGP+GVFE E F   T+ VA  +A+LT      ++ GGGD
Sbjct: 302 GPKTIANFVKTIKESKTVVWNGPMGVFEFENFANGTLSVARAMAELT---DATTVIGGGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T+VST GGA LE+LEGK+LPGI AL   
Sbjct: 359 SAAAVNQLGFGDKMTHVSTGGGASLEFLEGKELPGIAALDNK 400


>gi|160902889|ref|YP_001568470.1| phosphoglycerate kinase., Triose-phosphate isomerase [Petrotoga
           mobilis SJ95]
 gi|160360533|gb|ABX32147.1| Phosphoglycerate kinase., Triose-phosphate isomerase [Petrotoga
           mobilis SJ95]
          Length = 655

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ D++G + ++RVD+NVP  DGK+ D TRI   + TI   ++K AKV++ S
Sbjct: 1   MEKL-TIKDV-DLKGKKVIMRVDFNVPIKDGKITDETRIVAALDTIQYALDKGAKVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + D   SL  V      +L+  + FV++  G  + ++++ L EG +++ EN R
Sbjct: 59  HLGRPKGEKDPQFSLKPVADRLGELLNNKVYFVDETRGPKVEEAVSELKEGEVLVLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L
Sbjct: 119 FEKGETKNDPELAKYWASLADLHVNDAFGTAHRAHASNVGIADYIPSVAGFLMEKEIEFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +      +KP V I+GG+KVS KI ++ NL+ K DK++IGG M  +FL A    VG SL 
Sbjct: 179 QKAVENPEKPYVVILGGAKVSDKIGVINNLLNKADKILIGGAMMFTFLKALDKKVGSSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRD-VVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           + D  D   +I   AK    EI++P D V+  +         V     +P   + LD+G 
Sbjct: 239 EEDKLDVAKEILENAKAKGVEIVLPIDAVIAQKIEAGVEKKTVKIDDGIPEGWMGLDIGL 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +TV   K+ I+ ++T++WNGP+GVFEI+ F   T EVA  +A++TK +  ISI GGGD+ 
Sbjct: 299 ETVSLFKEKISDSKTIVWNGPMGVFEIDDFAFGTEEVAKAIAEVTK-KGCISIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A    G+++EF++VST GGA LE+LEG +LPGI ++S  
Sbjct: 358 AAAEKFGLASEFSHVSTGGGASLEFLEGIELPGISSISEK 397


>gi|94969569|ref|YP_591617.1| phosphoglycerate kinase [Candidatus Koribacter versatilis Ellin345]
 gi|166980483|sp|Q1INK7|PGK_ACIBL RecName: Full=Phosphoglycerate kinase
 gi|94551619|gb|ABF41543.1| phosphoglycerate kinase [Candidatus Koribacter versatilis Ellin345]
          Length = 403

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 172/408 (42%), Positives = 246/408 (60%), Gaps = 14/408 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIF 59
           MS+L ++ DL+ +   R  +RVD+NVP   +G+V D TRI   +PTI   +   AK+++ 
Sbjct: 1   MSKL-SIKDLQ-LSNKRVFMRVDFNVPLDENGRVTDDTRIRETLPTIEYALRHGAKLILC 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESI------LHKNILFVNDCIGSTLSQSIASLSEGGI 113
           SHLGRP+ K +   SL  V      +        +N+ F  DCIG    +    L +G  
Sbjct: 59  SHLGRPKGKPNPKMSLKPVAERLRVMLDHAISPGQNVGFSPDCIGMQAQEMAKQLEKGQA 118

Query: 114 ILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRA 172
           +L ENVRF++EEE+NDP F + L+   + Y+NDAF  +HRAHAS  G++H    S  G  
Sbjct: 119 LLLENVRFHAEEEKNDPAFAKELASLCELYVNDAFGSAHRAHASTEGITHYVEKSAAGLL 178

Query: 173 MQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQG 232
           MQKEL  L    S   KP VAI+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG
Sbjct: 179 MQKELDYLGKATSNPAKPFVAILGGAKVSDKIGVIQNLMAKVDAIIIGGGMAYTFLKAQG 238

Query: 233 MGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGI-PTQVVSAQSVPLD 291
             +G+SL + D  D   QI  +A +   + ++P D V A +      P Q+   QS+P +
Sbjct: 239 QEIGKSLFEADKLDLAKQILADAHKRGLKFLLPVDHVTADKFDMHATPHQIGEGQSIPAE 298

Query: 292 SIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIIS 351
            + LD+G KTV    + IA+ART++WNGP+GVFE + F + T  +A  VA         S
Sbjct: 299 QMALDIGPKTVALFSEEIAKARTIVWNGPMGVFEFDNFAKGTRAIAKAVA---GNSGATS 355

Query: 352 IAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           I GGGD++ A+  AG++++ T++ST GGA LE+LEGK LPG+ AL+  
Sbjct: 356 IVGGGDSVAAVHDAGVADKITHISTGGGASLEFLEGKKLPGVEALTNK 403


>gi|126700793|ref|YP_001089690.1| phosphoglycerate kinase [Clostridium difficile 630]
 gi|255102316|ref|ZP_05331293.1| phosphoglycerate kinase [Clostridium difficile QCD-63q42]
 gi|255308208|ref|ZP_05352379.1| phosphoglycerate kinase [Clostridium difficile ATCC 43255]
 gi|123173880|sp|Q181T8|PGK_CLOD6 RecName: Full=Phosphoglycerate kinase
 gi|115252230|emb|CAJ70070.1| Phosphoglycerate kinase [Clostridium difficile]
          Length = 400

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/402 (37%), Positives = 231/402 (57%), Gaps = 7/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T+ D+ D+ G + L+R D+NVP  DG + D  R+   +PTI  L+ K AKV++ S
Sbjct: 3   MLNKKTIEDI-DVCGKKVLVRCDFNVPLQDGVITDENRLNGALPTIQYLISKGAKVILCS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L K ++F  D   +G    ++   +  G ++L EN
Sbjct: 62  HLGKPKGEAKPELSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKATEKMENGDVVLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N+ +F + L+   + ++NDAF  +HRAH S  G          G  +QKEL
Sbjct: 122 TRYRKEETKNEENFSKELASLAEIFVNDAFGTAHRAHCSTVGAGEFLQERVCGYLIQKEL 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L    +   +P  AI+GG+KVS K+ ++  L++KVD L+IGGGMA +FL AQG  VG 
Sbjct: 182 KFLGEAVANPVRPFTAILGGAKVSDKLAVINELLEKVDNLIIGGGMAYTFLKAQGYEVGT 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +   ++  +AK     +++P DVV+A          V    +V  D + LD+
Sbjct: 242 SLLEIDKVEYAKEMMEKAKNKGVNLLLPVDVVMADHFAPDATPIVTEDANVKEDYMGLDM 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT+    + I +++TV+WNGP+GVFE E F   T+ VA  +A+LT      ++ GGGD
Sbjct: 302 GPKTIANFVKTIKESKTVVWNGPMGVFEFENFANGTLSVARAMAELT---DATTVIGGGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T+VST GGA LE+LEGK+LPGI AL   
Sbjct: 359 SAAAVNQLGFGDKMTHVSTGGGASLEFLEGKELPGIAALDNK 400


>gi|15616121|ref|NP_244426.1| phosphoglycerate kinase [Bacillus halodurans C-125]
 gi|20138853|sp|Q9K714|PGK_BACHD RecName: Full=Phosphoglycerate kinase
 gi|10176183|dbj|BAB07278.1| phosphoglycerate kinase [Bacillus halodurans C-125]
          Length = 394

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 157/398 (39%), Positives = 237/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ +++G +   RVD+NVP  DG V D TRI   +PTI  L EK A++++ SH
Sbjct: 1   MNKQSVRDV-ELQGKKVFCRVDFNVPMKDGVVTDDTRIRAALPTIQLLAEKGARIILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V +  + +L K +  VN   G    Q+   L +G ++L ENVRF
Sbjct: 60  LGRPKGEVVEELRLDPVAARLQELLGKPVAKVNVAHGPEAEQAANELKDGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H + +  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFASLADVYVNDAFGAAHRAHASTEGIAHHVTAVAGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFIKAQGHEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D       +AK       VP+D +VA +      T+ V    +P D   LD+G KT
Sbjct: 240 ADKMDLALSFMEKAKEKGVNFYVPQDAIVADDFSNDANTKAVDIDQIPADWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI  ++ V+WNGP+GVFE++ F   T  VA  +A         S+ GGGD+  A
Sbjct: 300 RETYRNVIQSSKLVIWNGPMGVFELDAFAGGTKAVAEALADA---NDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++N+ +++ST GGA LE++EGK LPG+VAL+  
Sbjct: 357 VEKFGLANQMSHISTGGGASLEFMEGKALPGVVALNDK 394


>gi|239618381|ref|YP_002941703.1| Phosphoglycerate kinase [Kosmotoga olearia TBF 19.5.1]
 gi|239507212|gb|ACR80699.1| Phosphoglycerate kinase [Kosmotoga olearia TBF 19.5.1]
          Length = 405

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 167/400 (41%), Positives = 252/400 (63%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFID--GKVADVTRIERVVPTILELVEKKAKVVI 58
           M +  T+ D+ D++  + LLRVD+NVP     G+VAD TRI+  +PTI  ++E   K ++
Sbjct: 1   MLKKLTVKDV-DLKDKKVLLRVDFNVPIDKETGEVADDTRIKAALPTIKYVLENGGKAIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+ K D   SL  V    E +L + + FV+DCIG    + I ++ EG ++L EN
Sbjct: 60  VSHLGRPKGKKDPKYSLKPVAKRLEQLLGRTVSFVDDCIGEGAKKVIEAMKEGEVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRFY EE++NDP+F   L+   D ++NDAF  +HRAHAS  G++  L S  G  M+KE++
Sbjct: 120 VRFYPEEKKNDPEFAEKLASLADIHVNDAFGTAHRAHASNVGVAQYLTSVAGFLMEKEIA 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ML    +  + P V I+GG+KVS KI ++ NL+KK D+++IGG M  +FL A G  VG S
Sbjct: 180 MLGKAVANPEHPYVVILGGAKVSDKIGVITNLLKKADRILIGGAMMFTFLKALGKQVGDS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDV 297
           L + D  +   +I  EA +   E ++P D V+A+E++ G  ++VV     +P     LD+
Sbjct: 240 LVEEDKLELAKEIMEEASKRGVEFVLPIDTVIAKEIEAGAESKVVRIDDGIPEGWKGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T+E  K  +  A+TV+WNGP+GVFEI+ F + T E+A  +A+L       +I GGGD
Sbjct: 300 GPETIELFKSKLKGAKTVVWNGPMGVFEIDDFAKGTEEIAKALAEL---EDATTIVGGGD 356

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  A+    ++++ ++VST GGA LE LEGK+LPGI +++
Sbjct: 357 SAAAINKFNLADKVSHVSTGGGASLEMLEGKELPGIASIA 396


>gi|320160732|ref|YP_004173956.1| phosphoglycerate kinase [Anaerolinea thermophila UNI-1]
 gi|319994585|dbj|BAJ63356.1| phosphoglycerate kinase [Anaerolinea thermophila UNI-1]
          Length = 391

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 163/396 (41%), Positives = 246/396 (62%), Gaps = 8/396 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +++ D+ D++G + L+RVD+NVP  +G V D TRI   +PTI  L+E+ A V++FS
Sbjct: 1   MFNKKSVRDI-DVKGKKVLVRVDFNVPIKEGVVQDDTRIRAALPTIEYLLEQGAAVILFS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   D   S+  V      ++ K + F  DC+G    ++ A+L  G +++ EN R
Sbjct: 60  HLGRPKGGPDPKYSMKPVAEYLAQLMGKPVAFAEDCVGEPAEKAAANLKPGEVLVLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+ND +  + ++   D Y+NDAF  +HRAH+S  G++  LP+  G  M+KE+  L
Sbjct: 120 FHPEEEKNDLELAKKMAALADIYVNDAFGSAHRAHSSTEGVARFLPAVAGFLMEKEIQYL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  K+P VAI+GG+KVS KI ++ NL+ K D ++IGGGMAN+F  AQG  VG+SL 
Sbjct: 180 SQAIENPKRPFVAILGGAKVSDKIGVIKNLLTKADTILIGGGMANTFFKAQGYPVGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + +    +        +   ++ +P DVV+A+ M+ G  T+VV    +P D +ILD+G +
Sbjct: 240 EDE---VLDLARELIAQGGTKLRLPVDVVIAQSMEEGAETKVVPVGPIPDDWMILDIGPE 296

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV    +VIA A TV+WNGP+GVFE+  F + T  +A  +AK       ISI GGGD+ +
Sbjct: 297 TVASYGKVIANAATVVWNGPMGVFEVSTFAKGTFGIADALAK----SNAISIVGGGDSAS 352

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  +G++ + T++ST GGA LE LEG  LPG+ AL
Sbjct: 353 AVQKSGLAEKITHISTGGGASLEMLEGLFLPGVAAL 388


>gi|154249426|ref|YP_001410251.1| phosphoglycerate kinase [Fervidobacterium nodosum Rt17-B1]
 gi|171769339|sp|A7HL11|PGK_FERNB RecName: Full=Phosphoglycerate kinase
 gi|154153362|gb|ABS60594.1| Phosphoglycerate kinase [Fervidobacterium nodosum Rt17-B1]
          Length = 400

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 245/400 (61%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI  ++E+ AKV++ +
Sbjct: 1   MEKL-TIRDV-DLKGKRVIMRVDFNVPIKDGVVTDDTRIVEALPTIKYVLEQGAKVILLT 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   D   ++         +L K + FV    G  + +++A L EG +++ EN R
Sbjct: 59  HLGRPKGGPDPKYTVKPAAERLAQLLGKEVKFVPALYGEEVEKAVAELKEGEVLMLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+ND +  +  +   D ++NDAF  +HRAH+S  G++  +PS  G  M+KE+  L
Sbjct: 119 FDPGEEKNDLELAKKWASLADIHVNDAFGTAHRAHSSNVGIAQYIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   KP V ++GG+KVS KI ++ NL+ K DK++IGG M  +F  A G   G SL 
Sbjct: 179 SKATHNPDKPYVVVLGGAKVSDKIGVITNLLNKADKIIIGGAMMFTFWRALGKQTGNSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   Q+  +AK    E+++P D V A++M+ G+  +V + +  +P      D+G 
Sbjct: 239 EEDKIDLAKQLLEQAKEKGVELVIPTDAVCAQKMEAGVEKKVFTCEEGIPEGWAGYDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            ++E IK  +A A+T++WNGPLGVFEIE F   T  VA ++A LT ++ + ++ GGGD+ 
Sbjct: 299 ASIELIKSKLADAKTIVWNGPLGVFEIEDFANGTKAVAEFIASLT-DKGVTTVVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A++  G+  +F++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAVSQFGLEKKFSHVSTGGGASLEFLEGKELPGIASIADK 397


>gi|23099892|ref|NP_693358.1| phosphoglycerate kinase [Oceanobacillus iheyensis HTE831]
 gi|30172999|sp|Q8ENP3|PGK_OCEIH RecName: Full=Phosphoglycerate kinase
 gi|22778123|dbj|BAC14393.1| phosphoglycerate kinase [Oceanobacillus iheyensis HTE831]
          Length = 393

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 237/398 (59%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+NDL+ + G R   RVD+NVP  DG++ D TRI   +PTI +L  + AKV++ SH
Sbjct: 1   MNKKTINDLQ-VEGKRVFTRVDFNVPLKDGEITDDTRIRAALPTIEQLTAQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+    ++  L  V      +L K +L  +   G  + Q+I+ L  GG++L ENVRF
Sbjct: 60  LGRPKGTVVEELRLDPVADRLSDLLGKEVLKTDQVYGEEVDQAISELENGGVLLIENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
            + EE+NDP+ V   +   D Y+NDAF  +HRAHAS TG++  LP+  G+ M+KE+  L 
Sbjct: 120 EAGEEKNDPELVEAFANMADLYVNDAFGAAHRAHASTTGVAEKLPAAAGKLMEKEIEALG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +     ++P  AIVGG+KV  KI+++ NL+ KVD L+IGGG+A +F+ AQG  +G+SL +
Sbjct: 180 NALENPERPFTAIVGGAKVKDKISVIDNLLDKVDNLIIGGGLAYTFIKAQGHEIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   +   +AK      ++P D +VA +      T++V    +P D   LD+G KT
Sbjct: 240 EDKIDLAKEFMNKAKEKGVNFVLPVDAIVADDFSEEANTKIVDIDKIPSDWEALDIGTKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    ++  ++ V+WNGP+GVFE+  F   T  VA  +A         SI GGGD+  A
Sbjct: 300 REKYSSIVKDSKLVIWNGPMGVFELNAFAGGTKAVAEALA----STEGYSIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++ E  +VST GGA LE++EGK LPG+ AL+  
Sbjct: 356 VEKFGLAEEMDHVSTGGGASLEFMEGKVLPGLAALNDK 393


>gi|27446627|gb|AAK40345.1| phosphoglycerate kinase [Chondrus crispus]
          Length = 456

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/398 (42%), Positives = 249/398 (62%), Gaps = 4/398 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ DL   DI G R L+R D NVP     + D TRI   VPTI  L+E  AKV++ SHL
Sbjct: 60  KSIKDLSPADIAGKRVLVRCDLNVPLDGKTITDDTRIRASVPTIKFLMEAGAKVLLSSHL 119

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +   SL  V +    +L K++    DCIG  +++ ++ ++ G + L ENVRFY
Sbjct: 120 GRPKDGPEDKFSLSPVAARLTQLLGKDVTMAPDCIGDGVTKIVSGMANGDVTLLENVRFY 179

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLE 181
            EE +NDPDF + L+ N DF++NDAF  +HRAH S  G++    PS  G  ++KEL+ L 
Sbjct: 180 KEETKNDPDFAKKLAANADFFVNDAFGTAHRAHGSTAGVTAHLKPSVAGLLLEKELAYLA 239

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S+  +P  AIVGGSKVS+KI ++ +L++KVDKL+IGGGM  +FL A+G+ VG SL +
Sbjct: 240 GTVSDPARPFAAIVGGSKVSSKIGVIDSLLQKVDKLIIGGGMVFTFLKAKGLNVGSSLVE 299

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   ++   A+     II+P DVV+A +      TQV S  S+P   + LD G  +
Sbjct: 300 DDKLELARELVKTAEAKGVSIILPTDVVLADKFAADANTQVTSVDSIPDGWMGLDQGEDS 359

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            + I+  + + +TV+WNGP+GVFE+E F + T  +A  +A LT E   I+I GGGD++ A
Sbjct: 360 TKLIQNELKECKTVIWNGPMGVFEMEKFAKGTFAIADTLADLT-ESGCITIIGGGDSVAA 418

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  AG++ + +++ST GGA LE LEGK LPG+ AL  +
Sbjct: 419 VEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALDDN 456


>gi|158320006|ref|YP_001512513.1| phosphoglycerate kinase [Alkaliphilus oremlandii OhILAs]
 gi|158140205|gb|ABW18517.1| Phosphoglycerate kinase [Alkaliphilus oremlandii OhILAs]
          Length = 397

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 156/402 (38%), Positives = 244/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M R +T+ DL +++G + L+R D+NVP   +GK+ D  RI   +PT+  ++E    V++ 
Sbjct: 1   MLRKKTLKDL-EMKGKKVLVRCDFNVPMDKEGKITDDIRIRAAMPTVEYILENGGSVILM 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SHLGRP  + +   SL  V      ++ + + F +D   +G +  +  + L EG ++L +
Sbjct: 60  SHLGRPNGEPNPKYSLEPVSKRISELIGREVKFSDDDRVVGESTQKLASELKEGEVLLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVR+  EEE+N+  F + L+   D Y+NDAF  +HRAH+S  G++  LPS +G  ++KE+
Sbjct: 120 NVRYRKEEEKNEDAFSKELASLADLYVNDAFGTAHRAHSSTAGVASFLPSAMGYLIEKEV 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             +       ++P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ AQG  VG+
Sbjct: 180 GFMGKALESPERPFVAILGGAKVSDKIGVIENLMEKVDALIIGGGMAYTFIKAQGFEVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D       +  +AK    E+++P D VVA+E         V++ S+P +++ LD+
Sbjct: 240 SLLEEDKVSLAADLIKKAKEKNIELLLPVDTVVAKEFAAEAQHWTVNSSSMPAETMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT+    + I +A+TV+WNGP+GVFE+  F + T EVA  +A        I+I GGGD
Sbjct: 300 GDKTIALFSEKIKEAKTVIWNGPMGVFEMPAFAKGTKEVAKALA----NSGAITIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G ++  T++ST GGA LE+LEGK LPGI  L   
Sbjct: 356 SAAAVEQLGFADRMTHISTGGGASLEFLEGKILPGINVLENK 397


>gi|310826282|ref|YP_003958639.1| phosphoglycerate kinase [Eubacterium limosum KIST612]
 gi|308738016|gb|ADO35676.1| phosphoglycerate kinase [Eubacterium limosum KIST612]
          Length = 395

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 243/398 (61%), Gaps = 8/398 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D++G + L+R D+NVP   DG + D TRI+  +PTI  ++++ A +++ SHLG
Sbjct: 3   KTVKDI-DLKGKKVLMRADFNVPLNEDGVITDDTRIQAALPTIKYILDQGASLILMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRF 121
           RP+++ D   SL  V      +L   ++F +D   +G     + A+L  G I+L +N RF
Sbjct: 62  RPKNEPDPKFSLLPVAKRLSEVLGTEVVFNDDGEVVGQVTKDAAAALKPGQILLLQNTRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EE++N+P F + L+  GD ++ DAF  SHRAHAS  G++  LP+  G  +QKEL  + 
Sbjct: 122 RPEEKKNEPSFAKELASLGDVFVEDAFGSSHRAHASTAGVADYLPAVSGFLIQKELDFIG 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + K+P VAI+GGSKVS KI ++ NL++KVD L++GGGMA +FL AQG  +G SL +
Sbjct: 182 GALEDPKRPFVAILGGSKVSDKIGVINNLLEKVDSLIVGGGMAFTFLKAQGYEIGTSLLE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   ++  +A+    ++++P DVVVA E K   P   V   ++P D + LD+G +T
Sbjct: 242 EDKIDLAKELLAKAEAKGVKLLLPIDVVVAPEFKADAPATNVKVDAIPADQMGLDIGVET 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +     I  A+TV+WNGP+GVFE   F + TV VA  +A    E   ++I GGGD+  A
Sbjct: 302 QKLFADTIKGAKTVIWNGPMGVFEFPEFAKGTVAVAKAMA----ESDAVTIIGGGDSAAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G  +  +++ST GGA LE++EGK LPGI  L   
Sbjct: 358 VKQLGFEDGMSHISTGGGASLEFMEGKVLPGIDVLENK 395


>gi|125972662|ref|YP_001036572.1| phosphoglycerate kinase [Clostridium thermocellum ATCC 27405]
 gi|256004748|ref|ZP_05429724.1| Phosphoglycerate kinase [Clostridium thermocellum DSM 2360]
 gi|125712887|gb|ABN51379.1| phosphoglycerate kinase [Clostridium thermocellum ATCC 27405]
 gi|255991341|gb|EEU01447.1| Phosphoglycerate kinase [Clostridium thermocellum DSM 2360]
 gi|316941101|gb|ADU75135.1| Phosphoglycerate kinase [Clostridium thermocellum DSM 1313]
          Length = 397

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 159/397 (40%), Positives = 240/397 (60%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIF 59
           M   +T+ D+ D++G + ++RVD+NVP  +  K+ D  RI   +PTI  LVE  AK ++ 
Sbjct: 3   MMNKKTIEDI-DVKGKKVIVRVDFNVPLDENRKITDDKRIVGALPTIKYLVEHGAKTILV 61

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   ++  S+         +L K ++   D IG       A+L EG +++ ENV
Sbjct: 62  SHLGRPKEGFEEKYSMAPTAVRLGELLGKEVIMAKDVIGPDAKAKAAALKEGEVLMLENV 121

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EE +NDP F + L+   + Y+NDAF  +HRAHAS  GL+  LP+  G  +QKE+ +
Sbjct: 122 RFHKEETKNDPAFAKELASMAEIYVNDAFGTAHRAHASTAGLADYLPAVCGYLIQKEIEV 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +    S  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  A+G  +G SL
Sbjct: 182 MGKALSNPERPFVAILGGAKVSDKIGVIENLIDKVDTLIIGGGMAYTFFKAKGYSIGTSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ D  +    +  +A++   ++++P D VV +E       + V +  +P   + +D+G 
Sbjct: 242 CEDDKVELAKSLMDKAEKKGVKLLLPVDNVVGKEFSNDTERKTVPSDQIPDGWMGMDIGE 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T++   + I  A+TV+WNGP+GVFE   F   T EVA  VA    E   ISI GGGD+ 
Sbjct: 302 ETIKLYSEAIKNAKTVVWNGPMGVFEFSNFANGTREVARAVA----ESGAISIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 358 AAIEQLGFADKITHISTGGGASLEFLEGKVLPGIDVL 394


>gi|148655614|ref|YP_001275819.1| phosphoglycerate kinase [Roseiflexus sp. RS-1]
 gi|166987805|sp|A5UTB6|PGK_ROSS1 RecName: Full=Phosphoglycerate kinase
 gi|148567724|gb|ABQ89869.1| phosphoglycerate kinase [Roseiflexus sp. RS-1]
          Length = 395

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 157/399 (39%), Positives = 234/399 (58%), Gaps = 8/399 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T+ D+ D  G R L+RVD+NVP  +G++ D TRI   +PTI  L+E  A V++ S
Sbjct: 1   MAK-KTIRDI-DWSGKRALVRVDFNVPLENGQITDDTRIRAALPTIRYLLEHGAAVILMS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILH--KNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           HLGRP++K  +   L  VV+    +L   K I       G     +   L  G +++ EN
Sbjct: 59  HLGRPKNKVVESMRLAPVVARLAELLPEAKAIKGTQATTGPAAEAAAQDLKPGEVLVLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF   EE ND    R L++ GD Y+NDAF  +HRAHAS  G++  LP+  G  M+ EL+
Sbjct: 119 TRFDPREEANDESMARELAKLGDVYVNDAFGSAHRAHASTEGVARFLPAVAGFLMEAELA 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L+       +P V I+GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+AQG  +G S
Sbjct: 179 ALQGALENPTRPFVTIIGGAKISDKIGVIENLLGKVDALLIGGGMANTFLLAQGYEMGDS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D       +  +A       ++P DVV+A         +VVS   +P    +LD+G
Sbjct: 239 LVEPDSVPVAKDLLEKAASRGVRFMLPTDVVIADAFSADANRRVVSVGDIPPGWRVLDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +TV    ++I  A+TV+WNGP+GVFE+ PF   T  +A  +A        ++I GGGD+
Sbjct: 299 PETVRAYTEIITTAQTVIWNGPMGVFELAPFAEGTRAIAQAMANCPG----MTIVGGGDS 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + A+   G++++  ++ST GGA LE LEG+ LPG+ AL+
Sbjct: 355 VAAVEQMGLADKIRHISTGGGASLELLEGRILPGVAALN 393


>gi|332799911|ref|YP_004461410.1| phosphoglycerate kinase [Tepidanaerobacter sp. Re1]
 gi|332697646|gb|AEE92103.1| Phosphoglycerate kinase [Tepidanaerobacter sp. Re1]
          Length = 394

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 169/399 (42%), Positives = 250/399 (62%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
              + + D  +++  R L+RVD NVP   +G + D TRI   +PTI  L+ K AKV++ S
Sbjct: 1   MNKKMLEDF-EVKDKRVLVRVDLNVPIDENGDITDDTRIRAALPTINYLISKDAKVILVS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +   SL  V      +L K ++   DCIG T+   +A +    +IL ENVR
Sbjct: 60  HFGRPKGKVNPKYSLAPVAKRLSELLDKEVVMAPDCIGETVENLVAQMKPKDVILLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP+F R L++  D +INDAF  SHRAHAS  G++  LP+  G  MQKE+ ++
Sbjct: 120 FHEGEEKNDPEFARKLAKLADIFINDAFGTSHRAHASTVGVAKFLPAGAGYLMQKEIEIM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +     ++P VAI+GG+KV  KI ++ NL+ KVD L+IGGGMA +FL +QG  +G+SL 
Sbjct: 180 GNALENPERPFVAILGGAKVGDKIGVIKNLLSKVDVLLIGGGMAYTFLKSQGYEIGKSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  EAK    ++++P DVVV  E+K G+P + VS   +P D + +D+G K
Sbjct: 240 ESDKIELAASLLNEAKEKNVKLLLPDDVVVTSELKEGLPYETVSIADIPKDKMGVDIGEK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E    +I +A+TV+WNGP+GVFEIE +   T+ VA  +A    E + ++I GGGD+  
Sbjct: 300 TREKFADIIKEAKTVIWNGPMGVFEIEEYAAGTLAVAKAMA----ESKAVTIIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++   T++ST GGA LE+LEGK+LPG+ AL+  
Sbjct: 356 AVEQMGLAKYMTHISTGGGASLEFLEGKELPGVAALNDK 394


>gi|167771106|ref|ZP_02443159.1| hypothetical protein ANACOL_02460 [Anaerotruncus colihominis DSM
           17241]
 gi|167666776|gb|EDS10906.1| hypothetical protein ANACOL_02460 [Anaerotruncus colihominis DSM
           17241]
          Length = 396

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/397 (38%), Positives = 237/397 (59%), Gaps = 5/397 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +++ D+ D+ G + L+R D+NVP  DG +    RI   +PTI  L+E  A V++ SHL
Sbjct: 5   NKKSVEDI-DVSGKKVLVRCDFNVPLKDGAITSDKRIVAALPTIKYLLEHGAAVILCSHL 63

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   + SL  V      +L K ++   D +G       A+L  G +++ ENVRF 
Sbjct: 64  GRPKGEFKPEFSLAPVAVRLGELLGKPVIMAKDVVGEDAKAKAAALKPGELLMLENVRFE 123

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           + E +N+PD  +  +   + Y+NDAF  +HRAHAS  G++  LP+  G  +QKE++++  
Sbjct: 124 AGETKNNPDLAKAFASLAEIYVNDAFGSAHRAHASTAGVADYLPAVCGFLIQKEITVMGK 183

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S+ K+P VAI+GG+KVS KI ++ NL+ KVD L++GGGMA +F  AQG  +G SLC+ 
Sbjct: 184 ALSDPKRPFVAILGGAKVSDKIGVINNLLDKVDTLIVGGGMAYTFAKAQGYSIGDSLCED 243

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  +   ++  +AK    ++++P D  V  +       +VV + ++P   + +D+G +T 
Sbjct: 244 DKVELAREMLEKAKAKGVKLLLPVDNRVGDKFDANCSVKVVGSDNIPDGWMGMDIGPETE 303

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           +   + I  A TV+WNGP+GVFE + F   T+ VA  VA    +   +SI GGGD+  A+
Sbjct: 304 KLFCEAIKGAGTVVWNGPMGVFEFDKFAGGTLAVAKAVA----DSGAVSIIGGGDSAAAV 359

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A  G  ++ T++ST GGA LE+LEG +LPGI AL+  
Sbjct: 360 AKLGFGDKMTHISTGGGASLEFLEGLELPGIAALNNK 396


>gi|323704684|ref|ZP_08116262.1| Phosphoglycerate kinase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536146|gb|EGB25919.1| Phosphoglycerate kinase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 393

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 164/396 (41%), Positives = 258/396 (65%), Gaps = 6/396 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+ D++G R L+RVD+NVP   +  + D TRI+  +PTI  L++  AKV++ SHLG
Sbjct: 3   KTVRDI-DVKGKRVLVRVDFNVPMDSEKNITDDTRIKAALPTIQYLLDNNAKVILVSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K + + S+  V      +L K ++  +D IG        +L +G ++L ENVRF++
Sbjct: 62  RPKGKFNMEYSMKPVAKRLSELLGKQVIVADDVIGEDAKAKANALKDGEVLLLENVRFHA 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDPDF + L+   D ++NDAF  +HRAHAS TG++  LP+  G  ++KEL+ +   
Sbjct: 122 EEEKNDPDFSKELASLADVFVNDAFGTAHRAHASTTGVASYLPAVSGFLIEKELNFMGGA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F+ A+G  +G+SL + D
Sbjct: 182 LENPERPFVAILGGAKVSDKIGVITNLLDKVDSLLIGGGMAYTFIKAEGHEIGKSLLEED 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  +AK+   ++++P D VV+ E+K+G+P +VV    +P D I +D+G KT+E
Sbjct: 242 KLELAKDLIEKAKQKGVKLLLPVDTVVSAELKSGVPYEVVDIDKMPNDKIGVDIGPKTIE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              +VI  A+TV+WNGP+GVFEI  F + T  +A  +++ +      +I GGGD+  A+ 
Sbjct: 302 EFSKVIKGAKTVVWNGPMGVFEIREFAKGTEAIAKAMSECSG----TTIIGGGDSAAAVE 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             G +++ +++ST GGA LE+LEGK LPGI AL+  
Sbjct: 358 QLGYADKVSHISTGGGASLEFLEGKVLPGIAALNDK 393


>gi|300857057|ref|YP_003782041.1| phosphoglycerate kinase [Clostridium ljungdahlii DSM 13528]
 gi|300437172|gb|ADK16939.1| phosphoglycerate kinase [Clostridium ljungdahlii DSM 13528]
          Length = 398

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/401 (37%), Positives = 237/401 (59%), Gaps = 9/401 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +T+ D+ D+ G R L+R D+NVP  DGK+ D  RI   +PTI  L+EK AKV++ 
Sbjct: 1   MAFNKKTIEDV-DVSGKRVLVRCDFNVPLKDGKITDENRIIGALPTIQYLLEKNAKVILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIG--STLSQSIASLSEGGIILAE 117
           SHLG+P+ +   + SL  V      +L K ++F  D +        ++ ++  G ++L E
Sbjct: 60  SHLGKPKGEPKPEMSLLPVSKRLSELLKKEVVFAADDVVVGKNARAAVKNMKNGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKE 176
           N R+  EE +N+ +F + L+   + ++NDAF  +HRAH S  G++  L +   G  +QKE
Sbjct: 120 NTRYRKEETKNEDNFSKELASLAEIFVNDAFGSAHRAHCSTVGVTKFLDTAVCGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   +  +P +AI+GG+KVS KI ++ NL++KVD L+IGGGM+ +F  A+G  +G
Sbjct: 180 LKFLGNAVEDPIRPFIAILGGAKVSDKINVINNLLEKVDTLIIGGGMSYTFSKAKGHSIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   Q+  +AK    ++++P D V+A +        V     +    + LD
Sbjct: 240 TSLLEEDKLEYARQMIDKAKAKGVKLLLPIDTVIADKFDANAKPIVTDGVDIKDGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +  ++ I  A+TV+WNGP+GVFE E F + T  VA  +A    E    +I GGG
Sbjct: 300 IGPKTSKLYEEAIKDAKTVVWNGPMGVFEFESFAKGTFAVAKAMA----ESEATTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 356 DSAAAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIAALN 396


>gi|320530915|ref|ZP_08031948.1| phosphoglycerate kinase [Selenomonas artemidis F0399]
 gi|320136780|gb|EFW28729.1| phosphoglycerate kinase [Selenomonas artemidis F0399]
          Length = 397

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/399 (37%), Positives = 244/399 (61%), Gaps = 3/399 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ D++G +  +RVD+NVP  + + + + TRI   +PTI  L++  A V++  
Sbjct: 1   MNKKTIRDI-DVKGKKVFVRVDFNVPMDENQNITNDTRIRATLPTINYLLDGGAAVILAC 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H+GRP    +   S   V +    +L K + + +DC+G    ++  +L  G ++L EN+R
Sbjct: 60  HVGRPTEAREPKFSTKPVAARLSELLGKKVQWASDCVGPEAEKAAGALKPGEVLLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           ++ EE++NDP F + L+   D  ++DAF V+HRAHAS  G++  L +  G  M+KE++ +
Sbjct: 120 YHKEEKKNDPAFAKQLAALADVAVDDAFGVAHRAHASNVGITADLETVAGFLMEKEINYI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P VAI+GG+KVS KI ++ N++ KVD ++IGGGMA++F  ++G  +G SL 
Sbjct: 180 GKTLEAPQRPFVAILGGAKVSDKIGVIENMIDKVDTIIIGGGMAHTFDASKGYPIGDSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D  +   ++  +A +   ++++P D+V+A +      TQ V    VP     LD G K
Sbjct: 240 EKDKIELAKELLEKAAKKGVKVVLPVDLVIADKFAADAKTQTVDVDKVPDGWQALDSGAK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   + +  A+TV+WNGP+GVFE + F + T  VAH VA+ TKE    SI GGGD+I 
Sbjct: 300 TSEEYVKALKGAKTVIWNGPMGVFEFDAFAKGTEAVAHAVAQATKE-GATSIVGGGDSIA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           AL   G+S++ +++ST GGA LE LEGK LPGI A++  
Sbjct: 359 ALKKTGLSDQISHISTGGGATLELLEGKVLPGINAIANK 397


>gi|149183681|ref|ZP_01862094.1| phosphoglycerate kinase [Bacillus sp. SG-1]
 gi|148848608|gb|EDL62845.1| phosphoglycerate kinase [Bacillus sp. SG-1]
          Length = 394

 Score =  378 bits (970), Expect = e-103,   Method: Composition-based stats.
 Identities = 161/398 (40%), Positives = 239/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G R   RVD+NVP  +G V D TRI+  +PTI  L E+ AKV++ SH
Sbjct: 1   MNKQTIKDI-DLKGKRVFCRVDFNVPMSEGNVTDETRIKAALPTIQYLSEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V      +L K++   ++  G T+   I  +SEG ++L ENVRF
Sbjct: 60  LGRPKGQVVEELRLTPVAKRLSELLGKDVAKTDEAYGDTVKAEIEKMSEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  E +ND D  +  +   D Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL +L 
Sbjct: 120 YPGETKNDADLAKEFAALADVYVNDAFGAAHRAHASTAGVAEHLPAAAGFLLEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ AQG  VG+SL +
Sbjct: 180 KALTTPERPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKAQGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   Q   +A+    +  +P DVVVA +      T+VV  + +P D   LD+G KT
Sbjct: 240 EDKIDLAKQFMKKAEDKGVKFYMPVDVVVADDFSNDANTKVVPIEEIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  +R V+WNGP+GVFEIE F   T  VA     L       S+ GGGD+  A
Sbjct: 300 QEQYASVIKNSRLVIWNGPMGVFEIEKFANGTKAVA---QALADAADTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++ +++ST GGA LE++EGK+LPG+ AL+  
Sbjct: 357 VEKFDLADKMSHISTGGGASLEFMEGKELPGVSALNDK 394


>gi|193214500|ref|YP_001995699.1| phosphoglycerate kinase [Chloroherpeton thalassium ATCC 35110]
 gi|238692709|sp|B3QWD9|PGK_CHLT3 RecName: Full=Phosphoglycerate kinase
 gi|193087977|gb|ACF13252.1| Phosphoglycerate kinase [Chloroherpeton thalassium ATCC 35110]
          Length = 397

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/398 (39%), Positives = 244/398 (61%), Gaps = 3/398 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
            + +T++D+    G R L+RVD+NVP  DG V D  RI   +P+I +++     V++ SH
Sbjct: 1   MKKKTVDDVS-FAGKRVLMRVDFNVPLKDGAVTDDIRIRGALPSIQKVLSDGGCVILMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K   + SL         +L K +    DCIG  +    A++  G +++ EN+RF
Sbjct: 60  LGRPKGKPVAEMSLKPAADRLAELLGKPVQMAPDCIGDEVKNMAAAMKAGDVLMLENLRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSML 180
           + EEE NDP+F + L+  G+ ++NDAF  +HRAHAS  G+++    S  G  + KEL+ L
Sbjct: 120 HKEEEANDPEFAKSLASLGEVFVNDAFGTAHRAHASTEGVTNYVAESVAGYLIGKELTYL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +   +P VAI+GG+K+S KI +L NL+ KVD +++GG M  +F  AQG  +G+SL 
Sbjct: 180 GEATANPVRPFVAILGGAKISGKIDVLENLLGKVDTVLVGGAMVFTFFKAQGYNIGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    I  +AK S  + ++P DVV+A +      T++ +  S+  D + LD+G +
Sbjct: 240 EDDKLELAKSILEKAKTSGVKFLLPTDVVLADKFDQDANTKIATIDSIEDDWMGLDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T    ++ +  A+TV+WNGP+GVFE+E F + T+ VA  +A  TK+   I++ GGGD+  
Sbjct: 300 TANCFREEVVNAKTVIWNGPMGVFEMEKFAKGTMAVAQALADATKQ-GAITVIGGGDSAA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           A+A AG+ +  T+VST GGA LE+LEGK+LPGI ALS 
Sbjct: 359 AIAVAGLEDSVTHVSTGGGASLEFLEGKELPGIAALSN 396


>gi|307244672|ref|ZP_07526775.1| phosphoglycerate kinase [Peptostreptococcus stomatis DSM 17678]
 gi|306491923|gb|EFM63973.1| phosphoglycerate kinase [Peptostreptococcus stomatis DSM 17678]
          Length = 399

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 236/402 (58%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T+ D+ ++RG +CL+R D+NVP  DGK+ D  R+   +PTI  L+E  A+V++ S
Sbjct: 3   MLNKKTIEDI-NVRGKKCLVRCDFNVPLKDGKITDENRLVGAMPTIKYLIENGARVILCS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V +    +L + ++F  D   +G    +++A + +G ++L EN
Sbjct: 62  HLGKPKGEAKPELSLAPVAARLSEMLGQEVVFAADANVVGENAKKAVAQMKDGDVVLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N+  + + L+   + ++NDAF  +HRAH S  G          G  +QKEL
Sbjct: 122 TRYRKEETKNEEGYSKELASLAEIFVNDAFGTAHRAHCSTVGAGQFLEERVCGYLIQKEL 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L S      +P +AI+GG+KVS K+ ++ NL++KVD L+IGGGMA +F+ A G  +G 
Sbjct: 182 DFLGSAVENPVRPFLAILGGAKVSDKLGVINNLLEKVDTLIIGGGMAYTFIKALGHEIGT 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D      ++  +A+    ++++P DVV A          +   + +P + + LD+
Sbjct: 242 SLLEEDKVAYAKEMMDKAEAKGVKLLLPVDVVYADRFAEDAQPHITEGRDIPANCMGLDI 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E   + + +++TV+WNGP+GVFE E F   T  +A  +A +       +I GGGD
Sbjct: 302 GPKTRELFAKAVKESKTVVWNGPMGVFEFENFANGTKAIAQAMADV----DATTIIGGGD 357

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ +++ST GGA LE+LEGK+LPGIVAL   
Sbjct: 358 SAAAVNQMGFGDKMSHISTGGGASLEFLEGKELPGIVALDDK 399


>gi|2499503|sp|P74421|PGK_SYNY3 RecName: Full=Phosphoglycerate kinase
          Length = 401

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 166/399 (41%), Positives = 243/399 (60%), Gaps = 4/399 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M   +++ +L   D+ G R  +RVD+NVP  +G + D TRI   +PTI +L+ K AKV++
Sbjct: 1   MLSKQSIANLTEADLAGKRVFVRVDFNVPLDNGSITDDTRIRAALPTIKDLLSKGAKVIL 60

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP+ K      L  V      +L + ++  +DCIG+ ++  IASL  GG+ L EN
Sbjct: 61  GSHFGRPKGKVVDSMRLTPVGDRLGELLGQPVVKCDDCIGAEVTAKIASLPNGGVALLEN 120

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           +RF++ EE ND +F + L+ N D Y+NDAF  +HRAHAS  G++H   P+  G  ++KEL
Sbjct: 121 LRFHAGEEGNDAEFAKALAANADLYVNDAFGTAHRAHASTEGVTHFLSPNVAGYLIEKEL 180

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      K+PLVAIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+  G+
Sbjct: 181 QFLQGAIEAPKRPLVAIVGGSKVSSKIGVIETLLDKCDKLIIGGGMIFTFYKAQGLNTGK 240

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  D    +  +AK    E ++P DVVVA         Q V   ++P   + LD+
Sbjct: 241 SLVEEDKLDLAKSLMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDI 300

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +V+  +  +A   TV+WNGP+GVFE + F   T  +A  +A+LT     ++I GGGD
Sbjct: 301 GPDSVKTFQDALAGCGTVIWNGPMGVFEFDKFAVGTEAIACSLAELT-ASGTVTIIGGGD 359

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+   G++ + +++ST GGA LE LEGK LPGI AL
Sbjct: 360 SVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|296134199|ref|YP_003641446.1| Phosphoglycerate kinase [Thermincola sp. JR]
 gi|296032777|gb|ADG83545.1| Phosphoglycerate kinase [Thermincola potens JR]
          Length = 399

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/399 (40%), Positives = 248/399 (62%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
             + ++ D+ D+RG R  LRVD+N P  +   V+D T+I   +PTI  L+E+ AKV+I S
Sbjct: 1   MEVSSVKDI-DVRGKRVFLRVDFNTPLDEQNNVSDDTKIRASLPTINYLLEQGAKVIIAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L++ +    DCIG    +++A +  G I++ ENVR
Sbjct: 60  HLGRPKGQFKPEFSLKPVAERLMQLLNRPVKLAEDCIGEKALKAVAGMQPGDIVMLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EE +NDP F R L++  D Y+NDAF  +HRAHAS  G++  LP   G  M+KE++ +
Sbjct: 120 FHEEETKNDPSFARQLAQLADVYVNDAFGTAHRAHASTAGITEYLPGAAGFLMEKEINYM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++PL+AI+GGSKVS KI +L NL+ KVD ++IGGGMAN+F  A G  +G SL 
Sbjct: 180 SKALESPERPLLAIIGGSKVSDKILVLENLIGKVDTILIGGGMANTFFRAMGYSMGNSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D       +A+ +  + ++P D+++A +++     Q+V    VP     +D+G K
Sbjct: 240 EEDKLDVAKNTMDKARAAGVKFMLPVDLMMADKIEKNARHQLVPVDKVPDGWAAVDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   + IA+A+T++WNGP+GVFEI+ F + T  +AH VA+       ++I GGG ++ 
Sbjct: 300 TAELYGREIARAKTIIWNGPMGVFEIDDFAKGTNYIAHAVAEA----DALTIVGGGQSVQ 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G+++  ++VST GGA LE+LEGK+LPGI AL   
Sbjct: 356 AIRKLGLTDRISHVSTGGGASLEFLEGKELPGIKALEKK 394


>gi|332711379|ref|ZP_08431311.1| phosphoglycerate kinase [Lyngbya majuscula 3L]
 gi|332349928|gb|EGJ29536.1| phosphoglycerate kinase [Lyngbya majuscula 3L]
          Length = 401

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 163/401 (40%), Positives = 255/401 (63%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +++ +L   D+ G   L+R D NVP  D G + D TRI   +PT+ +L++K AKV+
Sbjct: 1   MSK-KSVANLSESDLAGKTVLVRADLNVPLDDNGTITDDTRIRAALPTVQDLLKKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ +  +   L  V      +L + +    DC+G  ++  + +L  G + L E
Sbjct: 60  LCSHLGRPKGQVKESLRLTPVAERLSELLGQPVTMCKDCVGDEVAAQVGALENGQVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N+RF++ EE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++H   PS  G  ++KE
Sbjct: 120 NLRFHAGEEKNDPEFTKQLASLADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     +KPL AI+GGSKVS+KI ++  L++KVDKL+IGGGM  +F  A+GM VG
Sbjct: 180 LQYLQNAVENPEKPLAAIIGGSKVSSKIGVIDTLLEKVDKLLIGGGMIFTFYKARGMSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D    +  +AK    E+++P DVV+A        +Q VS +++P   + LD
Sbjct: 240 KSLVEDDKLDLAKSLEAKAKERGVELLLPTDVVIADNFAPDANSQTVSIEAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  ++ +A  +TV+WNGP+GVFE + F + T  +A+ +A+LTK     +I GGG
Sbjct: 300 IGPDSVKVFQEALADCKTVIWNGPMGVFEFDQFAKGTEAIANSMAELTK-TGASTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+   G++++ +++ST GGA LE LEGK LPGI AL+
Sbjct: 359 DSVAAVEKVGVADQMSHISTGGGASLELLEGKVLPGIAALN 399


>gi|304569549|ref|NP_441843.2| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
          Length = 400

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 167/399 (41%), Positives = 245/399 (61%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+ +++ +L   D+ G R  +RVD+NVP  +G + D TRI   +PTI +L+ K AKV++
Sbjct: 1   MSK-QSIANLTEADLAGKRVFVRVDFNVPLDNGSITDDTRIRAALPTIKDLLSKGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP+ K      L  V      +L + ++  +DCIG+ ++  IASL  GG+ L EN
Sbjct: 60  GSHFGRPKGKVVDSMRLTPVGDRLGELLGQPVVKCDDCIGAEVTAKIASLPNGGVALLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           +RF++ EE ND +F + L+ N D Y+NDAF  +HRAHAS  G++H   P+  G  ++KEL
Sbjct: 120 LRFHAGEEGNDAEFAKALAANADLYVNDAFGTAHRAHASTEGVTHFLSPNVAGYLIEKEL 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      K+PLVAIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+  G+
Sbjct: 180 QFLQGAIEAPKRPLVAIVGGSKVSSKIGVIETLLDKCDKLIIGGGMIFTFYKAQGLNTGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  D    +  +AK    E ++P DVVVA         Q V   ++P   + LD+
Sbjct: 240 SLVEEDKLDLAKSLMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +V+  +  +A   TV+WNGP+GVFE + F   T  +A  +A+LT     ++I GGGD
Sbjct: 300 GPDSVKTFQDALAGCGTVIWNGPMGVFEFDKFAVGTEAIACSLAELT-ASGTVTIIGGGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+   G++ + +++ST GGA LE LEGK LPGI AL
Sbjct: 359 SVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|169826062|ref|YP_001696220.1| phosphoglycerate kinase [Lysinibacillus sphaericus C3-41]
 gi|168990550|gb|ACA38090.1| Phosphoglycerate kinase [Lysinibacillus sphaericus C3-41]
          Length = 394

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/399 (38%), Positives = 246/399 (61%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +TM D+ D++G R  +RVD+NVP  DG + D TRI   +PT+  LVE+ AKV++ S
Sbjct: 1   MLNKKTMKDI-DVKGKRVFVRVDFNVPMADGVITDETRIRAAIPTVEYLVEQGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +  +D  L  V      ++ K +  +++ IG  + +++A++ +G I+L ENVR
Sbjct: 60  HLGRPKGEVKEDMRLTAVGIRLAELMSKPVTKLDESIGQAVEKAVANMQDGDILLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP   +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  MQ EL +L
Sbjct: 120 FHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGIAKHIPAVSGFLMQTELDVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  + P  AI+GG+KV  KI ++ +L++KVD L+IGGG++ +F+ AQG  +G+SL 
Sbjct: 180 GKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGLSFTFIKAQGYDIGKSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +       +AK    ++ +P D VVA E      T+VV   ++P D + LD+G K
Sbjct: 240 EEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQDAETKVVDVDAIPADWMGLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T  +  +VI  ++ ++WNGP+GVFE++ F   T  VA  +A         ++ GGGD+  
Sbjct: 300 TAAHYAEVINNSKLIIWNGPMGVFEMDKFANGTKTVADAMAT----TSGYTVIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+    ++++  ++ST GGA LE +EGK+LPGIVAL+  
Sbjct: 356 AVEKFKVADKMDHISTGGGASLELMEGKELPGIVALNDK 394


>gi|312899149|ref|ZP_07758527.1| phosphoglycerate kinase [Megasphaera micronuciformis F0359]
 gi|310619816|gb|EFQ03398.1| phosphoglycerate kinase [Megasphaera micronuciformis F0359]
          Length = 392

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/394 (40%), Positives = 245/394 (62%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+  + G +  +R D+NVP  D + + D TRI + +PTI  L++  + V++ SHLG
Sbjct: 3   KTIKDVS-LDGKKVFVRADFNVPLDDKQQITDDTRIVKTLPTIQYLLDHNSAVILASHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ ++  + SL  V +    +L + +    DC+G    +   SL  G ++L EN+R++ 
Sbjct: 62  RPKGEAKPEFSLRPVAARLSELLGRTVQMAPDCVGPETEKMAKSLKPGEVLLLENLRYHK 121

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
           EEE+NDP F + L++  D  INDAF  SHRAHAS+ G++  LP   G  ++KE+  +   
Sbjct: 122 EEEKNDPAFSKALAQLADVGINDAFGCSHRAHASVAGITEFLPMAAGLLLEKEIRFIGGA 181

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               + P  AI+GG+KVS KI ++ +L+ KVD ++IGGGMAN+FL AQG G+G+SL + D
Sbjct: 182 VEHPEHPFAAIIGGAKVSDKIEVISSLLPKVDLMIIGGGMANTFLAAQGYGIGKSLVEAD 241

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +    +  EAK+   E+++P DVVVA E       + V    VP D +ILD+G K+ E
Sbjct: 242 KIELASTLMEEAKKQNTELLLPVDVVVAAEFAAQALYKEVDVADVPADWMILDIGTKSRE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
                +   + ++WNGP+GVFE+E F + T  VA  VA    + + +S+ GGGD++ A+ 
Sbjct: 302 LFAHKLEPMKLIVWNGPMGVFEMEHFAKGTEAVAQAVA----DSKAVSVVGGGDSVAAVN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG++++ T++ST GGA LE+LEGK LPGI +LS
Sbjct: 358 KAGLADKITHISTGGGASLEYLEGKILPGIASLS 391


>gi|303230774|ref|ZP_07317521.1| phosphoglycerate kinase [Veillonella atypica ACS-049-V-Sch6]
 gi|302514534|gb|EFL56529.1| phosphoglycerate kinase [Veillonella atypica ACS-049-V-Sch6]
          Length = 392

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/395 (37%), Positives = 243/395 (61%), Gaps = 6/395 (1%)

Query: 4   LR-TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ T+ D+ ++   R  +RVD+NVP  DG + D TRI   + TI  L++  AKV++ SH 
Sbjct: 1   MKLTILDM-NVDNKRVFVRVDFNVPMKDGVITDDTRIRGALETIKYLIDHNAKVILASHF 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   D +L         +++K + FV+DC+G  +  ++ +L  G +++ EN+R++
Sbjct: 60  GRPKGERKPDMTLAPCAKRLSELINKPVAFVDDCVGPKVEAAVEALQPGDVLMLENLRYH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           +EE +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +
Sbjct: 120 NEETKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMGAGFLLKKEIDALSA 179

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL + 
Sbjct: 180 AVVHPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLYED 239

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                   +  EA+ +   ++ P D VVA        T++V   ++    +ILD+G KT 
Sbjct: 240 GQDAIATDLVMEARVAGARLLTPIDAVVADAFSNDANTKIVDVDNIEDGWMILDIGPKTR 299

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           +   + +A  +T++WNGP+GVFE++ F   T  VA  VA    E   ++I GGGD++ A+
Sbjct: 300 DLYTEALANMKTIIWNGPMGVFEMDNFAAGTNAVAKAVA----ESDAMTIVGGGDSVAAI 355

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             +G++++ +++ST GGA LE LEGK LPGI AL+
Sbjct: 356 EKSGLADKISHISTGGGASLELLEGKVLPGIAALT 390


>gi|254424136|ref|ZP_05037854.1| phosphoglycerate kinase [Synechococcus sp. PCC 7335]
 gi|196191625|gb|EDX86589.1| phosphoglycerate kinase [Synechococcus sp. PCC 7335]
          Length = 401

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 168/400 (42%), Positives = 252/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ + + DL   D+ G R L+R D+NVP  D G + D TRI   +PTI +L  K AKV+
Sbjct: 1   MAK-KALADLSASDVSGKRVLVRADFNVPLDDAGNITDDTRIRAALPTIQDLTSKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L  V +     L ++++  +DCIG  ++  IA + +G + L E
Sbjct: 60  LASHFGRPKGKVVESMRLTPVAARLSEKLGQDVIKCDDCIGDEVAAKIAEMKDGDVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY  E  N+P+F + L+ N D Y+NDAF  +HRAHAS  G++  L   + G  ++KE
Sbjct: 120 NVRFYDGETNNEPEFAKQLAANADLYVNDAFGTAHRAHASTAGVTEYLSPAVAGSLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      ++PL AIVGGSKVS+KI ++  L+ KVDKL IGGGM  +F  A+G+GVG
Sbjct: 180 LKFLQETVDNPQRPLAAIVGGSKVSSKIGVIETLLDKVDKLFIGGGMIFTFFKARGIGVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D   ++  +AK    E ++P DV+VA +      TQ VS +++P   + LD
Sbjct: 240 SSLVEEDKLDLAKKLEAKAKEKGVEFLLPTDVIVADKFAADANTQTVSVENIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  ++V+WNGP+GVFE+E F + T  +A  +A LT ++  I+I GGG
Sbjct: 300 IGPDSVKTFQDALADCKSVIWNGPMGVFEMEAFAKGTTGIATTLAGLT-DKGCITIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPGI AL
Sbjct: 359 DSVAAVEQAGLADKMSHISTGGGASLELLEGKTLPGIAAL 398


>gi|210621896|ref|ZP_03292893.1| hypothetical protein CLOHIR_00838 [Clostridium hiranonis DSM 13275]
 gi|210154527|gb|EEA85533.1| hypothetical protein CLOHIR_00838 [Clostridium hiranonis DSM 13275]
          Length = 397

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 145/399 (36%), Positives = 228/399 (57%), Gaps = 8/399 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T+ D++ + G R L+R D+NVP  DG + D  R+   +PTI  L++  A+V++ S
Sbjct: 1   MLNKKTIEDIQ-VAGKRVLVRCDFNVPLKDGVITDENRLNGALPTIKYLIDHNARVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIG--STLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L + + F  D         ++ A + +G +IL +N
Sbjct: 60  HLGKPKGEAKPELSLAPVAKRLSEMLGQEVKFAADDCVVGENAKKAAAEMKDGEVILLQN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N+ +F + L+   + ++NDAF  +HRAH S  G          G  +QKEL
Sbjct: 120 TRYRKEETKNEENFSKELASLAEIFVNDAFGTAHRAHCSTVGAGEFLEERACGYLIQKEL 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L       ++P VAI+GG+KVS K+ ++ NL+ KVD L+IGGGM  +FL A G  +G 
Sbjct: 180 KFLGEAVETPERPFVAILGGAKVSDKLGVINNLLDKVDTLIIGGGMGYTFLKAMGHEIGN 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D  D V ++  +A+    ++++P DV  A +        +   + +P D   LD+
Sbjct: 240 SLCEEDKIDYVKEMMAKAEAKGVKLLLPIDVTYAAKFGENETPMISEGRDIPADCEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E     +  A+TV+WNGP+GVFE + F + T  VA  +A    E   ++I GGGD
Sbjct: 300 GPKTAELFANEVKAAKTVVWNGPMGVFEFKNFAKGTEAVAKAMA----ETEAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G  ++ T++ST GGA LE+LEGK+LPGI +L
Sbjct: 356 SAAAVNQMGFGDKMTHISTGGGASLEFLEGKELPGIASL 394


>gi|295401524|ref|ZP_06811493.1| Phosphoglycerate kinase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109551|ref|YP_003987867.1| phosphoglycerate kinase [Geobacillus sp. Y4.1MC1]
 gi|294976436|gb|EFG52045.1| Phosphoglycerate kinase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214652|gb|ADP73256.1| Phosphoglycerate kinase [Geobacillus sp. Y4.1MC1]
          Length = 394

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/398 (39%), Positives = 239/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D++G R   RVD+NVP  +G + D TRI   +PTI  L+E+ AKV++ SH
Sbjct: 1   MNKKTIQDV-DVKGKRVFCRVDFNVPMENGAITDDTRIRAALPTIRYLIEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L K ++  ++  G  +  +IA + EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLNAVAERLSELLGKQVVKTDEAYGEAVKTAIAGMKEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADIYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPERPFTAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLAYTFVKALGHEVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P D VVA        T+VV+  ++P D   LD+G KT
Sbjct: 240 EDKIELAKSFMEKAKEKGVNFYMPVDAVVADRFANDANTKVVAIDAIPSDWEALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI +++ V+WNGP+GVFE++ F   T  VA     L       S+ GGGD+  A
Sbjct: 300 CELYRDVIMKSKLVVWNGPMGVFEMDAFAGGTKAVA---QALADAADTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 357 VEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALNDK 394


>gi|22299811|ref|NP_683058.1| phosphoglycerate kinase [Thermosynechococcus elongatus BP-1]
 gi|30172993|sp|Q8DGP7|PGK_THEEB RecName: Full=Phosphoglycerate kinase
 gi|22295995|dbj|BAC09820.1| phosphoglycerate kinase [Thermosynechococcus elongatus BP-1]
          Length = 400

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 165/400 (41%), Positives = 254/400 (63%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +++  L   D+ G R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MSK-KSVAQLSAADLEGKRVLVRVDFNVPVDEKGVITDETRIRAALPTIQDLISKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+   D+   L  V      +LHK +  ++DCIG  +     +++ G + L E
Sbjct: 60  LVSHFGRPKG-VDEKLRLTPVAQRLSELLHKPVAKLDDCIGDAVIAHTQAMANGDVCLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF+  EE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 119 NVRFHPGEEKNDPEFAKQLAACAEVYVNDAFGTAHRAHASTAGVTQYLSPCVAGFLMEKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AIVGGSKVS+KI ++  L++KVDKL+IGGGM  +F  A+G+ VG
Sbjct: 179 LEYLQNAIEHPRRPLAAIVGGSKVSSKIGVIEALLEKVDKLLIGGGMIFTFYKARGLNVG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +A+    E+++P DVVVA        +QVVS +++P D + LD
Sbjct: 239 KSLVEEDKLELAKHLETKAQEKGVELLLPTDVVVADNFANDANSQVVSIEAIPDDWMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  ++ +   +TV+WNGP+GVFE + F + T  +A Y+A+LT +    +I GGG
Sbjct: 299 IGPASVKRFQEALQDCKTVIWNGPMGVFEFDQFAKGTEAIARYLAELTSQGVC-TIIGGG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK LPGI AL
Sbjct: 358 DSVAAVEKVGVADRMSHISTGGGASLELLEGKQLPGIAAL 397


>gi|315644537|ref|ZP_07897669.1| Phosphoglycerate kinase [Paenibacillus vortex V453]
 gi|315280044|gb|EFU43341.1| Phosphoglycerate kinase [Paenibacillus vortex V453]
          Length = 393

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSVRDV-EVSGKRVFVRVDFNVPLEDGKITDDTRIRETLPTINYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           +GRP+ +  +   L         +L K +   ++ +G  +   +  L  G +++ ENVRF
Sbjct: 60  MGRPKGEVVESLRLTPASERLSELLGKPVAKADEAVGEAVKAQVNQLQNGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L 
Sbjct: 120 YPGEEKNDPELAKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELSVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  
Sbjct: 180 KALSNPDRPFTAIIGGSKVKDKIDVIDNLLTLADNVIIGGGLAYTFFKAQGHEIGQSLLD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           ++  D       +AK       +P D+VV  E      T++V    +P D   +D+G KT
Sbjct: 240 KEKLDVALGFIEKAKELGKNFYLPEDIVVTDEFSADANTKIVGIDGIPADWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
                +VI  ++ V+WNGP+GVFEI PF   T EVA   A    E    +I GGGD+  A
Sbjct: 300 RAKYAEVIKNSKLVVWNGPMGVFEIAPFSNGTREVAQACA----ETEAYTIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
               G++++  ++ST GGA LE++EGK+LPG+VAL+  
Sbjct: 356 AEKFGLADKMDHISTGGGASLEFMEGKELPGVVALNDK 393


>gi|196249344|ref|ZP_03148042.1| Phosphoglycerate kinase [Geobacillus sp. G11MC16]
 gi|196211101|gb|EDY05862.1| Phosphoglycerate kinase [Geobacillus sp. G11MC16]
          Length = 394

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 163/398 (40%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ ++RG R   RVD+NVP  DG + D TRI   +PTI  L+E  AKV++ SH
Sbjct: 1   MNKKTIRDV-EVRGKRVFCRVDFNVPMEDGAITDDTRIRAALPTIQYLIEHGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L + ++  N+ IG  +  ++A+L+EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLDAVAKRLGELLERPVVKTNEAIGDEVKAAVANLNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  R  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L 
Sbjct: 120 YPGEEKNDPELARAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKALGHDVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA        T+VV   ++P D   LD+G +T
Sbjct: 240 EDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPSDWEALDIGPQT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI Q++ V+WNGP+GVFE+E F   T  VA     L +     S+ GGGD+  A
Sbjct: 300 RELYRDVIRQSKLVVWNGPMGVFEMETFSHGTRAVA---EALAEAADTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 357 VEKFDLADKMDHISTGGGASLEFMEGKQLPGVVALNDK 394


>gi|170744059|ref|YP_001772714.1| phosphoglycerate kinase [Methylobacterium sp. 4-46]
 gi|168198333|gb|ACA20280.1| Phosphoglycerate kinase [Methylobacterium sp. 4-46]
          Length = 398

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 205/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+R RT++D  D++G R L+RVD NVP  +G+V+D TRI RV+PTI E+ E   +VV+ +
Sbjct: 1   MTRFRTLDDAGDLKGKRVLVRVDLNVPMENGRVSDATRITRVLPTIREIAEAGGRVVLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  +     + L + + F  DC+G   + ++A+L +G +++ EN R
Sbjct: 61  HFGRPKGKPDPKESLRPIAEAVAADLGRPVAFAEDCVGEAAAAAVAALGDGDVVMLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF R L+RNGD Y+N+AFS SHRAHAS  GL+H+LP+Y GR MQ E+  L
Sbjct: 121 FHPGEEKNDPDFARALARNGDVYVNEAFSASHRAHASTEGLAHVLPAYAGRLMQAEIEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P+VAIVGGSKVSTKI LL+NLV KVD LVIGGGMAN+FL A G+GVG+SLC
Sbjct: 181 TKGLEAPARPVVAIVGGSKVSTKIDLLVNLVGKVDALVIGGGMANTFLHAAGLGVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +    +I   A+   C II+P D VVA E K   P       ++P   +ILDVG +
Sbjct: 241 EKDLAGTALRIIEAAREKNCAIILPVDAVVAEEFKANAPHHTYGVDAIPQAGMILDVGSQ 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE +   +  ART++WNGPLG FE  PFD+ TV  A + A+ T+  R++S+AGGGDT+ 
Sbjct: 301 SVERVAAALNDARTLVWNGPLGAFEFPPFDQGTVAAARHAAERTRAGRLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++  FTYVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 361 ALNHAGVAEAFTYVSTAGGAFLEWLEGKPLPGVDAL 396


>gi|156742045|ref|YP_001432174.1| phosphoglycerate kinase [Roseiflexus castenholzii DSM 13941]
 gi|189036828|sp|A7NKY6|PGK_ROSCS RecName: Full=Phosphoglycerate kinase
 gi|156233373|gb|ABU58156.1| Phosphoglycerate kinase [Roseiflexus castenholzii DSM 13941]
          Length = 395

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/399 (38%), Positives = 235/399 (58%), Gaps = 8/399 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T+ D+ D  G R L+RVD+NVP  +G++ D TRI   +PTI  L+E  A V++ S
Sbjct: 1   MAK-KTIRDI-DWSGKRALVRVDFNVPLENGQITDDTRIRAALPTIRYLLEHGAAVILMS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILH--KNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           HLGRP++K  +   L  VV+    +L   K +       G     +   L  G +++ EN
Sbjct: 59  HLGRPKNKVVESMRLAPVVARLAELLPEAKAVKGSQATTGPAAEAAARDLKPGEVLVLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF   EE ND    R L++ GD Y+NDAF  +HRAHAS  G++  LP+  G  M+ EL+
Sbjct: 119 TRFDPREEANDESMARELAKLGDVYVNDAFGSAHRAHASTEGVARFLPAVAGFLMEAELA 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L+       +P V I+GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+AQG  +G S
Sbjct: 179 ALQGALENPARPFVTIIGGAKISDKIGVIENLLGKVDALLIGGGMANTFLLAQGHEMGDS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D +     +  +A +    +++P DVV+A         +VV    +P     LD+G
Sbjct: 239 LVEPDSAPIAKSLLDQAAQRGVRLMLPTDVVIADAFSADANRKVVPVGEIPPGWRALDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T+    +VI  A+TV+WNGP+GVFE+ PF   T  +A  +A        ++I GGGD+
Sbjct: 299 PETIRAYTEVITGAQTVIWNGPMGVFELAPFAEGTRAIAQAMANCPG----MTIIGGGDS 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + A+   G++++  ++ST GGA LE LEG+ LPG+ AL+
Sbjct: 355 VAAIEQMGLADKIRHISTGGGASLELLEGRILPGVAALN 393


>gi|134300822|ref|YP_001114318.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
 gi|134053522|gb|ABO51493.1| phosphoglycerate kinase [Desulfotomaculum reducens MI-1]
          Length = 393

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/398 (40%), Positives = 249/398 (62%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
            + +++ D+ D++G R  +RVD+NVP    K+ D TRI++ +PTI  L+ + A+V++ SH
Sbjct: 1   MQKKSVRDV-DVKGKRVFVRVDFNVPLDREKITDDTRIQKALPTIQYLMGQGARVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  +   L  V      +L + ++ VN+ +G+   Q+IA + +G ++L ENVRF
Sbjct: 60  LGRPKGEVVEKYRLNPVAKRLSELLGQEVVKVNESVGTEPQQAIAQMKDGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EE +ND  + R L++  D ++NDAF  +HRAHAS  G++  LP+  G  M+KEL  L 
Sbjct: 120 HGEETKNDEKYARQLAQLADLFVNDAFGAAHRAHASTAGIAEYLPAVAGFLMEKELENLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL +
Sbjct: 180 KAVTNPERPFVAIIGGAKVSDKIGVIENLLSKVDTLIIGGGMANTFLKAQGYDIGKSLIE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   ++   +K    E+++P D VVA  M+      VV    VP D +ILD+G  T
Sbjct: 240 PDKVELAKELLERSKAQKVELLLPNDAVVALAMEPNAQQGVVPVSGVPADWMILDIGPDT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E       +A TV+WNGP+GVFE++ F + T  VA  +A    E   I+I GGGD++ A
Sbjct: 300 AECYAAAAKKAATVVWNGPMGVFEMDAFAKGTEAVAKALA----ESNAITIVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G+++  +++ST GGA LE+LEGK LPG+ AL   
Sbjct: 356 VNKVGVADRISHISTGGGASLEFLEGKVLPGVAALQDK 393


>gi|261404073|ref|YP_003240314.1| phosphoglycerate kinase [Paenibacillus sp. Y412MC10]
 gi|261280536|gb|ACX62507.1| Phosphoglycerate kinase [Paenibacillus sp. Y412MC10]
          Length = 393

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/398 (38%), Positives = 231/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSVRDV-EVSGKRVFVRVDFNVPLEDGKITDDTRIRETLPTIKYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           +GRP+ +  +   L         +L K +   ++ +G  +   +  L  G +++ ENVRF
Sbjct: 60  MGRPKGEVVESLRLTPASQRLSELLGKPVAKADEAVGEAVKAQVEKLQNGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L 
Sbjct: 120 YPGEEKNDPELAKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELSVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  
Sbjct: 180 KALSNPDRPFTAIIGGSKVKDKIDVIDNLLTLADNVIIGGGLAYTFFKAQGHEIGQSLLD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           ++  D       +AK       +P D+VV  E      T+VV    +P D   +D+G KT
Sbjct: 240 KEKLDVALGFIEKAKELGKNFYLPEDIVVTDEFSADANTKVVDIDGIPADWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
                +VI  ++ V+WNGP+GVFEI PF   T EVA   A    E    +I GGGD+  A
Sbjct: 300 RAKYAEVIKNSKLVVWNGPMGVFEIAPFSNGTREVAQACA----ETEAYTIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
               G++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 AEKFGLADKMDHISTGGGASLEFMEGKALPGVVALNDK 393


>gi|218438562|ref|YP_002376891.1| phosphoglycerate kinase [Cyanothece sp. PCC 7424]
 gi|226699798|sp|B7K9Q5|PGK_CYAP7 RecName: Full=Phosphoglycerate kinase
 gi|218171290|gb|ACK70023.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7424]
          Length = 401

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 253/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M + +T+ +L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MPK-KTIANLSRADVEGKRVLVRVDFNVPLDDAGNITDDTRIRAALPTIQDLISKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L         +L ++++  +DC+G+++++++  L  G + L E
Sbjct: 60  LCSHFGRPKGKVVESMRLTPTAKRLSELLGQDVVMCDDCVGASVTEAVNKLENGQVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N+RF++EEE NDP+F + L+ N D Y+NDAF  +HRAHAS  G++H   PS  G  ++KE
Sbjct: 120 NLRFHAEEEGNDPEFSKQLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L+ L+S     ++PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG
Sbjct: 180 LNYLQSAIENPQRPLAAIIGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +A     ++++P DVVVA         + V  + +P   + LD
Sbjct: 240 KSLVEEDKLELAKSLEAKASEKGVQLLLPTDVVVADAFDANANDKTVKIEEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  ++V+WNGP+GVFE + F + T  +A+ +  LT  +   +I GGG
Sbjct: 300 IGPDSVKLFQDALADCKSVIWNGPMGVFEFDKFAKGTEAIAYTLETLTG-KGATTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPGI AL
Sbjct: 359 DSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|81299925|ref|YP_400133.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
 gi|123556987|sp|Q31P73|PGK_SYNE7 RecName: Full=Phosphoglycerate kinase
 gi|81168806|gb|ABB57146.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
          Length = 402

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 247/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ RT+  L   D+ G R L+RVD+NVP   +GK+ D TRI   +PTI  L E  AKV+
Sbjct: 1   MSK-RTLASLTAADLEGKRVLVRVDFNVPLDGNGKITDDTRIRAALPTIRYLSESGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L  V      +L + ++   D +G+     +A+ S G ++L E
Sbjct: 60  LVSHFGRPKGKPVESMRLTPVAERLSELLGRPVVKTTDAVGAGAEAQVAATSNGQVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF++EEE ND +F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  ++KE
Sbjct: 120 NVRFHAEEEANDAEFAKALASLADIYVNDAFGAAHRAHASTAGVTEYLSPCVAGYLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+ VG
Sbjct: 180 LQYLQAAIDNPQRPLAAIVGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +A+    ++++P DVVVA +       + V+  ++P   + LD
Sbjct: 240 GSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  ++ +A  R+V+WNGP+GVFE + F   T  +A  +A LT+ +   +I GGG
Sbjct: 300 IGPESVKQFEEALADCRSVIWNGPMGVFEFDQFAVGTEAIARSLAGLTR-KGATTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++E +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|77918936|ref|YP_356751.1| phosphoglycerate kinase [Pelobacter carbinolicus DSM 2380]
 gi|77545019|gb|ABA88581.1| phosphoglycerate kinase [Pelobacter carbinolicus DSM 2380]
          Length = 396

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/401 (38%), Positives = 241/401 (60%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M    T+ D+ D +G R   RVD+NVP   DG++ D TRI   +PTI  ++E+  ++++ 
Sbjct: 1   MFTKMTVKDV-DFKGKRVFCRVDFNVPLDKDGRITDDTRIVAALPTIKYILEQGGRLILA 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+     + SL         +L ++++   DCIG+ + + +  L+EG +++ ENV
Sbjct: 60  SHLGRPKGTPKPEFSLAPAAEHLGGLLGQSVIMAPDCIGAEVEKLVDQLAEGAVLMLENV 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELS 178
           RF+  E  NDP F + L+   D Y+NDAF  +HRAHAS  G++ LL   + G  ++KEL 
Sbjct: 120 RFHKGETENDPAFCKQLAALADVYVNDAFGTAHRAHASTEGVARLLSPAVGGFLIEKELR 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L    +E  +P VA++GG+KVS K+  + N+++KVD L+IGGGMA +FL A+G  +G S
Sbjct: 180 YLGQAIAEPVRPFVAVLGGAKVSDKLPAIENMLEKVDALIIGGGMAYTFLKAKGYDLGNS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  +   ++   A      +++P D + A E K     +V      P   + LD+G
Sbjct: 240 LVEEDRLEMASELMARAAAKGVAMLLPEDHLAAAEFKADAEHKVCGNDDFPAGWMGLDIG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T++   +V+  A TV+WNGP+GVFE + F + T  VA  +A    E + +SI GGGD+
Sbjct: 300 PRTIDRFSEVLKDAGTVVWNGPMGVFEFDTFAQGTFAVAKVIA----ESQAVSIVGGGDS 355

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             A   +G++++ T++ST GGA LE+LEGK LPGIVAL+  
Sbjct: 356 SAAAKKSGLADKMTHISTGGGASLEFLEGKALPGIVALTDK 396


>gi|129919|sp|P18912|PGK_BACST RecName: Full=Phosphoglycerate kinase
 gi|157833493|pdb|1PHP|A Chain A, Structure Of The Adp Complex Of The 3-Phosphoglycerate
           Kinase From Bacillus Stearothermophilus At 1.65
           Angstroms
 gi|48855|emb|CAA41093.1| 3-phosphoglycerate kinase [Geobacillus stearothermophilus]
          Length = 394

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 237/398 (59%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ D+ D+RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SH
Sbjct: 1   MNKKTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRF
Sbjct: 60  LGRPKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL +
Sbjct: 180 KALSNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +       +AK       +P DVVVA        T+VV   ++P D   LD+G KT
Sbjct: 240 EDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E  + VI +++ V+WNGP+GVFE++ F   T  +A     L +     S+ GGGD+  A
Sbjct: 300 RELYRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIA---EALAEALDTYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G++++  ++ST GGA LE++EGK LPG+VAL   
Sbjct: 357 VEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK 394


>gi|303228374|ref|ZP_07315207.1| phosphoglycerate kinase [Veillonella atypica ACS-134-V-Col7a]
 gi|302516876|gb|EFL58785.1| phosphoglycerate kinase [Veillonella atypica ACS-134-V-Col7a]
          Length = 392

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/395 (37%), Positives = 243/395 (61%), Gaps = 6/395 (1%)

Query: 4   LR-TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ T+ D+ ++   R  +RVD+NVP  DG + D TRI   + TI  L++  AKV++ SH 
Sbjct: 1   MKLTILDM-NVDNKRVFVRVDFNVPMKDGVITDDTRIRGALDTIKYLIDHNAKVILASHF 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +   D +L         +++K + FV+DC+G  +  ++ +L  G +++ EN+R++
Sbjct: 60  GRPKGERKPDMTLAPCAKRLSELINKPVAFVDDCVGPKVEAAVEALQPGDVLMLENLRYH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           +EE +NDP+F + L+   D  INDAF VSHR  AS+ G++  +P   G  ++KE+  L +
Sbjct: 120 NEETKNDPEFAKQLASLADVAINDAFGVSHRNAASVVGIADYIPMGAGFLLKKEIDALSA 179

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                K P+ AI+GG+KV+ KI+++ NL+ KVD ++IGGGMAN+F+ AQG  +G SL + 
Sbjct: 180 AVVHPKTPMAAIIGGAKVTDKISVISNLLPKVDVMIIGGGMANAFIKAQGCNIGSSLYED 239

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
                   +  EA+ +   ++ P D VVA        T++V   ++    +ILD+G KT 
Sbjct: 240 GQDAIATDLVMEARVAGARLLTPIDAVVADAFSNDANTKIVDVDNIEDGWMILDIGPKTR 299

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           +   + +A  +T++WNGP+GVFE++ F   T  VA  VA    E   ++I GGGD++ A+
Sbjct: 300 DLYTEALANMKTIIWNGPMGVFEMDKFAAGTNAVAKAVA----ESDAMTIVGGGDSVAAI 355

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             +G++++ +++ST GGA LE LEGK LPGI AL+
Sbjct: 356 EKSGLADKISHISTGGGASLELLEGKVLPGIAALT 390


>gi|326201354|ref|ZP_08191226.1| triosephosphate isomerase [Clostridium papyrosolvens DSM 2782]
 gi|325988922|gb|EGD49746.1| triosephosphate isomerase [Clostridium papyrosolvens DSM 2782]
          Length = 646

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/397 (38%), Positives = 239/397 (60%), Gaps = 6/397 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M   +T+ D+ D+ G + ++RVD+NVP   D K+ D  RI   +PTI  LVEK AK ++ 
Sbjct: 3   MMNKKTIEDI-DVAGKKVIVRVDFNVPLDADRKITDDKRIVGALPTIKYLVEKGAKTILV 61

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   +   S+         +L K ++   D +G       A+L +G +++ ENV
Sbjct: 62  SHLGRPKEGFEDKFSMKPTAVRLGELLGKEVIMAKDVVGEDAKAKAAALKDGEVLMLENV 121

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EE +ND +F + L+   + ++NDAF  +HRAHAS  GL+  LP+  G  ++KE+  
Sbjct: 122 RFHKEETKNDANFAKELASMAEIFVNDAFGTAHRAHASTAGLADYLPAVCGFLIKKEIEF 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +    +   +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +FL A+G  +G S+
Sbjct: 182 MGKALANPARPFVAILGGAKVSDKIAVIENLIDKVDTLIIGGGMAYTFLKAKGYHIGNSI 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ +  D    +  +A+     +++P   +VA+E K     + V + ++P   + +D+G 
Sbjct: 242 CEEEKIDLAKTLMEKAEAKGVNLMLPIGSMVAKEFKNDTEIKYVPSDAMPDGWMGMDIGS 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            T+E   + I +A+TV+WNGP+GVFE   F   T E+A  VA    E   +SI GGGD+ 
Sbjct: 302 LTIEKFAKEIMKAKTVIWNGPMGVFEFPNFAIGTKEIAKSVA----ESGALSIVGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G +++ T++ST GGA LE+LEGK+LPGI  L
Sbjct: 358 AAVEQLGYADKITHISTGGGASLEFLEGKELPGIAVL 394


>gi|329928012|ref|ZP_08282016.1| phosphoglycerate kinase [Paenibacillus sp. HGF5]
 gi|328938116|gb|EGG34513.1| phosphoglycerate kinase [Paenibacillus sp. HGF5]
          Length = 393

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/398 (38%), Positives = 231/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DGK+ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSVRDV-EVSGKRVFVRVDFNVPLEDGKITDDTRIRETLPTIKYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           +GRP+ +  +   L         +L K +   ++ +G  +   +  L  G +++ ENVRF
Sbjct: 60  MGRPKGEVVESLRLTPASQRLSELLGKPVAKADEAVGEAVKAQVEKLQNGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L 
Sbjct: 120 YPGEEKNDPELTKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELSVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  
Sbjct: 180 KALSNPDRPFTAIIGGSKVKDKIDVIDNLLTLADNVIIGGGLAYTFFKAQGHEIGQSLLD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           ++  D       +AK       +P D+VV  E      T+VV    +P D   +D+G KT
Sbjct: 240 KEKLDVALGFIEKAKELGKNFYLPEDIVVTDEFSADANTKVVDIDGIPADWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
                +VI  ++ V+WNGP+GVFEI PF   T EVA   A    E    +I GGGD+  A
Sbjct: 300 RAKYAEVIKNSKLVVWNGPMGVFEIAPFSNGTREVAQACA----ETEAYTIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
               G++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 AEKFGLADKMDHISTGGGASLEFMEGKALPGVVALNDK 393


>gi|310657953|ref|YP_003935674.1| phosphoglycerate kinase [Clostridium sticklandii DSM 519]
 gi|308824731|emb|CBH20769.1| phosphoglycerate kinase [Clostridium sticklandii]
          Length = 398

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 152/401 (37%), Positives = 238/401 (59%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   + +ND+ D++G + ++R D+NVP  +G++ D  RI+  + TI  L E KAKV++ S
Sbjct: 3   MLNKKAVNDI-DVKGKKVIVRCDFNVPMKNGEITDDRRIKGALETINYLTENKAKVILMS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLGRP  K + + SL  V      +  K +    D   +G       AS++EG I+L EN
Sbjct: 62  HLGRPDKKYEPEFSLAPVAKRLSELTGKEVKLAQDEAVVGENAKALTASMNEGDIVLLEN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRF   E +ND DF + L+   D ++NDAF  +HRAH+S  G+++ LPS +G  ++KE+S
Sbjct: 122 VRFVKGETKNDLDFAKELASLADVFVNDAFGTAHRAHSSTAGIANYLPSAMGFLIEKEIS 181

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ++       ++P VAI+GG+KVS KI+++ N++ KVD L+IGG MA +F  A  + VG S
Sbjct: 182 IMGKALEAPERPFVAILGGAKVSDKISVIENMMDKVDTLIIGGAMAYTFKKALNVPVGSS 241

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
             + D  +    +  +AK+   ++++P D +VA+E      +     + +P   + LD+G
Sbjct: 242 RVEDDKVELAKDLLEKAKQKGIKLLLPIDHMVAKEFNETSESFATDTEEIPEGFMGLDIG 301

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT++  +  I QA+TV+WNGP+GVFE+  F   T  +A  +A        +SI GGGD+
Sbjct: 302 PKTIKLFEDEIKQAKTVIWNGPMGVFEMPKFAVGTKSLAEIIA----NTDAVSIIGGGDS 357

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             A+   G +++ T++ST GGA LE+LEGK LPGI  L   
Sbjct: 358 AAAVEQLGFADKMTHISTGGGASLEFLEGKILPGIDVLESK 398


>gi|227499731|ref|ZP_03929831.1| phosphoglycerate kinase [Anaerococcus tetradius ATCC 35098]
 gi|227218198|gb|EEI83461.1| phosphoglycerate kinase [Anaerococcus tetradius ATCC 35098]
          Length = 398

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 167/403 (41%), Positives = 253/403 (62%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVI 58
              +T+ DL D++G + L+RVD+NVP     + ++AD TRI   +PTI  L+E +AKV++
Sbjct: 1   MNKKTVKDL-DVKGKKVLVRVDFNVPLSKENNEEIADDTRIRAALPTIDYLLENEAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ ++  + SL  V    E+  +    F      +   + + +  L +G + L 
Sbjct: 60  MSHLGRPKGEAKPEFSLKPVAKWLENHYNGKFHFFPSDVVVDEKVKEEVNGLKDGELCLI 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE
Sbjct: 120 ENTRYVAGETKNDPEFAKQLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           +S++       + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 ISVMGKALEAPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +A+ +  EI++P DVV+A E+K G  T++V   S+P D   LD
Sbjct: 240 KSLLEEDKMDLSLELIKKAEANNVEILLPIDVVIADEIKAGAETEIVDIDSIPEDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT E     I  A+TV+WNGP+GVFEI+ F   T +VA  +A    E   ++I GGG
Sbjct: 300 IGPKTAELFASKIKDAKTVVWNGPMGVFEIKEFANGTNKVAEALA----ESNAVTIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG+ ++ T+VST GGA LE+LEGKDLPGI ++   
Sbjct: 356 DSALAIELAGLKDKITHVSTGGGASLEFLEGKDLPGITSIEDK 398


>gi|313896145|ref|ZP_07829699.1| phosphoglycerate kinase [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312975570|gb|EFR41031.1| phosphoglycerate kinase [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 397

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 150/399 (37%), Positives = 243/399 (60%), Gaps = 3/399 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ D++G +  +RVD+NVP  + + + + TRI   +PTI  L++  A V++  
Sbjct: 1   MNKKTIRDI-DVKGKKVFVRVDFNVPMDENQNITNDTRIRATLPTINYLLDGGAAVILAC 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H+GRP    +   S   +V+    +L K + +  DC+G    ++  +L  G ++L EN+R
Sbjct: 60  HVGRPTEAREPKFSTKPIVARLSELLGKEVQWAPDCVGPEAEKAAGALKPGEVLLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           ++ EE++NDP F + L+   D  ++DAF V+HRAHAS  G++  L +  G  M+KE++ +
Sbjct: 120 YHKEEKKNDPAFAKQLAALADVAVDDAFGVAHRAHASNVGITADLETVAGFLMEKEINYI 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P VAI+GG+KVS KI ++ N++ KVD ++IGGGMA++F  ++G  +G SL 
Sbjct: 180 GKTLEAPQRPFVAILGGAKVSDKIGVIENMIDKVDTIIIGGGMAHTFDASKGYPIGDSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D  +   ++  +A +   ++++P D+V+A +      TQ V    VP     LD G K
Sbjct: 240 EKDKIELAKKLLEKAAKKGVKVVLPVDLVIADKFAADAKTQTVDVDKVPDGWQALDSGAK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   + +  A+TV+WNGP+GVFE + F + T  VA  VA+ TKE    SI GGGD+I 
Sbjct: 300 TSEEYVKALKGAKTVIWNGPMGVFEFDAFAKGTEAVARAVAQATKE-GATSIVGGGDSIA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           AL   G+S++ +++ST GGA LE LEGK LPGI A++  
Sbjct: 359 ALKKTGLSDQISHISTGGGATLELLEGKVLPGIDAIANK 397


>gi|254526173|ref|ZP_05138225.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9202]
 gi|221537597|gb|EEE40050.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9202]
          Length = 402

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/401 (39%), Positives = 248/401 (61%), Gaps = 5/401 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV+
Sbjct: 1   MSKL-SLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ K ++   L  V +     L +N+   N CI         SLS G ++L E
Sbjct: 60  LAAHFGRPKGKVNEKMRLTPVAARLSEFLGQNVALTNSCIDDEAIAQSNSLSNGDVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G+++   PS  G  ++KE
Sbjct: 120 NVRFFGEEEKNDLEFAKKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDSPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DVV+A E      +++    S+  + + LD
Sbjct: 240 KSLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISQIDSISGNWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPDSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSAFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|123965459|ref|YP_001010540.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9515]
 gi|166987798|sp|A2BUH2|PGK_PROM5 RecName: Full=Phosphoglycerate kinase
 gi|123199825|gb|ABM71433.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9515]
          Length = 402

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/403 (39%), Positives = 250/403 (62%), Gaps = 5/403 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV+
Sbjct: 1   MSKL-SLSSLDKSKLEGKKVLVRVDFNVPLNDDGQITDDTRIRAAIPTIKYLINNSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ K ++   L  + +    IL K +     CIG    +   +L+ G ++L E
Sbjct: 60  LAAHFGRPKGKVNERMRLTPIAARLSEILGKKVNLTESCIGEEALEKSNNLNNGDVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G++    PS  G  ++KE
Sbjct: 120 NVRFYEEEEKNDLNFAKNLAAHADMYVNDAFGAAHRAHASTQGVTKFLEPSVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+       +PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDAPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIIIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DVV+A E      ++V    S+  D + LD
Sbjct: 240 KSLVEEDKLELARNLEEKAKTKGVELLLPSDVVLANEFSPTAESKVSQIDSISGDWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPQSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNSIATTLADLSSFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D++ A+  AG++ + +++ST GGA LE LEGK+LPG+ AL+ +
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKNLPGVAALNEN 402


>gi|331268757|ref|YP_004395249.1| phosphoglycerate kinase [Clostridium botulinum BKT015925]
 gi|329125307|gb|AEB75252.1| Phosphoglycerate kinase [Clostridium botulinum BKT015925]
          Length = 404

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/400 (37%), Positives = 238/400 (59%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D++ ++G R L+R D+NVP  +G + D  R+   +PTI  LV + AKV++ SHL
Sbjct: 10  NKKTVEDIQ-VKGKRVLVRCDFNVPLKEGVITDENRLVGALPTIQYLVNQGAKVILCSHL 68

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+P+ ++  + SL  V      +L+K ++F  D   +G     ++A++ +G I+L +N R
Sbjct: 69  GKPKGEAKPELSLAPVAKRLSELLNKEVVFAADDNVVGENAKNAVANMKDGDIVLLQNTR 128

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKELSM 179
           +  EE +N+ +F + L+   D ++NDAF  +HRAH S  G++  +     G  +QKEL  
Sbjct: 129 YRKEETKNEENFSKELASLADVFVNDAFGTAHRAHCSTVGVTEFVNEAACGYLIQKELQF 188

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        +P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  +G+SL
Sbjct: 189 LGDAVESPVRPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTIGKSL 248

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +AK    ++++P D VV  E             ++P   + LD+G 
Sbjct: 249 VEEDKVEYAKEMMDKAKAKGVKLLLPIDNVVGEEFSADTTPVTTEDANIPEGYMGLDIGP 308

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +     + +++TV+WNGP+GVFE   F + T+ VA  +A+        +I GGGD+ 
Sbjct: 309 KTSKLYADAVKESKTVVWNGPMGVFEFANFAKGTIAVAEAMAEA----DATTIIGGGDSA 364

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGIVALS  
Sbjct: 365 AAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIVALSDK 404


>gi|163848367|ref|YP_001636411.1| phosphoglycerate kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222526289|ref|YP_002570760.1| phosphoglycerate kinase [Chloroflexus sp. Y-400-fl]
 gi|189036810|sp|A9WKE4|PGK_CHLAA RecName: Full=Phosphoglycerate kinase
 gi|254782197|sp|B9LM50|PGK_CHLSY RecName: Full=Phosphoglycerate kinase
 gi|163669656|gb|ABY36022.1| Phosphoglycerate kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222450168|gb|ACM54434.1| Phosphoglycerate kinase [Chloroflexus sp. Y-400-fl]
          Length = 400

 Score =  374 bits (961), Expect = e-102,   Method: Composition-based stats.
 Identities = 163/398 (40%), Positives = 236/398 (59%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ D  G R L+RVD+NVP  D G++ D TRI   +PTI  L+E  A VV+ S
Sbjct: 1   MNKKTIRDV-DWAGKRALVRVDFNVPLDDQGQITDDTRIRAALPTIRYLLEHGASVVLMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILH--KNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           HLGRP+ K +   SL  VV     +L   K +       G     ++A L  G +++ EN
Sbjct: 60  HLGRPKGKPNPKYSLRPVVERLFELLPEAKEVKKTEAITGPAAEAAVAMLKPGQVLVLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF   EE NDP     L++ GD ++NDAF  +HRA+AS  G++H LP+  G  M+KEL+
Sbjct: 120 TRFDPREEPNDPAMAAELAKLGDVFVNDAFGTAHRANASTEGVAHYLPAVAGFLMEKELT 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            +    +  ++P V ++GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+A+G+ VG S
Sbjct: 180 YIGGALNNPQRPFVTVIGGAKISDKIGVIENLLGKVDALLIGGGMANTFLLAKGLNVGDS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D      Q+   A+     +++P DVV+A         QVV    +P    +LD+G
Sbjct: 240 LVEPDSVPVAQQLMARAEERGARLLLPVDVVIADAFSADAQRQVVDVSDIPAGWRVLDIG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT+E     I  ARTV+WNGP+GVFE+EPF   T  +A            I+I GGGD+
Sbjct: 300 PKTIERYSAEIRAARTVIWNGPMGVFELEPFAVGTRAIAQA-MAEAAANGAITIVGGGDS 358

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           + A+  AG++++ ++VST GGA LE LEG+ LPG+ AL
Sbjct: 359 VAAVEQAGLADKMSHVSTGGGASLELLEGRVLPGVAAL 396


>gi|307151342|ref|YP_003886726.1| phosphoglycerate kinase [Cyanothece sp. PCC 7822]
 gi|306981570|gb|ADN13451.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7822]
          Length = 401

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 256/400 (64%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M + +T+ +L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MPK-KTVANLSSADVAGKRVLVRVDFNVPLDDQGNITDDTRIRAALPTIQDLMGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L         +L ++++   DC+G  ++Q++ +L +G + L E
Sbjct: 60  LCSHFGRPKGKVVESMRLTPTAKRLSELLGQDVVMCGDCVGDAVTQALNTLKDGQVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N+RF++EEE ND +F + L+ N D Y+NDAF  +HRAHAS  G++H   PS  G  ++KE
Sbjct: 120 NLRFHAEEEDNDAEFSKQLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L+ L++     ++PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG
Sbjct: 180 LNYLQAAIENPQRPLAAIIGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D    +  +AK    ++++P DVVVA   K     Q VS +++P   + LD
Sbjct: 240 KSLVEEDKLDLAKSLEAKAKEKGVQLLLPTDVVVADAFKADANAQTVSIENIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A  ++V+WNGP+GVFE + F + T  +AH +A LT  + + +I GGG
Sbjct: 300 IGPDSIKVFQDALADCKSVIWNGPMGVFEFDQFAKGTEAIAHTLADLTG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPGI AL
Sbjct: 359 DSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|167629685|ref|YP_001680184.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
 gi|167592425|gb|ABZ84173.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
          Length = 394

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 248/399 (62%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M ++ ++ D+ D+RG R L+R D NVP   G + D TRI   +PT+  L+++ A+V++ S
Sbjct: 1   MEKI-SLRDI-DVRGKRVLVREDLNVPLKKGVITDDTRIRMTLPTLQYLIDRGARVIVAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   +  L  V      +L K +  V+D IG  +  ++A++ EG ++L ENVR
Sbjct: 59  HLGRPKGQPVDEFRLTPVAKRLAELLGKPVAKVDDVIGPEVQAAVAAMQEGDVLLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY EEE+ND  + + L+   D Y+NDAF  SHRAHAS  G++  LP+  G  M+KELSML
Sbjct: 119 FYKEEEKNDKAYAKALADLADIYVNDAFGTSHRAHASTAGVADFLPAVAGFLMEKELSML 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  ++P VA++GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL A G   G SL 
Sbjct: 179 GKAVTNPERPFVAVIGGAKVSDKIGVIENLLNKVDSLIIGGGMANTFLRALGYETGNSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D   ++   AK     +++P DVVVA+  + G P + V+  ++    + LD+G +
Sbjct: 239 ETDKVDLAGELILRAKAQKVNLLLPTDVVVAQAFEAGAPQKTVAVNAIEPGWMALDIGPE 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T +    V+ +A TV+WNGP+GVFEI+ F + T  VA  +A+       I++ GGGD++ 
Sbjct: 299 TAKGYADVVKEAATVLWNGPMGVFEIDDFAKGTEAVARAMAECRG----ITVIGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++   +++ST GGA LE+LEGK LPG+  L   
Sbjct: 355 AVNKVGVAERMSHISTGGGASLEFLEGKTLPGVAVLRDK 393


>gi|239787537|emb|CAX84006.1| Phosphoglycerate kinase [uncultured bacterium]
          Length = 421

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 190/398 (47%), Positives = 277/398 (69%), Gaps = 1/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS++RT++DL D++G R LLR D NVP  DG+V +  RI+R VPT++EL +K AKV+I S
Sbjct: 25  MSKIRTIDDL-DVKGKRVLLRADLNVPMKDGQVTNANRIDRTVPTVIELADKGAKVIILS 83

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + + + +L  V         + + F  DCIG    + + ++  G I + ENVR
Sbjct: 84  HLGRPKGEKNPEFTLKPVAEAFAKACGRPVAFGTDCIGPDAEKVVNAMKNGDIAMLENVR 143

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY +EE+ND DF + L+  GD  ++DAFS +HRAHAS+  ++ ++P+  GR MQ EL  L
Sbjct: 144 FYKQEEKNDADFAKKLAALGDILVSDAFSCAHRAHASVEAVARIIPAAAGRLMQAELEAL 203

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    + KKP+ A+VGG+K+STK+ +L NL++KVD L++GG MAN+FL+AQG+ VG+SL 
Sbjct: 204 EGALEKPKKPVAAVVGGAKISTKMDVLGNLIQKVDVLIVGGAMANTFLMAQGVKVGKSLV 263

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  DN   +  +AK++ C+I++P+D VVA E K G     V+  ++P D +ILDVG K
Sbjct: 264 EADMLDNARAVMEKAKKAGCDIVLPKDAVVASEFKEGAKATTVALDAIPADQMILDVGPK 323

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE + + +   +T++WNGPLG FE++PFD  T  VA + A LTK+  ++S+AGGGDT++
Sbjct: 324 SVEDLNKRLDGCKTLLWNGPLGAFEVKPFDTGTNAVAKHAADLTKKGSLLSVAGGGDTVS 383

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AL +AG   +F+YVSTAGGAFLEW+EGK LPG+  L G
Sbjct: 384 ALKNAGAQKQFSYVSTAGGAFLEWMEGKILPGVAVLRG 421


>gi|33860755|ref|NP_892316.1| phosphoglycerate kinase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|46576735|sp|Q7V390|PGK_PROMP RecName: Full=Phosphoglycerate kinase
 gi|33633697|emb|CAE18654.1| Phosphoglycerate kinase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 402

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 158/401 (39%), Positives = 247/401 (61%), Gaps = 5/401 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D   + G + L+RVD+NVP  D G++ D TRI   +PTI  L+   AKV+
Sbjct: 1   MSKL-SLSSLDKSKLEGKKVLVRVDFNVPLNDSGQITDDTRIRAAIPTIKYLINNSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ K ++   L  V +    IL + +     CIG        SL+ G ++L E
Sbjct: 60  LAAHFGRPKGKVNEKMRLTPVAARLSDILEQKVNLTESCIGEEALAKSNSLNNGEVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+ND DF + L+ + D Y+NDAF  +HRAHAS  G++  L   + G  ++KE
Sbjct: 120 NVRFYEEEEKNDLDFAKNLASHADMYVNDAFGAAHRAHASTQGVTKFLEPAVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDAPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIIIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DV++A E      ++V    ++  D + LD
Sbjct: 240 KSLVEEDKLELARNLEAKAKNKGVELLLPSDVLLANEFSPDAESKVSQIDAISGDWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPQSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSSFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL 
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALK 400


>gi|78778583|ref|YP_396695.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9312]
 gi|123554732|sp|Q31CY6|PGK_PROM9 RecName: Full=Phosphoglycerate kinase
 gi|78712082|gb|ABB49259.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9312]
          Length = 402

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 158/401 (39%), Positives = 251/401 (62%), Gaps = 5/401 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D  ++ G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV+
Sbjct: 1   MSKL-SLSSLDKTNLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L +N+   N CIG        SLS G ++L E
Sbjct: 60  LAAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAVAQSNSLSNGDVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G+++   PS  G  ++KE
Sbjct: 120 NVRFFGEEEKNDLEFAKKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDSPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DVV+A E      +++    S+  + + LD
Sbjct: 240 KSLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISQIDSISGNWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPDSIKVFQNALAECKTIIWNGPMGVFEFDKFADGTNAIATTLADLSAFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|289422958|ref|ZP_06424780.1| phosphoglycerate kinase [Peptostreptococcus anaerobius 653-L]
 gi|289156638|gb|EFD05281.1| phosphoglycerate kinase [Peptostreptococcus anaerobius 653-L]
          Length = 399

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/402 (36%), Positives = 239/402 (59%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +++ D++ ++G +CL+R D+NVP  DGK+ D  R+   +PTI  LV+  AKV++ S
Sbjct: 3   MLNKKSIEDIQ-VKGRKCLVRCDFNVPLKDGKITDENRLVGALPTIKYLVDNGAKVILCS 61

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L K ++F  D   +G+    ++A++ +  I+L +N
Sbjct: 62  HLGKPKGEAKPELSLAPVAKRLSEMLGKIVVFAADDNVVGNNAKAAVAAMEDSDIVLLQN 121

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+ +EE +N+ +F R L+   D ++NDAF  +HRAH S  G+         G  +QKEL
Sbjct: 122 TRYRAEETKNEENFSRELASLADVFVNDAFGTAHRAHCSTVGVGEFLEERVCGYLIQKEL 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L S     ++P +AI+GG+KVS+K+ ++ NL++KVD L+IGGGM+ +F  A G  +G 
Sbjct: 182 DFLGSAVENPERPFLAILGGAKVSSKLGVINNLLEKVDTLIIGGGMSYTFFKAMGHEIGT 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +A+    ++++P DVV A +       Q    + +P DS+ LD+
Sbjct: 242 SLVEDDKIEYALDMIKKAEEKGVKLLLPVDVVYADKFAEDAKPQFTEGRDIPADSMGLDI 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E     +  A+T++WNGP+GVFE E F   T  +A  +A++       +I GGGD
Sbjct: 302 GLKTRELFVDAVKSAKTIVWNGPMGVFEFENFANGTKAIAEAMAEI----DATTIIGGGD 357

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ +++ST GGA LE+LEGK+LPGI AL   
Sbjct: 358 SAAAVNQMGFGDKMSHISTGGGASLEFLEGKELPGIAALDNK 399


>gi|210615807|ref|ZP_03290788.1| hypothetical protein CLONEX_03006 [Clostridium nexile DSM 1787]
 gi|210150143|gb|EEA81152.1| hypothetical protein CLONEX_03006 [Clostridium nexile DSM 1787]
          Length = 397

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/402 (36%), Positives = 243/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G R L+R D+NVP IDGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKRVLVRCDFNVPLIDGKITDENRLVAALPTIKKLIADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++A++++G +IL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADATVVGENAKAAVAAMNDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEEFSKELASLCDVFVNDAFGTAHRAHCSNVGVTKYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  VG 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLDKVDTLIIGGGMSYTFSKAMGGKVGI 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ D    +  +A+    ++++P D VVA +       QVVS   +P     LD+
Sbjct: 240 SLLEEDYCDFALNMLKKAEEKGVKLLLPVDHVVADDFSNDANIQVVSRGEIPDGWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +   + +  A+TV+WNGP+G FE+  F + T  VA  +A    E   ++I GGGD
Sbjct: 300 GPETAKLYAEAVKTAKTVVWNGPMGCFEMPNFAKGTEAVAKALA----ETDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|126649362|ref|ZP_01721603.1| phosphoglycerate kinase [Bacillus sp. B14905]
 gi|126593687|gb|EAZ87610.1| phosphoglycerate kinase [Bacillus sp. B14905]
          Length = 394

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/399 (39%), Positives = 245/399 (61%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +TM D+ D++G R  +RVD+NVP  DG + D TRI   +PTI  LVE+ AKV++ S
Sbjct: 1   MLNKKTMKDI-DVKGKRVFVRVDFNVPMADGAITDETRIRAAIPTIEYLVEQGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +  +D  L  V      ++ K +  +++ IG  + +++AS+ +G I+L ENVR
Sbjct: 60  HLGRPKGEVKEDMRLTAVGIRLAELMSKPVTKLDESIGQAVEEAVASMQDGDILLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP   +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  MQ EL +L
Sbjct: 120 FHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGIAKHIPAVSGFLMQTELDVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  + P  AI+GG+KV  KI ++ +L++KVD L+IGGG++ +F+ AQG  +G+SL 
Sbjct: 180 GKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGLSFTFIKAQGYDIGKSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +       +AK    ++ +P D VVA E      T+VV   ++P D + LD+G K
Sbjct: 240 EEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQDAETKVVDVDAIPADWMGLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T  +  +VI  ++ ++WNGP+GVFE++ F   T  VA  +A         ++ GGGD+  
Sbjct: 300 TAAHYAEVIKNSKLIIWNGPMGVFEMDKFANGTKTVADAMAT----TSGYTVIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+    ++ +  ++ST GGA LE +EGK+LPGIVAL+  
Sbjct: 356 AVEKFEVATKMDHISTGGGASLELMEGKELPGIVALNDK 394


>gi|291550049|emb|CBL26311.1| 3-phosphoglycerate kinase [Ruminococcus torques L2-14]
          Length = 399

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 146/404 (36%), Positives = 236/404 (58%), Gaps = 10/404 (2%)

Query: 1   MS--RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+    ++++D+ +++G + L+R D+NVP  DGK+ D  RI   +PTI +L++   KV++
Sbjct: 1   MAALNKKSVDDI-NVKGKKVLVRCDFNVPLQDGKITDENRIVAALPTIKKLIDDGGKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLG+P+ +   + SL  V      +L + + F  D   +G     ++ ++ +G +IL 
Sbjct: 60  CSHLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADPEVVGPNAKAAVEAMKDGDVILL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQK 175
           EN R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQK
Sbjct: 120 ENTRYRAEETKNGEAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQK 179

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  L +     ++P VAI+GGSKVS+KI+++ NL+ KVD L+IGGGM  +F  AQG  V
Sbjct: 180 EIDFLGNAVENPERPFVAILGGSKVSSKISVINNLLDKVDTLIIGGGMCYTFTKAQGGNV 239

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G SL + D+      +  +A+    ++++P D V A        T+VV+   +P   + L
Sbjct: 240 GNSLLEEDYLQYALDMVKKAEEKGVKLLLPVDAVAADAFSNDANTKVVAQNEIPDGWMGL 299

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G KT E     +  A+TV+WNGP+G FE+  F   T  VA  +A        ++I GG
Sbjct: 300 DIGPKTAEMFADAVKSAKTVVWNGPMGCFEMPKFAEGTKAVAEALA----NTDAVTIIGG 355

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GD+  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 GDSAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 399


>gi|221195801|ref|ZP_03568854.1| phosphoglycerate kinase [Atopobium rimae ATCC 49626]
 gi|221184275|gb|EEE16669.1| phosphoglycerate kinase [Atopobium rimae ATCC 49626]
          Length = 396

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/393 (39%), Positives = 241/393 (61%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D  D+ G R L+RVD+NVP  DG V D TR+   +PTI  L++  AKV++ SHLGR
Sbjct: 6   KTVRD-ADVDGKRVLMRVDFNVPLKDGVVTDDTRVRAALPTIQYLLDHNAKVILMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P       + SL         +L K + FV D  G    +++ SL  G +++ ENVRF  
Sbjct: 65  PDGTGFQPELSLRPAAEKLSELLGKPVKFVEDTYGEKAKEAVDSLESGQVLVLENVRFDK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  ++L+  GD ++ DAF  +HRA  S+ G +  LP+Y G  ++KE+  L S 
Sbjct: 125 REKKNDPEIAKILASYGDIFVLDAFGTAHRAQGSVVGPAAYLPAYAGFLLEKEVDTLTSI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           F++  +P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G  VG SL + D
Sbjct: 185 FADPARPFVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAKGYTVGTSLQEPD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+   C+I++P D VVA         + V++ ++P D + +D+G KTV+
Sbjct: 245 WVEPAKKMLEKAEAKGCKILLPVDNVVADHFGEDAKGEAVNSDNIPDDRMGMDIGPKTVQ 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
                I  A+TV WNGP+GVFE + F + T  VA  +A    +    SI GGGD++ A+ 
Sbjct: 305 LYTDAIKGAKTVFWNGPMGVFEFDQFAKGTEAVARAIA----DSDCTSIIGGGDSVAAIN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G++++ +++ST GGA +E +EGK LPG+ AL
Sbjct: 361 KFGLADKMSWISTGGGASMELVEGKALPGVEAL 393


>gi|154503931|ref|ZP_02040991.1| hypothetical protein RUMGNA_01757 [Ruminococcus gnavus ATCC 29149]
 gi|153795530|gb|EDN77950.1| hypothetical protein RUMGNA_01757 [Ruminococcus gnavus ATCC 29149]
          Length = 397

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/402 (36%), Positives = 240/402 (59%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G R L+R D+NVP IDGK+ D  R+   +PTI +LV    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKRVLVRCDFNVPLIDGKITDENRLVAALPTIKKLVADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++A++++G I+L EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADAEVVGENAKAAVAAMNDGDIVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKELASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +     ++P VAI+GGSKVS+KI+++ NL++KVD L+IGGGM  +F  AQG  VG+
Sbjct: 180 DFLGNAVENPERPFVAILGGSKVSSKISVINNLLEKVDTLIIGGGMCFTFTKAQGGNVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+      +  +AK    ++++P D V A E       +VV    +P   + LD+
Sbjct: 240 SLLEEDYLQYALDMIEKAKEKGVKLLLPVDAVAADEFSNDANIKVVPQNEIPEGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +   + +  A+TV+WNGP+G FE+  F   T  VA  ++    E   ++I GGGD
Sbjct: 300 GPETAKLYAEAVKSAKTVVWNGPMGCFEMPNFANGTETVAKALS----ETDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|111074975|gb|ABH04835.1| phosphoglycerate kinase [Heliobacillus mobilis]
          Length = 394

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/396 (41%), Positives = 262/396 (66%), Gaps = 6/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ D++  R L+RVD+NVP  D G + D TRI   +PTI  L++  AKV++ S
Sbjct: 1   MNKKTIKDI-DVKAKRVLVRVDFNVPVNDAGVITDDTRIRAALPTIQYLIQAGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +    L  +      +L++++  ++DCIG  +  ++     G +IL ENVR
Sbjct: 60  HFGRPKGKVNDKYRLTPIAGHLSELLNRSVKKLDDCIGPDVEAAVKEAQPGDVILLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY EEE+NDP+F R L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M KE+S++
Sbjct: 120 FYPEEEKNDPEFSRKLASLADVYVNDAFGTAHRAHASTAGVAAYLPAVAGFLMDKEISIM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               ++ ++P VA++GG+KV+ KI ++ NL+ KVD L+IGGGMAN+F  A  + VG+SLC
Sbjct: 180 GKALAQPERPFVAVMGGAKVADKIAVIENLLNKVDTLIIGGGMANTFFYAMNLEVGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +D   ++  +A+++  ++++P DVV+A  +   +PT+VV   ++P D   LD+G +
Sbjct: 240 EKDKADTARELLQKAEKAGVKMMLPVDVVIADTLAANVPTEVVPVNAIPADKSALDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+   Q ++ ++ V+WNGP+G FE+EPFDR T+ VA  +  +    +  +I GGGD++ 
Sbjct: 300 SVKQFAQALSASKMVLWNGPMGAFEVEPFDRGTMGVAQAMVNV----QGTTIIGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+  AG++ + T+VST GGA LE+LEG++LPG+ AL
Sbjct: 356 AVEKAGLAEKMTHVSTGGGASLEFLEGRELPGVAAL 391


>gi|227485035|ref|ZP_03915351.1| phosphoglycerate kinase [Anaerococcus lactolyticus ATCC 51172]
 gi|227237032|gb|EEI87047.1| phosphoglycerate kinase [Anaerococcus lactolyticus ATCC 51172]
          Length = 398

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/403 (40%), Positives = 250/403 (62%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVI 58
              +T+ DL D+RG + L+RVD+NVP      GK+AD  RI+  +PTI  L E  AKV++
Sbjct: 1   MNKKTVKDL-DVRGKKVLVRVDFNVPLSKEEKGKIADDARIKAALPTINYLSENGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNI--LFVNDCIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ +++ D SL  V    ++        +  ++ +   + + +  L++G I L 
Sbjct: 60  MSHLGRPKGEANPDFSLKPVADYLKNEYKDKFAFIPSDEVVDEKVKEEVNKLADGQIALL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+  EE +N  DF + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE
Sbjct: 120 ENTRYRKEETKNGEDFAKELASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           + ++         P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL A G  +G
Sbjct: 180 IEVMGKALEAPDHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAMGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +AK +  EI++P DVV+A +++ G+ T++V    +P+D   LD
Sbjct: 240 KSLLEEDKMDLSLELIEKAKANGVEILLPVDVVIADKIEAGVDTEIVDIDDIPVDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +   + I  A+TV+WNGP+GVFEI+ F   T EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKLFAEKIKAAKTVVWNGPMGVFEIKEFSNGTNEVAKALA----DSDAVTIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG+ ++ T+VST GGA LE+LEGK LPGI A+   
Sbjct: 356 DSALAIEMAGLKDKITHVSTGGGASLEFLEGKALPGITAIEDK 398


>gi|299536227|ref|ZP_07049540.1| phosphoglycerate kinase [Lysinibacillus fusiformis ZC1]
 gi|298728213|gb|EFI68775.1| phosphoglycerate kinase [Lysinibacillus fusiformis ZC1]
          Length = 412

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/399 (39%), Positives = 246/399 (61%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +TM D+ D++G R  +RVD+NVP  DG + D TRI   +PTI  LVE+ AKV++ S
Sbjct: 19  MLNKKTMKDI-DVKGQRVFIRVDFNVPMADGAITDETRIRAAIPTIEYLVEQGAKVILAS 77

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +  +D  L  V      ++ K +  +++ IG  + +++A++ +G I+L ENVR
Sbjct: 78  HLGRPKGEVKEDMRLTAVGIRLAELMGKPVTKLDESIGQAVEEAVANMQDGDILLLENVR 137

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+NDP   +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  MQKEL +L
Sbjct: 138 FHAGEEKNDPTLAQQFAQLADIYVNDAFGAAHRAHASTEGIAKHIPAVSGFLMQKELDVL 197

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  + P  AI+GG+KV  KI ++ +L++KVD L+IGGG++ +F+ AQG  +G+SL 
Sbjct: 198 GKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGLSFTFIKAQGHDIGKSLL 257

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +       +AK    ++ +P D VVA E      TQ+V   ++P D + LD+G K
Sbjct: 258 EEDKIELAKSFIEKAKAKGVQLHMPVDAVVANEFSQDAETQIVDVDAIPADWMGLDIGPK 317

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T     +VI  ++ ++WNGP+GVFE++ F   T  VA  +A         ++ GGGD+  
Sbjct: 318 TAANYAEVIKNSKLIIWNGPMGVFEMDKFSNGTKTVADAMAT----TAGYTVIGGGDSAA 373

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+    ++++  ++ST GGA LE +EGK+LPGIVAL+  
Sbjct: 374 AVEKFEVADKMDHISTGGGASLELMEGKELPGIVALNDK 412


>gi|289450877|ref|YP_003474933.1| triose-phosphate isomerase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289185424|gb|ADC91849.1| triose-phosphate isomerase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 651

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 161/402 (40%), Positives = 248/402 (61%), Gaps = 9/402 (2%)

Query: 1   MSRL--RTMNDLRDIRGLRCLLRVDWNVPFID--GKVADVTRIERVVPTILELVEKKAKV 56
           M++L  +++ D+ ++ G R + RVD+NVP     G + D  RI   +PTI  L++  AK+
Sbjct: 1   MAKLLKKSIEDI-EVTGKRVIARVDFNVPQDKATGAITDDKRIRAALPTIQYLIDHGAKL 59

Query: 57  VIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILA 116
           ++ SHLGRP++  +   S+  V +    +L K +    D IG      IA++ +G +++ 
Sbjct: 60  ILVSHLGRPKNGPEDKFSMRPVAARLSELLGKEVTLAKDVIGDDAKAKIAAMHDGDVVML 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           ENVRF+ EE +N+P F R L+   + ++NDAF  +HRAHAS  GL++ LPS  G  +QKE
Sbjct: 120 ENVRFHKEETKNNPAFARELASLAEIFVNDAFGTAHRAHASTAGLANYLPSVCGFLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L ++    +  K+PLVAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  A+G  VG
Sbjct: 180 LKIMGDAINNPKRPLVAILGGAKVSDKIGVIENLIAKVDTLIIGGGMAYTFFAAKGYEVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +A+    ++++P D VV +E K      VV++ ++P D + +D
Sbjct: 240 KSLLEADKIELAKGLLAKAEDKGVKLLLPVDTVVVKEFKADAAATVVASDAIPADQMGMD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  K  IA A TV+WNGP+GVFE + F   T  +A  V+    E   ISI GGG
Sbjct: 300 IGPESVKLFKAAIADAGTVIWNGPMGVFEFDAFAVGTRAIAQAVS----ESGAISIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           D+  A+   G +++ T++ST GGA LE+LEGK LPGI  L  
Sbjct: 356 DSAAAIEKLGFADKVTHISTGGGASLEFLEGKVLPGIDCLMN 397


>gi|331091039|ref|ZP_08339881.1| phosphoglycerate kinase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405261|gb|EGG84797.1| phosphoglycerate kinase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 397

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 239/402 (59%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G R L+R D+NVP IDGK+ D  R+   +PTI +LV    K+++ S
Sbjct: 1   MLNKKSVDDI-NVKGKRVLVRCDFNVPLIDGKITDENRLVAALPTIKKLVADGGKIILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++ ++++G IIL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADATVVGENAKAAVEAMNDGDIILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEEFSKELASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGMA +F  A+G  +G 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLDKVDTLIIGGGMAYTFSKARGGKIGL 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+ +    +  +A+    ++++P D  +  +       QVV +  +P     +D+
Sbjct: 240 SLCEDDYMEYALNMLKKAEEKGVKLLLPVDHRIGDDFSNDANVQVVESGEIPDGWEGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT       +  A+TV+WNGP+G FE+  F   T  VA  +A    E   ++I GGGD
Sbjct: 300 GPKTEVLFADAVKDAKTVVWNGPMGCFEMPKFANGTEAVAKALA----ETDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|260893463|ref|YP_003239560.1| phosphoglycerate kinase [Ammonifex degensii KC4]
 gi|260865604|gb|ACX52710.1| Phosphoglycerate kinase [Ammonifex degensii KC4]
          Length = 392

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 171/399 (42%), Positives = 254/399 (63%), Gaps = 7/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T+ D+ ++RG R L+RVD+NVP  DGKV D TR+   +PTI  L ++ AKV++ S
Sbjct: 1   MTK-KTVKDV-EVRGKRVLVRVDFNVPLKDGKVTDDTRLRAALPTIEYLCQQGAKVILVS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   D+   L  V    E +L + +  ++ C+G  + +++A+L+ G ++L EN+R
Sbjct: 59  HLGRPKGAPDESLRLDPVAQRLEELLGRPVRKLDSCVGPEVEEAVAALNPGDVLLLENIR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  E +NDP+  + L++  D Y+NDAF  +HRAHAS  G++ L P+  G  M KE+  L
Sbjct: 119 FHPGETKNDPELAQGLAKLCDIYVNDAFGTAHRAHASTVGVAKLRPAVAGFLMAKEIEAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +   +P VA++GG+K+S KI +L +L+ +VD L+IGGGMAN+FL AQG  +GRSL 
Sbjct: 179 SRLLTSPARPFVALIGGAKISDKIGVLRSLLTRVDSLLIGGGMANTFLAAQGYNLGRSLL 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    I  EA+     +++PRD+VVA   + G   +VV    VP   + LDVG  
Sbjct: 239 EPDQLEQARSIMEEARERGVNLVLPRDLVVAANKEAGAEHRVVPVNEVPEGWMALDVGPA 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVE   +++A ART+ WNGPLG FE  P+D  TV VA  +   T E    +I GGGDT+ 
Sbjct: 299 TVEEFCRILAGARTIFWNGPLGYFEQPPYDAGTVAVARAL-PATAE----TIVGGGDTVA 353

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+  AG+++  T++ST GGA LE+LEGK+LPGI  L   
Sbjct: 354 AVTRAGVADRITHISTGGGASLEFLEGKELPGIAVLEDK 392


>gi|168185508|ref|ZP_02620143.1| phosphoglycerate kinase [Clostridium botulinum C str. Eklund]
 gi|169296307|gb|EDS78440.1| phosphoglycerate kinase [Clostridium botulinum C str. Eklund]
          Length = 398

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/400 (37%), Positives = 236/400 (59%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D++ ++G + L+R D+NVP  DG + D  R+   +PTI  LV + AKV++ SHL
Sbjct: 4   NKKTVEDIQ-VKGKKVLVRCDFNVPLKDGAITDENRLVGALPTIKYLVNEGAKVILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+P+ ++  + SL  V      +L K ++F  D   +G    ++++ + +G I+L +N R
Sbjct: 63  GKPKGEAKPELSLAPVAKRLSELLEKEVVFAADDNVVGENAKKAVSEMKDGDIVLLQNTR 122

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKELSM 179
           +  EE +N+ +F + L+   D ++NDAF  +HRAH S  G++  L     G  +QKEL  
Sbjct: 123 YRKEETKNEENFSKELASLADVFVNDAFGTAHRAHCSTVGVTEFLNEVACGYLIQKELKF 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        +P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  +G+SL
Sbjct: 183 LGDAVETPVRPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +AK    ++++P D VV  E             ++P   + LD+G 
Sbjct: 243 VEEDKVEYAKEMMDKAKAKGVKLLLPIDNVVGEEFDANTTPVTTEDANIPEGYMGLDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +     +  A+TV+WNGP+GVFE   F + T+ VA  +A+        +I GGGD+ 
Sbjct: 303 KTSKAYADAVRTAKTVVWNGPMGVFEFANFAKGTIAVAEAMAEA----DATTIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGIVALS  
Sbjct: 359 AAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIVALSDK 398


>gi|284048292|ref|YP_003398631.1| triosephosphate isomerase [Acidaminococcus fermentans DSM 20731]
 gi|283952513|gb|ADB47316.1| triosephosphate isomerase [Acidaminococcus fermentans DSM 20731]
          Length = 641

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 152/396 (38%), Positives = 245/396 (61%), Gaps = 6/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D++ + G R L+RVD+NVP  D G++ D  RIE  +PT+  L+++ A V++ +
Sbjct: 1   MDKKTVKDIQ-LTGKRVLVRVDYNVPMNDKGEITDFIRIEASLPTLHYLLDQGAAVILMA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K +   +L  V      ++H+ + F  DC+G     + A L  G I+L EN+R
Sbjct: 60  HLGRPKGKVNPKFTLKPVAEALSQLIHRPVQFCPDCVGKDAQDAAAQLRNGDILLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP F + L+  GD Y+ND F VSHRAHAS+  ++H LP+  G  ++KE++ L
Sbjct: 120 FHPEEEKNDPHFAQELAALGDVYVNDGFGVSHRAHASVEAVTHYLPAVAGFLLEKEIAYL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +   + ++P  AI+GG+KV+ KI ++ +L+KK D ++IGGGMAN+FL A+G  +G+SL 
Sbjct: 180 GNAVDKPQRPFAAIIGGAKVADKIAVIRSLIKKADVILIGGGMANTFLAAKGYNLGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +++       +  EA     ++++P D+++A         +     ++  D + LD+G K
Sbjct: 240 EKESLGIAKDLLAEAAAQKTKMLLPVDLIMAASFSNEADHEAEDLDALNPDYMALDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   Q +A  +T++WNGP+GVFE+  +   T  VA  +A        I+I GGGD+  
Sbjct: 300 TAELYAQTLAGMKTIVWNGPMGVFEMPNYAEGTRRVAEAMA----ASDGITIVGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++++ ++VST GGA LE+LEGK LPG+ AL
Sbjct: 356 AVKQMGLADKMSHVSTGGGASLEYLEGKVLPGLAAL 391


>gi|187777185|ref|ZP_02993658.1| hypothetical protein CLOSPO_00731 [Clostridium sporogenes ATCC
           15579]
 gi|187774113|gb|EDU37915.1| hypothetical protein CLOSPO_00731 [Clostridium sporogenes ATCC
           15579]
          Length = 400

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/403 (36%), Positives = 242/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+EK AK+++ 
Sbjct: 3   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLSEGKITDENRLVGALPTIKYLMEKGAKIILC 61

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +S+  + +G I+L +
Sbjct: 62  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKSVKDMKDGDIVLLQ 121

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 122 NTRYRKEETKNEEVFSKELASLADLFVNDAFGTAHRAHCSTVGVTNYLEEAACGYLIQKE 181

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL +QG  VG
Sbjct: 182 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDILIIGGGMGYTFLKSQGYTVG 241

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D+ +A          +   Q+V    + LD
Sbjct: 242 DSLLEEDKVEYAKEMINKAKEKGVNLLLPVDITIADRFDKDAKPIITEDQNVGEGYMGLD 301

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 302 IGPKTAKMYSDAIKSAKTVIWNGPMGVFEFKNFANGTIEVAKAMA----DSDAVTIIGGG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 358 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 400


>gi|119952859|ref|YP_945068.1| phosphoglycerate kinase [Borrelia turicatae 91E135]
 gi|254782190|sp|A1QYK6|PGK_BORT9 RecName: Full=Phosphoglycerate kinase
 gi|119861630|gb|AAX17398.1| phosphoglycerate kinase [Borrelia turicatae 91E135]
          Length = 392

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/397 (41%), Positives = 245/397 (61%), Gaps = 5/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D  D  G R L+R D+NVP  +G + D TRI   +PTI  L  + A+V++ SH
Sbjct: 1   MSIKTIKD-CDFAGKRALVRCDFNVPLKEGNITDDTRIRAALPTIEYLKSQGARVILMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + +   SL  V      +L +++  + DCIG  ++ +++ +  G I+L EN+RF
Sbjct: 60  LGRPKGEKNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATTVSCMKNGDIVLLENLRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y EEE N   FVR LS+NGD ++NDAF  +HRAHAS  GL+  LP+  G  M+KE   L 
Sbjct: 120 YKEEEENCDAFVRKLSQNGDIFVNDAFGTAHRAHASTAGLAAYLPAVGGFLMEKEDEFLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 + P VAI+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL +
Sbjct: 180 KILRNPESPFVAIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGYSIGQSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D VVA E +     + V +  +P D + +D+G KT
Sbjct: 240 NEYIDVASSFLKKAKELDVKVILPLDHVVASEFREDSIPEYVDSVDIPNDKVGMDIGEKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +  I++V+  A+TV+WNGPLGVFE   F + T +VA YVA  +     I++ GGGD++ A
Sbjct: 300 LRKIEEVLVSAKTVIWNGPLGVFEFNSFSKGTAKVAEYVASCSG----ITVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S + T+VST GGA LE+LEGK LPGI  L  
Sbjct: 356 VNKFNLSEKITHVSTGGGASLEYLEGKVLPGIKVLEK 392


>gi|226509797|ref|NP_001142404.1| hypothetical protein LOC100274579 [Zea mays]
 gi|194707626|gb|ACF87897.1| unknown [Zea mays]
 gi|194708658|gb|ACF88413.1| unknown [Zea mays]
 gi|195632546|gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
          Length = 402

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 169/400 (42%), Positives = 249/400 (62%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D++G +  +R D NVP  D  K+ D TRI   VPTI  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P D+VVA +      +++V A ++P D + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAESKIVPATAIPDDWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG    +   + +   +TV+WNGP+GVFE + F   T  +A  +A+LT  + + +I GGG
Sbjct: 300 VGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAIAKKLAELTTTKGVTTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|330836441|ref|YP_004411082.1| phosphoglycerate kinase [Spirochaeta coccoides DSM 17374]
 gi|329748344|gb|AEC01700.1| phosphoglycerate kinase [Spirochaeta coccoides DSM 17374]
          Length = 394

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 169/399 (42%), Positives = 247/399 (61%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELV-EKKAKVVIFS 60
            +L T+ D + + G R L+RVD+NVP  DG V D TRI   +PT+  ++ +K   +V+ +
Sbjct: 1   MKLNTIEDAK-LEGKRVLIRVDFNVPLKDGVVTDDTRIVAALPTVKHILGKKGTSLVVMT 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + + + SL  V    E +L   +   +D IGS + + +ASL  G ++L ENVR
Sbjct: 60  HLGRPKGQKNMEFSLAPVARRFEELLGSPVKLASDVIGSQVKEDVASLKPGEVLLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY EEE NDP F + L+  GD Y+NDAF  +HRAHAS  G++H LP+Y G  ++KE+  +
Sbjct: 120 FYKEEEANDPAFAKELASFGDIYVNDAFGTAHRAHASTEGVAHFLPAYAGYLIEKEVRFM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                    P VAI+GG+KVS+KIT+L +L+K VD +VIGGGMA +FL  QG  +G SL 
Sbjct: 180 APLLENPAHPFVAIIGGAKVSSKITVLESLLKTVDTIVIGGGMAYTFLKVQGREIGGSLF 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D+         +A+    ++I+P D V A E         V A  VP D + LD+G K
Sbjct: 240 EPDYIGTAESFLKKAEDKGVKVILPVDYVCASEFSETAVPVYVDAPDVPADMMSLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T + I   I+ A++V+WNGP+GVFE E F + T+ VA  +A        +++ GGGD++ 
Sbjct: 300 TTQLIIDAISTAKSVVWNGPMGVFEFEAFAKGTLAVAQALA----ASSAVTVVGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++++ ++VST GGA LE+LEGK+LPGIVAL   
Sbjct: 356 AINKFGLADKISHVSTGGGASLEFLEGKELPGIVALEAK 394


>gi|153955990|ref|YP_001396755.1| phosphoglycerate kinase [Clostridium kluyveri DSM 555]
 gi|219856331|ref|YP_002473453.1| hypothetical protein CKR_2988 [Clostridium kluyveri NBRC 12016]
 gi|189036813|sp|A5N2N8|PGK_CLOK5 RecName: Full=Phosphoglycerate kinase
 gi|254782199|sp|B9E6B4|PGK_CLOK1 RecName: Full=Phosphoglycerate kinase
 gi|146348848|gb|EDK35384.1| Hypothetical protein CKL_3381 [Clostridium kluyveri DSM 555]
 gi|219570055|dbj|BAH08039.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 398

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/400 (35%), Positives = 234/400 (58%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D+ D++G R L+R D+NVP  +GK+ D  R+   +PTI  L+E  AKV++ SHL
Sbjct: 4   NKKTIEDV-DVKGKRVLVRCDFNVPLQEGKITDENRLIGSLPTIKYLMENNAKVILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+P+ +   + SL  V      +L K ++F  D   +G     ++ ++ +G +IL +N R
Sbjct: 63  GKPKGEVKPEMSLLPVAKRLSELLKKEVVFAADDNVVGENAKAAVKNMKDGDVILLQNTR 122

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSM 179
           +  EE +N  +F + L+  G+ ++NDAF  +HRAH S  G++  LP+   G  +QKEL  
Sbjct: 123 YRIEETKNQDNFSKELASLGEIFVNDAFGTAHRAHCSTVGVTKFLPTAVCGYLIQKELEF 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +      +P  AI+GG KVS KI ++ NL++KVD L+IGGGM+ +F  AQG  +G S+
Sbjct: 183 LGNAIENPSRPFTAILGGVKVSDKINVINNLLEKVDTLIIGGGMSYTFARAQGYTIGTSV 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +AK    ++++P D VV  +        +   +++    + +D+G 
Sbjct: 243 VEEDKIEYAKEMIDKAKEKGIKLLLPIDRVVTDKFDESAEPILEDDKNIKDGYMGMDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +     I  ++T++WNGP+GVFE + F + T  VA  +A    E   I+I GGGD+ 
Sbjct: 303 KTAKVYADAIKDSKTIIWNGPMGVFEFKNFAKGTFAVAKAMA----ESGAITIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+L G++LPGI AL+  
Sbjct: 359 AAINQLGFGDKMTHISTGGGASLEFLGGEELPGISALNNK 398


>gi|257066259|ref|YP_003152515.1| Phosphoglycerate kinase [Anaerococcus prevotii DSM 20548]
 gi|256798139|gb|ACV28794.1| Phosphoglycerate kinase [Anaerococcus prevotii DSM 20548]
          Length = 398

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/403 (41%), Positives = 254/403 (63%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVI 58
              +T+ DL D++G + L+RVD+NVP     + ++AD TRI   +PTI  L+E  AKV++
Sbjct: 1   MNKKTVKDL-DVKGKKVLVRVDFNVPLSKENNEEIADDTRIRAALPTIDYLLENDAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVN--DCIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ ++  + +L  V    E+       F    + +   + + +A+L EG + L 
Sbjct: 60  MSHLGRPKGEAKPEFALKPVADWLENHYKDKFHFFPSPEVVDDKVKEEVANLKEGEVCLI 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE
Sbjct: 120 ENTRYVAGETKNDPEFAKKLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           + ++       + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 IEVMGKALEAPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +A+ +  EI++P DVV+A E+K G  T++V   S+P D   LD
Sbjct: 240 KSLLEEDKMDLSLELIKKAEANNVEILLPVDVVIADEIKAGAETEIVDIDSIPEDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT E     I +A+TV+WNGP+GVFEI+ F   T +VA  +A    E   I+I GGG
Sbjct: 300 IGPKTAELFASKIKEAKTVVWNGPMGVFEIKEFADGTNKVAAALA----ESDAITIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG+ ++ T+VST GGA LE+LEGKDLPGI ++   
Sbjct: 356 DSALAIELAGLKDKITHVSTGGGASLEFLEGKDLPGISSIEDK 398


>gi|168177560|ref|ZP_02612224.1| phosphoglycerate kinase [Clostridium botulinum NCTC 2916]
 gi|182671197|gb|EDT83171.1| phosphoglycerate kinase [Clostridium botulinum NCTC 2916]
          Length = 398

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/403 (37%), Positives = 243/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+EK AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      IL+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEILNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        V   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVVTEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKSFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|88809813|ref|ZP_01125319.1| phosphoglycerate kinase [Synechococcus sp. WH 7805]
 gi|88786197|gb|EAR17358.1| phosphoglycerate kinase [Synechococcus sp. WH 7805]
          Length = 402

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/401 (39%), Positives = 246/401 (61%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLSGTDLSGKRVLVRVDFNVPLDDAGAITDDTRIRAALPTINDLIGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +   + CIG      + +++ G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF++EEE+N+  F   L+   + Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 120 NVRFFAEEEKNEAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKYLKPAVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DVV+A        +QV    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQVADVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   V+  +  +A  +TV+WNGP+GVFE E F   T  +A  +A+L+ +    +I GGG
Sbjct: 300 IGPDAVKVFQAALADCQTVIWNGPMGVFEFEKFANGTNAIATTLAELSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALN 399


>gi|148378230|ref|YP_001252771.1| phosphoglycerate kinase [Clostridium botulinum A str. ATCC 3502]
 gi|153931900|ref|YP_001382631.1| phosphoglycerate kinase [Clostridium botulinum A str. ATCC 19397]
 gi|153937674|ref|YP_001386183.1| phosphoglycerate kinase [Clostridium botulinum A str. Hall]
 gi|166219318|sp|A7FQN7|PGK_CLOB1 RecName: Full=Phosphoglycerate kinase
 gi|166219319|sp|A5HYC0|PGK_CLOBH RecName: Full=Phosphoglycerate kinase
 gi|148287714|emb|CAL81779.1| phosphoglycerate kinase [Clostridium botulinum A str. ATCC 3502]
 gi|152927944|gb|ABS33444.1| phosphoglycerate kinase [Clostridium botulinum A str. ATCC 19397]
 gi|152933588|gb|ABS39087.1| phosphoglycerate kinase [Clostridium botulinum A str. Hall]
          Length = 398

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/403 (36%), Positives = 243/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+EK AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        +   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVITEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKSFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|258517030|ref|YP_003193252.1| Phosphoglycerate kinase [Desulfotomaculum acetoxidans DSM 771]
 gi|257780735|gb|ACV64629.1| Phosphoglycerate kinase [Desulfotomaculum acetoxidans DSM 771]
          Length = 394

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 171/400 (42%), Positives = 258/400 (64%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIF 59
           M + +++ D+ D+RG R  +RVD+NVP  +  +V D TRI   +PTI  L E+KAKV++ 
Sbjct: 1   MPK-KSVKDI-DVRGKRVFVRVDFNVPLDEKHEVTDDTRIRAALPTIRYLTEQKAKVILA 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+ K  ++  L  VV   E +L K ++  +DCIG  +  +I+ + EG I+L EN+
Sbjct: 59  SHLGRPKGKVAEEFRLDPVVRHLEELLGKKVIKTDDCIGEEVKAAISEMQEGDILLLENL 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RFY  EE++DP F R L+   D Y+NDAF  +HRAHAS  G++ LLP+  G  +QKE+ M
Sbjct: 119 RFYPGEEKDDPVFARELAALADVYVNDAFGTAHRAHASTHGIARLLPAVAGFLLQKEIKM 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L S  +  ++P  AI+GG+KVS KI ++ NL+ KVD L++GGGMAN+F+ AQG  VG+SL
Sbjct: 179 LGSAINNPQRPFTAILGGAKVSDKIGIIKNLLGKVDNLLLGGGMANTFIKAQGYDVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  EA+      ++P DVVVA  +     TQVV    +P D++ LD+G 
Sbjct: 239 LESDKVELAGELINEARVKGINFLLPVDVVVAPMLSPDAMTQVVEISHIPGDNMALDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++++   ++I  ++TV+WNGP+GVFE+  F   T ++   +A    +   ++I GGGD  
Sbjct: 299 ESIKKYSEIIKSSKTVIWNGPMGVFEMNAFANGTNDLVRVLA----DSGAVTIVGGGDLD 354

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G+S++ T+VST GGA LE+LEGK+LPGI  L  +
Sbjct: 355 AAVEKTGLSDKITHVSTGGGASLEFLEGKELPGIAVLQDN 394


>gi|167759058|ref|ZP_02431185.1| hypothetical protein CLOSCI_01405 [Clostridium scindens ATCC 35704]
 gi|167663465|gb|EDS07595.1| hypothetical protein CLOSCI_01405 [Clostridium scindens ATCC 35704]
          Length = 397

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 236/402 (58%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLVAALPTIKKLIADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V +    +L + + F  D   +G     ++  + +G +IL EN
Sbjct: 60  HLGKPKGEPVPELSLAPVAARLSELLGQEVKFAADREVVGPNAKAAVDVMKDGEVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+  EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRIEETKNGEAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  VG+
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLDKVDTLIIGGGMSYTFSKAMGGNVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+      +  +A+    ++++P D V+A +      TQVV    +P     LD+
Sbjct: 240 SLLEEDYCQYALDMLKKAEEKGVKLLLPVDNVIADDFSNDANTQVVLRGEIPDGWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    +    +I GGGD
Sbjct: 300 GPETEKIFCDAVQDAKTVVWNGPMGCFEMPNFAHGTEAVAKALA----DTDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|254416717|ref|ZP_05030467.1| phosphoglycerate kinase [Microcoleus chthonoplastes PCC 7420]
 gi|196176457|gb|EDX71471.1| phosphoglycerate kinase [Microcoleus chthonoplastes PCC 7420]
          Length = 401

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/400 (41%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +T+ +L   D+ G R L+R D NVP   +G + D TRI   +PTI +L++K AKVV
Sbjct: 1   MSK-KTVANLNESDLAGKRVLVRADLNVPLDENGTITDDTRIRAALPTIQDLIKKNAKVV 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+ +      L  V +    +L + ++  +DCIG  +   I SL  G + L E
Sbjct: 60  MCSHLGRPKGQVKDSLRLTPVANRLSELLGQTVVKCDDCIGDAVKSQIDSLDNGQVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N+RF+  EE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++H   PS  G  ++KE
Sbjct: 120 NLRFHPGEEKNDPEFTKKLAALADVYVNDAFGTAHRAHASTEGVTHHLQPSVAGYLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     + PL AI+GGSKVS+KI ++  L+ KVDKL+IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQNAIENPQNPLAAIIGGSKVSSKIGVIETLLDKVDKLLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    ++++P DVVVA        +Q VS +S+P   + LD
Sbjct: 240 KSLVEEDKLELAKSLEAKAKEKGVDLLLPTDVVVADNFAADANSQTVSVESIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V++ +  +   ++V+WNGP+GVFE + F   T  +A  +A LTK +   +I GGG
Sbjct: 300 IGPDSVKFFQDALGDCKSVIWNGPMGVFEFDKFAAGTEAIARTLADLTK-KGTTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPGI AL
Sbjct: 359 DSVAAVEKVGVADQMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|255544582|ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gi|223547260|gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
          Length = 401

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 249/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L++  A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   +   +DCIG  + + +A + EGG++L E
Sbjct: 61  LCTHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMASDCIGEEVEKLVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFHKEEEKNEPEFAKKLAGLADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLEKVDILILGGGMIFTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVV+A +      ++VV A S+P   + LD
Sbjct: 240 SSLVEGDKLDLASSLIEKAKAKGVDLLLPTDVVIADKFAADANSKVVPASSIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +   +T++WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 VGPDAIKTFCEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|331085018|ref|ZP_08334105.1| phosphoglycerate kinase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330408718|gb|EGG88183.1| phosphoglycerate kinase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 397

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 245/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+   +PTI +L+    +V++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLVAALPTIKKLIADGGRVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V +    +L + + F  D   +G     ++ ++ +G +IL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAARLSELLGQEVKFAADPEVVGPNAKAAVEAMEDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   + ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKELASLCEVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL++KVD L+IGGGM+ +F  AQG  VG+
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLEKVDVLIIGGGMSYTFSKAQGGTVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ +    +  +A+    ++++P D V+A +      T+VV++  +P     LD+
Sbjct: 240 SLLEEDYCEYALNMIKKAEEKGVKLLLPVDNVIADDFSNDANTKVVASGEIPDGWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E   + +  A+TV+WNGP+G FE+  F   T  VA  +A    +   ++I GGGD
Sbjct: 300 GPKTAELFAETVKTAKTVVWNGPMGAFEMPKFAAGTEAVAKALA----DTEAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|325661225|ref|ZP_08149852.1| phosphoglycerate kinase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472732|gb|EGC75943.1| phosphoglycerate kinase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 397

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 245/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+   +PTI +L+    +V++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLVAALPTIKKLIADGGRVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V +    +L + + F  D   +G     ++ ++ +G +IL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAARLSELLGQEVKFAADPEVVGPNAKAAVEAMEDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   + ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKELASLCEVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL++KVD L+IGGGM+ +F  AQG  VG+
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLEKVDVLIIGGGMSYTFSKAQGGIVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ +    +  +A+    ++++P D V+A +      T+VV++  +P     LD+
Sbjct: 240 SLLEEDYCEYALNMIKKAEEKGVKLLLPVDNVIADDFSNDANTKVVASGEIPDGWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E   + +  A+TV+WNGP+G FE+  F   T  VA  +A    +   ++I GGGD
Sbjct: 300 GPKTAELFAETVKTAKTVVWNGPMGAFEMPKFAAGTEAVAKALA----DTEAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|157412552|ref|YP_001483418.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9215]
 gi|166987796|sp|A8G2K1|PGK_PROM2 RecName: Full=Phosphoglycerate kinase
 gi|157387127|gb|ABV49832.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9215]
          Length = 402

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/401 (39%), Positives = 249/401 (62%), Gaps = 5/401 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV+
Sbjct: 1   MSKL-SLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L +N+   N CIG        SLS G ++L E
Sbjct: 60  LAAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAIAQSNSLSNGDVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+ND +F + L+ + D YINDAF  +HRAHAS  G+++   PS  G  ++KE
Sbjct: 120 NVRFFGEEEKNDLEFAKKLASHADMYINDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDSPKRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D       +  +AK    E+++P DVV+A E      +++    S+  + + LD
Sbjct: 240 KSLVEEDKLKLAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISRIDSISGNWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPDSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSAFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|224109062|ref|XP_002315067.1| predicted protein [Populus trichocarpa]
 gi|222864107|gb|EEF01238.1| predicted protein [Populus trichocarpa]
          Length = 401

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L++  A+V+
Sbjct: 1   MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   NDCIG  + + +A +  GG++L E
Sbjct: 61  LCSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF+ EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDFLFLGGGMIFTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVVVA +      ++VV A  +    + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPTDVVVADKFAPDANSKVVPASEIADGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|211906450|gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
          Length = 401

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/401 (41%), Positives = 249/401 (62%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  +++ DL+  D++G +  +RVD NVP  D   + D TRI   VPTI  L+   +KV+
Sbjct: 1   MATKKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   NDCIG  + + +A+L +GG++L E
Sbjct: 61  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAALPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGHAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVVVA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVVADKFAADANSKVVPASGIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL+
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALN 399


>gi|322384479|ref|ZP_08058161.1| phosphoglycerate kinase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321150689|gb|EFX44164.1| phosphoglycerate kinase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 414

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/398 (36%), Positives = 234/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              + + D+ ++ G R  +RVD+NVP  +G++ D TRI   +PT+  L+E+ A+V++ SH
Sbjct: 22  MNKKIVRDV-EVAGKRVFVRVDFNVPLENGQITDDTRIRETLPTVKYLIEQGARVILASH 80

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V      +L K ++  +  IG+   +    L  G ++L ENVRF
Sbjct: 81  LGRPKGQVVEEMRLTPVAKRLSELLGKPVVKADVAIGAEAKEKAEQLKNGEVLLLENVRF 140

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   + Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 141 YPGEEKNDPELAKAFAELAELYVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELDVLG 200

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AI+GG+KV  KI ++ NL+   D ++IGGG+A +FL AQG  VG+SL  
Sbjct: 201 KALTNPERPFTAIIGGAKVKDKIDVINNLLNLADNIIIGGGLAYTFLKAQGNEVGKSLVD 260

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +  D       +AK      ++P+D++VA +      T+VV+   +P D   LD+G +T
Sbjct: 261 NEKIDLALGFINKAKEKGVNFLLPKDIIVADDFSNTANTKVVAVNQIPADWEGLDIGPET 320

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +   + I  ++ V+WNGP+GVFE++ F   T  VA   A    E    +I GGGD+  A
Sbjct: 321 CKLYAETIKNSKLVVWNGPMGVFEMDLFAEGTKAVAQACA----ETEAYTIIGGGDSAAA 376

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++  ++ST GGA LE++EGK LPG+VAL   
Sbjct: 377 VEKFKMADKMDHISTGGGASLEFMEGKALPGVVALQDK 414


>gi|167461756|ref|ZP_02326845.1| phosphoglycerate kinase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 393

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/398 (36%), Positives = 234/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              + + D+ ++ G R  +RVD+NVP  +G++ D TRI   +PT+  L+E+ A+V++ SH
Sbjct: 1   MNKKIVRDV-EVAGKRVFVRVDFNVPLENGQITDDTRIRETLPTVKYLIEQGARVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  ++  L  V      +L K ++  +  IG+   +    L  G ++L ENVRF
Sbjct: 60  LGRPKGQVVEEMRLTPVAKRLSELLGKPVVKADVAIGAEAKEKAEQLKNGEVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   + Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L 
Sbjct: 120 YPGEEKNDPELAKAFAELAELYVNDAFGAAHRAHASTEGIAHHLPAVSGLLMEKELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AI+GG+KV  KI ++ NL+   D ++IGGG+A +FL AQG  VG+SL  
Sbjct: 180 KALTNPERPFTAIIGGAKVKDKIDVINNLLNLADNIIIGGGLAYTFLKAQGNEVGKSLVD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +  D       +AK      ++P+D++VA +      T+VV+   +P D   LD+G +T
Sbjct: 240 NEKIDLALGFINKAKEKGVNFLLPKDIIVADDFSNTANTKVVAVNQIPADWEGLDIGPET 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +   + I  ++ V+WNGP+GVFE++ F   T  VA   A    E    +I GGGD+  A
Sbjct: 300 CKLYAETIKNSKLVVWNGPMGVFEMDLFAEGTKAVAQACA----ETEAYTIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++  ++ST GGA LE++EGK LPG+VAL   
Sbjct: 356 VEKFKMADKMDHISTGGGASLEFMEGKALPGVVALQDK 393


>gi|33866859|ref|NP_898418.1| phosphoglycerate kinase [Synechococcus sp. WH 8102]
 gi|46576725|sp|Q7U3V0|PGK_SYNPX RecName: Full=Phosphoglycerate kinase
 gi|33639460|emb|CAE08844.1| phosphoglycerate kinase [Synechococcus sp. WH 8102]
          Length = 402

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 158/401 (39%), Positives = 247/401 (61%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLNAGDLSGKRVLVRVDFNVPLNEAGAITDDTRIRAALPTINDLIGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +   + CIG      + ++++G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVNAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF++EEE+ND  F   L+   + Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 120 NVRFFAEEEKNDAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DVV+A        +QV    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQVADVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   V+  +  +   +TV+WNGP+GVFE E F   T  +A  +A+L+ +    +I GGG
Sbjct: 300 IGPDAVKVFQDALGDCQTVIWNGPMGVFEFEKFATGTNAIATTLAELSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL+
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAALN 399


>gi|325971263|ref|YP_004247454.1| phosphoglycerate kinase [Spirochaeta sp. Buddy]
 gi|324026501|gb|ADY13260.1| Phosphoglycerate kinase [Spirochaeta sp. Buddy]
          Length = 392

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 161/397 (40%), Positives = 243/397 (61%), Gaps = 5/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             L T+ D  D    + L+RVD+NVP  DG V D TRI+  +PTI  L+E  A VV+ SH
Sbjct: 1   MILNTIRD-YDFSNKKALVRVDFNVPLKDGVVTDDTRIQAALPTISYLLEHGATVVVMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ K + + S+  +      +L K ++   D IG  ++  +A L +G ++L ENVRF
Sbjct: 60  FGRPKGKKNPEFSMAPIAKRFSELLGKQVILAKDVIGPEVALQVAGLKKGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE NDP+F + L+  GD Y+NDAF  +HRAHAS  G++H LPS+ G  ++KE+  + 
Sbjct: 120 YAEEETNDPEFSKNLASFGDVYVNDAFGTAHRAHASTEGVAHFLPSFAGFLIEKEVKFMA 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  KP VAI+GGSKVS+KI++L +LV+  + +VIGGGMA +FL  QG  +G+SL +
Sbjct: 180 PLLENPDKPFVAIIGGSKVSSKISVLESLVRTCNTIVIGGGMAYTFLAVQGHSIGKSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D+ +       +AK    ++I+P D +   E K       + +  +P + I +D+G KT
Sbjct: 240 EDYKETAASFLAKAKEKGVQVILPVDHLCGEEFKEDTAVVTIDSADIPQNLIGMDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  I   ++QA++V+WNGP+GVFE   F   T+ VA  +A+        ++ GGGD++ A
Sbjct: 300 VALIVAAVSQAKSVVWNGPMGVFEFNSFANGTLTVAKALAQ----SNATTVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    ++++ ++VST GGA LE+LEG+ LPGI AL  
Sbjct: 356 INKFNLADKISHVSTGGGASLEFLEGQVLPGIKALEK 392


>gi|253682117|ref|ZP_04862914.1| phosphoglycerate kinase [Clostridium botulinum D str. 1873]
 gi|253561829|gb|EES91281.1| phosphoglycerate kinase [Clostridium botulinum D str. 1873]
          Length = 398

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/400 (37%), Positives = 237/400 (59%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D++ ++G R L+R D+NVP  DG + D  R+   +PTI  LV   AKV++ SHL
Sbjct: 4   NKKTVEDIQ-VKGKRVLVRCDFNVPLKDGVITDENRLVGALPTIQYLVNGGAKVILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+P+ ++  + SL  V      +L+K ++F  D   +G     +++++ +G ++L +N R
Sbjct: 63  GKPKGEAKPELSLAPVAKRLSELLNKEVIFAADDNVVGENAKNAVSNMKDGDVVLLQNTR 122

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKELSM 179
           +  EE +N+ +F + L+   D ++NDAF  +HRAH S  G++  +     G  +QKEL  
Sbjct: 123 YRKEETKNEENFSKELASLADVFVNDAFGTAHRAHCSTVGVTEFVDEAACGYLIQKELQF 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        +P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  +G+SL
Sbjct: 183 LGDAVESPVRPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +AK    ++++P D +V  E             ++P   + LD+G 
Sbjct: 243 VEEDKVEYAKEMMDKAKDKGVKLLLPIDNIVGEEFSADTTPVTTEDANIPEGFMGLDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +     + +A+TV+WNGP+GVFE   F + T+ VA  +A+        +I GGGD+ 
Sbjct: 303 KTSKLYADAVREAKTVVWNGPMGVFEFANFAKGTIAVAESMAEA----DATTIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGIVALS  
Sbjct: 359 AAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIVALSDK 398


>gi|56750442|ref|YP_171143.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
 gi|81676947|sp|Q5N4Z6|PGK_SYNP6 RecName: Full=Phosphoglycerate kinase
 gi|56685401|dbj|BAD78623.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
          Length = 402

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 245/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ RT+  L   D+ G R L+RVD+NVP   +GK+ D TRI   +PTI  L E  AKV+
Sbjct: 1   MSK-RTLASLTAADLEGKRVLVRVDFNVPLDGNGKITDDTRIRAALPTIRYLSESGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ K  +   L  V      +L + ++   D +G+     +A+ S G ++L E
Sbjct: 60  LVSHFGRPKGKPVESMRLTPVAERLSELLGRPVVKTTDAVGAGAEAQVAATSNGQVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF++EEE ND +F + L+   D Y+NDAF  +HRAHA   G++  L   + G  ++KE
Sbjct: 120 NVRFHAEEEANDAEFAKALASLADIYVNDAFGAAHRAHAPTAGVTEYLSPCVAGYLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AIVGGSKVS+KI ++  L+ K DKL+IGGGM  +F  AQG+ VG
Sbjct: 180 LQYLQAAIDNPQRPLAAIVGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +A+    ++++P DVVVA +       + V+  ++P   + LD
Sbjct: 240 GSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  +  +A  R+V+WNGP+GVFE + F   T  +A  +A LT+ +   +I GGG
Sbjct: 300 IGPESVKQFEGALADCRSVIWNGPMGVFEFDQFAVGTEAIARSLAGLTR-KGATTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++E +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|83589132|ref|YP_429141.1| phosphoglycerate kinase [Moorella thermoacetica ATCC 39073]
 gi|123525151|sp|Q2RLU1|PGK_MOOTA RecName: Full=Phosphoglycerate kinase
 gi|83572046|gb|ABC18598.1| phosphoglycerate kinase [Moorella thermoacetica ATCC 39073]
          Length = 393

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 173/399 (43%), Positives = 257/399 (64%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++L T+ DL ++   R L+RVD+NVP   G+V D TRI   +PTI  L++  A+V++ S
Sbjct: 1   MAKL-TLKDL-ELNNKRVLVRVDFNVPLEAGRVTDNTRIRAALPTIEYLLDHGARVILMS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K  ++  L  V    ES+L + +  VNDC+G  +  + A+L  G ++L EN+R
Sbjct: 59  HLGRPKGKVKEELRLDPVARELESLLGRQVHKVNDCVGPEVEAAAAALKPGEVLLLENLR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP F R L+   D Y+NDAF  +HRAHAS  G++H LP+  G  +QKE+  L
Sbjct: 119 FHPEEEKNDPGFARQLASLADVYVNDAFGAAHRAHASTEGVAHYLPAAAGFLLQKEIETL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               ++ ++P VAI+GG+KVS KI+++ NL+ KVD L+IGGGMAN+FL AQG  +G+SL 
Sbjct: 179 GKALADPERPFVAIIGGAKVSDKISVIRNLLTKVDTLIIGGGMANTFLKAQGYAMGKSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D      ++   A +   ++++PRD+VVA+E K   P QVV+  +VP   + LD+G +
Sbjct: 239 EEDQVPLAQELIQLAAQKGVKMLLPRDLVVAQEFKADAPHQVVAVNAVPDGWMALDIGPE 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T       +  ARTV+WNGP+GVFE+E F   T      VA+       ++I GGGD++ 
Sbjct: 299 TARAYAGALEGARTVVWNGPMGVFEMEAFAHGT----EAVARAVAAVDGMTIVGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++ +  ++ST GGA LE+LEGK LPG+VAL+  
Sbjct: 355 AVEKMGVAGKIGHISTGGGASLEFLEGKALPGVVALTEK 393


>gi|325479317|gb|EGC82413.1| phosphoglycerate kinase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 398

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/403 (41%), Positives = 257/403 (63%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVI 58
              +T+ DL D++G + L+RVD+NVP     + ++AD TRI+  +PTI  L+E  AKV++
Sbjct: 1   MNKKTVKDL-DVKGKKVLVRVDFNVPLSKENNEEIADDTRIKAALPTIDYLLENNAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVN--DCIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ ++  + +L  V    E+       F    + +   + + +A+L EG + L 
Sbjct: 60  MSHLGRPKGEAKPEFALKPVADWLENHYKDKFHFFPSPEVVDDKVKEEVANLKEGEVCLI 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE
Sbjct: 120 ENTRYVAGETKNDPEFAKKLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           + ++     + + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 IDVMGKALEDPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +A+ +  EI++P DVV+A E+K+G+ T+VV   S+P D   LD
Sbjct: 240 KSLLEEDKMDLSLELIKKAEENNVEILLPVDVVIADEIKSGVETEVVDIDSIPEDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT E     I  A+TV+WNGP+GVFE++ F   T +VA  +A    E   I+I GGG
Sbjct: 300 IGPKTAELFASKIKNAKTVVWNGPMGVFEVKEFANGTNKVAESLA----ESDAITIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG+ ++ T+VST GGA LE+LEGKDLPGI ++   
Sbjct: 356 DSALAIELAGLKDKITHVSTGGGASLEFLEGKDLPGISSIEDK 398


>gi|296446819|ref|ZP_06888757.1| Phosphoglycerate kinase [Methylosinus trichosporium OB3b]
 gi|296255694|gb|EFH02783.1| Phosphoglycerate kinase [Methylosinus trichosporium OB3b]
          Length = 397

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 193/398 (48%), Positives = 272/398 (68%), Gaps = 1/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+   T+ D  D++G R LLRVD+NVP  +G V D TRI+RV+PTI E+  K  KV++ +
Sbjct: 1   MAAFNTL-DSADLKGKRVLLRVDFNVPMENGVVTDRTRIQRVLPTIEEISAKGGKVILLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +  +D SL  V +     LH+ + F  DC+G    ++I  L++G I+L EN R
Sbjct: 60  HFGRPKGERKEDESLRPVAAALAETLHRPVAFAEDCVGEPAREAIGKLADGDILLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP F+  +++ GD Y+N+AFS +HRAHA+  GL+H+LP+Y GR MQ EL  L
Sbjct: 120 FHKGEEKNDPAFIAEVAKLGDLYVNEAFSAAHRAHATTEGLAHVLPAYAGRTMQAELQAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  + P++A+VGG+K+STK+ LL NL+ KVD LVIGGGMAN+FL AQG  +G+SLC
Sbjct: 180 GQALDHPEHPVMAVVGGAKISTKLELLGNLIAKVDALVIGGGMANTFLAAQGKPIGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D    I  +AK + CEI++P D  VA++ +   P+ +VS   V    +ILD+G K
Sbjct: 240 EHDLLDKARAIMADAKAADCEIVLPVDATVAQKFEAHAPSHIVSVDHVGEADMILDLGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V +I+ ++ + +T++WNGPLG FE+ PFD  T  VA   A+LT E R++S+AGGGDT+ 
Sbjct: 300 SVAHIESLLEKTKTLVWNGPLGAFELPPFDEGTNAVAQTAARLTCEGRLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AL  A  + EFTY+STAGGAFLEWLEGK+LPG+ AL  
Sbjct: 360 ALNQAHAAQEFTYLSTAGGAFLEWLEGKELPGVAALRK 397


>gi|113953913|ref|YP_731897.1| phosphoglycerate kinase [Synechococcus sp. CC9311]
 gi|123132353|sp|Q0I6M5|PGK_SYNS3 RecName: Full=Phosphoglycerate kinase
 gi|113881264|gb|ABI46222.1| phosphoglycerate kinase [Synechococcus sp. CC9311]
          Length = 402

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLAKLNTSDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +     CIG      + +++ G ++L E
Sbjct: 60  LAAHFGRPKGQVNDKMRLTPVATRLSELLSKPVTKTESCIGPDAEAKVNAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+ND DF + L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNDADFAKQLAGLADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DV++A        +QV    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVLLADNFAPDANSQVADVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   ++  +  +A  +TV+WNGP+GVFE + F   T  +A  +A+L+ +    +I GGG
Sbjct: 300 IGPDAIKVFQAALADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAELSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|150021145|ref|YP_001306499.1| phosphoglycerate kinase [Thermosipho melanesiensis BI429]
 gi|166987819|sp|A6LMG3|PGK_THEM4 RecName: Full=Phosphoglycerate kinase
 gi|149793666|gb|ABR31114.1| Phosphoglycerate kinase [Thermosipho melanesiensis BI429]
          Length = 402

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +L T+ D+ DI+  + ++RVD+NVP  DGK+ D TRI   +PTI   +E  A V++ S
Sbjct: 1   MEKL-TIRDI-DIKNKKVIMRVDFNVPLKDGKITDDTRIVEALPTIKYAIENNAVVILLS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +   + SL  V      +L K + FV +  G  +  +I +   G +IL EN R
Sbjct: 59  HLGRPKGERKPEFSLKPVSERLSELLGKQVTFVPELYGEEVKMAIDNAKPGDVILLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  +  +   D ++NDAF  +HRAHAS  G+S  +PS  G  M+KE+  L
Sbjct: 119 FDKGETKNDPELAKKWADLADIHVNDAFGTAHRAHASNVGISQYIPSVAGFLMEKEIKFL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  +KP V I+GG+KVS KI ++ NL+ K DK++IGG M  +FL A G  VG SL 
Sbjct: 179 SKATLNPEKPYVVILGGAKVSDKIGVITNLLNKADKILIGGAMMFTFLKALGKNVGSSLV 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGF 299
           + D  D   +I  EAK    E ++P D V A+++++G+ T+       +P   + LD+G 
Sbjct: 239 EEDKLDLAKRILEEAKEKGVEFVLPVDAVCAQKIESGVETKTFRINDGIPEGWMGLDIGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++++  K+ I+ A+T++WNGP+GVFEIE F+  T EVA  +A  T E+   ++ GGGD+ 
Sbjct: 299 ESIKLFKEKISGAKTIVWNGPMGVFEIEDFETGTKEVAISIAAET-EKGATTVIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+A   + N+ ++VST GGA LE+LEGK+LPGI +++  
Sbjct: 358 AAIAKFNLKNKVSHVSTGGGASLEFLEGKELPGIASIASK 397


>gi|118442874|ref|YP_877493.1| phosphoglycerate kinase [Clostridium novyi NT]
 gi|166219321|sp|A0PYP1|PGK_CLONN RecName: Full=Phosphoglycerate kinase
 gi|118133330|gb|ABK60374.1| phosphoglycerate kinase [Clostridium novyi NT]
          Length = 398

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/400 (37%), Positives = 235/400 (58%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D++ ++G + L+R D+NVP  DG + D  R+   +PTI  LV + AKV++ SHL
Sbjct: 4   NKKTVEDIQ-VKGKKVLVRCDFNVPLKDGVITDENRLVGAMPTIKYLVNEGAKVILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+P+ ++  + SL  V      +L K ++F  D   +G    +++A + +G ++L +N R
Sbjct: 63  GKPKGEAKPELSLAPVAKRLSELLEKEVVFAADDTVVGENAKKAVAEMKDGDVVLLQNTR 122

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           +  EE +N+ +F + L+   D ++NDAF  +HRAH S  G++     +  G  +QKEL  
Sbjct: 123 YRKEETKNEENFSKELASLADVFVNDAFGTAHRAHCSTVGVADFLNEAACGYLIQKELKF 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        +P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  +G+SL
Sbjct: 183 LGDAVETPVRPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTIGKSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +AK    ++++P D VV  E             ++P   + LD+G 
Sbjct: 243 VEEDKVEYAKEMMDKAKAKGVKLLLPVDNVVGEEFDANTTPVTTEDANIPEGYMGLDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT       +  A+TV+WNGP+GVFE   F + T+ VA  +A+        +I GGGD+ 
Sbjct: 303 KTSALYADAVRTAKTVVWNGPMGVFEFANFAKGTIAVAEAMAEA----DATTIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGIVALS  
Sbjct: 359 AAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIVALSDK 398


>gi|168182163|ref|ZP_02616827.1| phosphoglycerate kinase [Clostridium botulinum Bf]
 gi|237793546|ref|YP_002861098.1| phosphoglycerate kinase [Clostridium botulinum Ba4 str. 657]
 gi|259530732|sp|C3KYR4|PGK_CLOB6 RecName: Full=Phosphoglycerate kinase
 gi|182674609|gb|EDT86570.1| phosphoglycerate kinase [Clostridium botulinum Bf]
 gi|229261519|gb|ACQ52552.1| phosphoglycerate kinase [Clostridium botulinum Ba4 str. 657]
          Length = 398

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/403 (36%), Positives = 242/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+EK AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        V   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVVTEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKSFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  +  T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDNMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|187917935|ref|YP_001883498.1| phosphoglycerate kinase [Borrelia hermsii DAH]
 gi|226699796|sp|B2S1P1|PGK_BORHD RecName: Full=Phosphoglycerate kinase
 gi|119860783|gb|AAX16578.1| phosphoglycerate kinase [Borrelia hermsii DAH]
          Length = 392

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 246/397 (61%), Gaps = 5/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D  D  G R L+R D+NVP  +G + D TRI   +PTI  L  + A+VV+ SH
Sbjct: 1   MSIKTIKDF-DFSGKRALVRCDFNVPLREGNITDDTRIRAALPTIEYLKSQGARVVLMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + +   SL  V      +L +++  + DCIG  ++ +++++  G ++L EN+RF
Sbjct: 60  LGRPKGERNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATAVSNMKNGDVVLLENIRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y +EE N  DF + LS+NGD ++NDAF  +HRAHAS  GL+  LP+  G  M+KE   L 
Sbjct: 120 YRQEEENCNDFAKKLSQNGDIFVNDAFGTAHRAHASTAGLAAYLPAVGGFLMEKEDEFLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 + P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL +
Sbjct: 180 KILKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGHSIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA E K     + V A  +P   I +D+G KT
Sbjct: 240 NEYIDVAASFLKKAKELDVKVILPLDHIVASEFKEDSIPEYVDAIDIPDGKIGMDIGEKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +  I++V+  A+TV+WNGPLGVFE + F + T +VA YVA  +     I++ GGGD++ A
Sbjct: 300 LRKIEEVLVSAKTVIWNGPLGVFEFDSFSKGTAKVAEYVASCSG----ITVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S + T+VST GGA LE+LEGK LPGI  L  
Sbjct: 356 VNKFNLSEKITHVSTGGGASLEYLEGKILPGIKVLEK 392


>gi|209550817|ref|YP_002282734.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|259530815|sp|B5ZPA0|PGK_RHILW RecName: Full=Phosphoglycerate kinase
 gi|209536573|gb|ACI56508.1| Phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 400

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 217/397 (54%), Positives = 285/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DIRG R L+RVD NVP  DGKV D TRIERV PTILEL EK AKV++ +
Sbjct: 1   MPSFKTLDDLSDIRGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSEKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     + SL  +    E +L   +   +DCIG   + ++A++++G I+L EN R
Sbjct: 61  HFGRPKDGPSPELSLSLIAPSVEEVLDHAVSTASDCIGEAAASAVAAMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDPDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 181 EKGLGDPARPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C II+P D V+ARE K G   + V   ++P D+++LDVG K
Sbjct: 241 EHDLAETARQIMIEAATSGCAIILPEDGVIAREFKAGAANETVDIDAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V+ I   I +A T++WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++
Sbjct: 301 SVQAISAWIERASTLVWNGPLGAFEIEPFDAATVGAAKYAAERTTAGKLTSVAGGGDTVS 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 397


>gi|194335064|ref|YP_002016924.1| phosphoglycerate kinase [Prosthecochloris aestuarii DSM 271]
 gi|229620377|sp|B4S6S2|PGK_PROA2 RecName: Full=Phosphoglycerate kinase
 gi|194312882|gb|ACF47277.1| Phosphoglycerate kinase [Prosthecochloris aestuarii DSM 271]
          Length = 397

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 156/398 (39%), Positives = 245/398 (61%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
            + +T++D+   +G R L+RVD+NVP   +G + +  RI   +P+I +++E   ++++ S
Sbjct: 1   MQKKTLSDIS-CKGKRILMRVDFNVPLDLNGTITNDKRIIEALPSIRQVLETGGRLILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K   + SL  V      +L  +++  N+CIG+   Q   +L +G +++ EN+R
Sbjct: 60  HLGRPKGKVTPELSLAPVARRLSELLDTDVVMANNCIGTEAMQQALALQDGEVMMLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITG-LSHLLPSYIGRAMQKELSM 179
           F+ EEE+NDP+F R L+  G+ Y+NDAF  +HRAHAS  G   ++  S  G  ++KEL  
Sbjct: 120 FHPEEEKNDPEFARELASMGEIYVNDAFGTAHRAHASTEGICHYVPISVAGFLIEKELRY 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +  +  ++P +AI+GG+K+S KI +L NL  KVD ++IGG M  +F  AQG  VG SL
Sbjct: 180 LGNALANPERPFLAILGGAKISGKIDVLDNLFDKVDTILIGGAMIFTFFKAQGYQVGTSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +    +  +A      +++P DV+ A        T  V   S+P   + LD+G 
Sbjct: 240 VEEDKIELAKHLLEKAAAKNIRMLLPEDVIAASAFSADAETATVPIDSIPETMMGLDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++   + I +ART++WNGP+GVFEI+ F   T+ +AH +A  T  +  ISI GGGD+ 
Sbjct: 300 KTIDTYSREILKARTIVWNGPMGVFEIDAFATGTIAIAHALADAT-AKGAISIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+  AG+ +  T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 359 AAVMKAGLESGITHISTGGGASLEFLEGKELPGIAALN 396


>gi|329114752|ref|ZP_08243509.1| Phosphoglycerate kinase [Acetobacter pomorum DM001]
 gi|326695883|gb|EGE47567.1| Phosphoglycerate kinase [Acetobacter pomorum DM001]
          Length = 407

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 196/399 (49%), Positives = 269/399 (67%), Gaps = 3/399 (0%)

Query: 1   MSRLR--TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+ L   T++ L D +G R LLRVD NVP  DGKV D TRIERVVPTI EL EK  +V++
Sbjct: 1   MAELPFSTLDTL-DPKGKRILLRVDLNVPMKDGKVTDETRIERVVPTIRELAEKGGRVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH  RP+ K   D SL  + +   + L + + F +DCIG     +  S+ +G I+L EN
Sbjct: 60  LSHFDRPKGKVVPDMSLQPIATALATALGRPVSFAHDCIGPDAEAAARSMQDGDILLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF   EE+ND      L+  GD Y+NDAFS +HRAHAS  G++  LPSY GR MQ EL 
Sbjct: 120 TRFQPGEEKNDAGLSAALASLGDVYVNDAFSAAHRAHASTAGVAAHLPSYGGRLMQAELE 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +     ++P+ AIVGG+K+STK+ LL N++ KVD L IGG MAN+FL A+G+ VG+S
Sbjct: 180 ALYAALENPERPVGAIVGGAKISTKLQLLENMLAKVDMLAIGGAMANTFLAAKGLQVGKS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L ++D  D    I  +A+   C++I+P DVV++ +   G PTQVV A ++P   + LDVG
Sbjct: 240 LIEKDMLDTARTIMEQAQAKKCDLILPVDVVISEDFIAGAPTQVVPATAIPDGWMALDVG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +TV+ ++  +A  +T++WNGPLGVFE+ PFD  T  VA   A+LT+E ++ ++AGGGDT
Sbjct: 300 PETVKLLQSKLAGLKTLVWNGPLGVFELPPFDEGTNAVAQAAAQLTQEGKLKTVAGGGDT 359

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++AL HAG+ ++ +YVSTAGGAFLEWLEGK LPG+ A+S
Sbjct: 360 VSALRHAGVLHKMSYVSTAGGAFLEWLEGKILPGLTAIS 398


>gi|225570691|ref|ZP_03779714.1| hypothetical protein CLOHYLEM_06791 [Clostridium hylemonae DSM
           15053]
 gi|225160518|gb|EEG73137.1| hypothetical protein CLOHYLEM_06791 [Clostridium hylemonae DSM
           15053]
          Length = 397

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/402 (36%), Positives = 243/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+E  +PTI +L     +V++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLEAALPTIKKLAADGGRVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++    SL  V +    +L + + F  D   +G     +++++ +G IIL EN
Sbjct: 60  HLGKPKGEAVPSLSLAPVAARLSELLGQEVKFAADPEVVGPNAKAAVSAMKDGEIILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  AQG  VG+
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLDKVDTLIIGGGMSYTFSKAQGGNVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ D    +  +AK    ++++P D V+A +      ++VV A  +P D   LD+
Sbjct: 240 SLLEEDYCDYALDMLKKAKEKGVKLLLPVDTVIADDFSNDANSRVVKAGEIPADWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T     + +  A+TV+WNGP+G FE+  F   T  VA  +A    E    +I GGGD
Sbjct: 300 GPETAAMFSEAVEDAKTVVWNGPMGCFEMPNFATGTEAVAKALA----ETDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ +++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMSHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|123967750|ref|YP_001008608.1| phosphoglycerate kinase [Prochlorococcus marinus str. AS9601]
 gi|166987799|sp|A2BNZ0|PGK_PROMS RecName: Full=Phosphoglycerate kinase
 gi|123197860|gb|ABM69501.1| Phosphoglycerate kinase [Prochlorococcus marinus str. AS9601]
          Length = 402

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 156/401 (38%), Positives = 248/401 (61%), Gaps = 5/401 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D   + G + L+RVD+NVP   DG++ D TRI   +PTI  L+   AKV+
Sbjct: 1   MSKL-SLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L +N+   N CIG        SLS G ++L E
Sbjct: 60  LAAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAVAQSNSLSNGDVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+ND +F   L+ + D Y+NDAF  +HRAHAS  G+++   PS  G  ++KE
Sbjct: 120 NVRFFGEEEKNDLEFAEKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+       +PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAVDSPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DVV+A E      +++    ++  + + LD
Sbjct: 240 KSLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLADEFSPDANSKISQIDAISGNWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPDSIKVFQNALAECKTIIWNGPMGVFEFDKFADGTNAIATTLADLSAFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALN 400


>gi|258541141|ref|YP_003186574.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632219|dbj|BAH98194.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635276|dbj|BAI01245.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638331|dbj|BAI04293.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641385|dbj|BAI07340.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-22]
 gi|256644440|dbj|BAI10388.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-26]
 gi|256647495|dbj|BAI13436.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-32]
 gi|256650548|dbj|BAI16482.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653539|dbj|BAI19466.1| phosphoglycerate kinase [Acetobacter pasteurianus IFO 3283-12]
          Length = 407

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 196/399 (49%), Positives = 268/399 (67%), Gaps = 3/399 (0%)

Query: 1   MSRLR--TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+ L   T++ L D +G R LLRVD NVP  DGKV D TRIERVVPTI EL EK  +V++
Sbjct: 1   MAELPFSTLDTL-DPKGKRILLRVDLNVPMKDGKVTDETRIERVVPTIRELAEKGGRVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH  RP+ K   D SL  + +   + L + + F +DCIG     +  S+ +G I+L EN
Sbjct: 60  LSHFDRPKGKVVPDMSLQPIATALATALGRPVSFAHDCIGPDAEAAARSMQDGDILLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
            RF   EE+ND      L+  GD Y+NDAFS +HRAHAS  G++  LPSY GR MQ EL 
Sbjct: 120 TRFQPGEEKNDAGLSAALASLGDVYVNDAFSAAHRAHASTAGVAAHLPSYGGRLMQAELE 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L +     ++P+ AIVGG+K+STK+ LL N++ KVD L IGG MAN+FL A+G+ VG+S
Sbjct: 180 ALYAALENPERPVGAIVGGAKISTKLQLLENMLAKVDMLAIGGAMANTFLAAKGLQVGKS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L ++D  D    I  +AK   C++I+P DVV++ +   G PTQVV   ++P   + LDVG
Sbjct: 240 LIEKDMLDTARTIMEQAKAKNCDLILPVDVVISEDFIAGAPTQVVPVTAIPDGWMALDVG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +TV+ ++  +A  +T++WNGPLGVFE+ PFD  T  VA   A+LT+E ++ ++AGGGDT
Sbjct: 300 PETVKLLQSKLAGLKTLVWNGPLGVFELPPFDEGTNAVAQAAAQLTQEGKLKTVAGGGDT 359

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ++AL HAG+ ++ +YVSTAGGAFLEWLEGK LPG+ A+S
Sbjct: 360 VSALRHAGVLHKMSYVSTAGGAFLEWLEGKVLPGLTAIS 398


>gi|153855256|ref|ZP_01996422.1| hypothetical protein DORLON_02436 [Dorea longicatena DSM 13814]
 gi|149752255|gb|EDM62186.1| hypothetical protein DORLON_02436 [Dorea longicatena DSM 13814]
          Length = 397

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/402 (36%), Positives = 241/402 (59%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLVAALPTIKKLIADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++A + +G +IL EN
Sbjct: 60  HLGKPKGQPVPELSLAPVAVRLSELLGQEVKFAADPEVVGPNAKAAVAEMKDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N+  F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNEDAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTKYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGMA +F  AQG  VG+
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLLDKVDTLIIGGGMAYTFAKAQGGTVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+      +  +AK    ++++P D VV  +      TQVV A  +P     LD+
Sbjct: 240 SLLEEDYCQYALDMIEKAKAKGVKLLLPVDNVVGDDFSNDANTQVVKAGEIPEGWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F + T  VA  +A    +   ++I GGGD
Sbjct: 300 GPETAKIFSDAVKDAKTVVWNGPMGCFEMPKFAKGTETVAKALA----DTDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|116787582|gb|ABK24564.1| unknown [Picea sitchensis]
          Length = 507

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 252/400 (63%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL+  D++G R  +R D NVP  + + + D TRI   VPTI  L+   AKV+
Sbjct: 103 MAK-KSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNGAKVI 161

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  N+L  +DCIG  + +++ASL +GG++L E
Sbjct: 162 LASHLGRPKG-VTPKYSLKPLVPRLTELLGVNVLKTDDCIGEEVEKAVASLPDGGVLLLE 220

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           N+RF+ EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 221 NLRFHKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLMQKE 280

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG+ VG
Sbjct: 281 LDYLVGAVSVPKRPFAAIVGGSKVSSKIGVIESLLEKVDILFLGGGMIFTFYKAQGLKVG 340

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      ++VV A  +P   + LD
Sbjct: 341 SSLVEDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLD 400

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 401 IGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSIAKKLAELSG-KGVTTIIGGG 459

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 460 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLAL 499


>gi|322804495|emb|CBZ02045.1| phosphoglycerate kinase [Clostridium botulinum H04402 065]
          Length = 398

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/403 (36%), Positives = 242/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+ K AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMRKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        V   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVVTEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKNFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|197303196|ref|ZP_03168238.1| hypothetical protein RUMLAC_01919 [Ruminococcus lactaris ATCC
           29176]
 gi|197297736|gb|EDY32294.1| hypothetical protein RUMLAC_01919 [Ruminococcus lactaris ATCC
           29176]
          Length = 399

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/404 (36%), Positives = 238/404 (58%), Gaps = 10/404 (2%)

Query: 1   MS--RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+    ++++D+ +++G R L+R D+NVP IDGK+ D  RI   +PTI +L+    KV++
Sbjct: 1   MAALNKKSVDDI-NVKGKRVLVRCDFNVPLIDGKITDENRIVAALPTIKKLIADGGKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLG+P+ +   + SL  V      +L + + F  D   +G     ++ ++ +G +IL 
Sbjct: 60  CSHLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADPEVVGPNAKAAVEAMQDGDVILL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQK 175
           EN R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQK
Sbjct: 120 ENTRYRAEETKNGEAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQK 179

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  L +     ++P VAI+GG+KVS+KI+++ NL++KVD L+IGGGMA +F  A G  V
Sbjct: 180 EIDFLGNAVENPERPFVAILGGAKVSSKISVIENLLEKVDTLIIGGGMAYTFSKAMGGNV 239

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G SL + D+      +  +A+    ++++P D V+A +       QVV++  +P     L
Sbjct: 240 GTSLLEEDYCQYALDMLKKAEDKGVKLLLPVDNVIADDFSNDANIQVVASGEIPDGWEGL 299

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G KT E     +  A+TV+WNGP+G FE+  F   T  VA  +A        ++I GG
Sbjct: 300 DIGPKTAELFADAVKTAKTVVWNGPMGCFEMPKFAAGTKAVAEALA----ATDAVTIIGG 355

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GD+  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 GDSAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 399


>gi|148240687|ref|YP_001226074.1| phosphoglycerate kinase [Synechococcus sp. WH 7803]
 gi|166987816|sp|A5GPB2|PGK_SYNPW RecName: Full=Phosphoglycerate kinase
 gi|147849226|emb|CAK24777.1| Phosphoglycerate kinase [Synechococcus sp. WH 7803]
          Length = 402

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/401 (39%), Positives = 247/401 (61%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLNAGDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +   + CIG      + ++++G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF++EEE+N+  F   L+   + Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 120 NVRFFAEEEKNEAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DVV+A        +QV    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQVADVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   V+  +  +A  +TV+WNGP+GVFE E F   T  +A  +A+L+ +    +I GGG
Sbjct: 300 IGPDAVKVFQAALADCQTVIWNGPMGVFEFEKFATGTNAIATTLAELSAKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALN 399


>gi|258510740|ref|YP_003184174.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477466|gb|ACV57785.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 395

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 157/401 (39%), Positives = 246/401 (61%), Gaps = 8/401 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIF 59
           M + +T+ D+   +G R L+RVD+NVP  D  ++ D TRI   +PTI  L ++ A+V++ 
Sbjct: 1   MPK-KTVEDVA-WQGKRALVRVDFNVPMDDARQITDDTRIRAALPTITYLSDRGARVILM 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAES-ILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           SHLGRP+ + +   SL  V     S I  K + F  + +G    +++++L++G I+L EN
Sbjct: 59  SHLGRPKGEPNPKYSLRPVADHLASLIPDKRVSFCPEAVGEEAQKAVSALADGDILLLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRFY  EE+NDP F R L+  GD ++NDAF  +HRAHAS  G++  LP   G  M++E+ 
Sbjct: 119 VRFYPGEEKNDPAFARQLADLGDVFVNDAFGSAHRAHASTAGIAQYLPCVAGFLMEREVG 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ++    +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL  +G  + +S
Sbjct: 179 IMGKALANPERPFVAIIGGAKVSDKIKVIENLLPKVDALIIGGGMANTFLAVEGHDMAKS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  +   ++   A+ S  ++++P DVV A+         V     +  D + LDVG
Sbjct: 239 LVEEDAKETARRLLDLARTSNRKLLLPVDVVAAKAFAPDAEHTVRLVSELQPDEMALDVG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             +VE  +  I  A+TV+WNGP+GVFE+  F + T  +A  +A+        +I GGGD+
Sbjct: 299 PASVEMFRNEILGAKTVIWNGPMGVFEMPAFAKGTFAIAQAMAEA----DATTIVGGGDS 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           + A+  AG++++ T+VST GGA LE+LEG+ LPG+  +   
Sbjct: 355 VAAVEQAGVADKMTHVSTGGGASLEFLEGRTLPGVAVIEDK 395


>gi|222149683|ref|YP_002550640.1| phosphoglycerate kinase [Agrobacterium vitis S4]
 gi|259530688|sp|B9JS00|PGK_AGRVS RecName: Full=Phosphoglycerate kinase
 gi|221736665|gb|ACM37628.1| phosphoglycerate kinase [Agrobacterium vitis S4]
          Length = 400

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 211/397 (53%), Positives = 284/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R LLRVD NVP   GKV D TRIERV PTI EL  K AKV++ +
Sbjct: 1   MPAFKTLDDLTDIAGKRVLLRVDLNVPVSGGKVTDATRIERVAPTIKELSAKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   D SL +++S  E +L + + F  DC+G    +++A+L+ G I+L EN R
Sbjct: 61  HFGRPKGEPVADMSLSQIISAVEEVLDQAVAFGEDCVGEPAERAVAALNNGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+ND DF   L++NGD Y+NDAFS +HRAHAS  GL+H+LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDADFTAELAKNGDIYVNDAFSAAHRAHASTEGLAHILPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +   P+VAIVGG+KVS+KI LL+NLVKKVD LVIGGGMAN+F+ AQG+ VG+SLC
Sbjct: 181 EKGLGKPTHPVVAIVGGAKVSSKIDLLMNLVKKVDALVIGGGMANTFIAAQGIDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    QI  EA+ + C I++P D VVARE K     + VS  ++P D+++LDVG K
Sbjct: 241 EHDLAATAKQIMIEAETAGCTIVLPVDGVVAREFKANAANETVSVSAIPADAMMLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V  +   I +A T++WNGPLG FEI PFD ATV  A + A+ +K  +++S+AGGGDT++
Sbjct: 301 SVAVVNDWITKAATLVWNGPLGAFEIPPFDTATVSAAKHAAERSKAGKLVSVAGGGDTVS 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+ ++F+YVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVVDDFSYVSTAGGAFLEWMEGKELPGVAVLT 397


>gi|168047403|ref|XP_001776160.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162672535|gb|EDQ59071.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 475

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 162/397 (40%), Positives = 239/397 (60%), Gaps = 5/397 (1%)

Query: 6   TMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ D+   + +G    +R D NVP  D  ++ D TRI   +PTI  L +  AKVV+ SHL
Sbjct: 79  SIKDVPESEFQGKVVFVRADLNVPLNDACEITDDTRIRASLPTIQHLTKAGAKVVLASHL 138

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +   SL  V      +L + +    DCIG+ +   IA+L  G ++L ENVRFY
Sbjct: 139 GRPKKGPEDKFSLKPVAGRLTELLGQTVELAPDCIGAEVESKIAALKNGEVLLLENVRFY 198

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLE 181
            EEE+ND +F + L++  D ++NDAF  +HRAH+S  G++  +  +  G  ++KEL+ L 
Sbjct: 199 KEEEKNDSEFSQKLAKGVDIFVNDAFGTAHRAHSSTAGIAEYVGKTVAGFLLEKELAYLA 258

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  +P VAIVGGSKVS+KIT++ +L+   DK+++GGGM  +F  A G  VG SL +
Sbjct: 259 GAVKAPARPFVAIVGGSKVSSKITVIESLMNVCDKVILGGGMIFTFFKADGKDVGSSLVE 318

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D    +   AK+   E+I+P DV  A +      TQV S+ ++P   + LD+G K 
Sbjct: 319 DDKIDLAKDLVALAKKKGVELILPVDVTAADKFSPEANTQVCSSSNIPAGWMGLDIGPKA 378

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++  +  +  A+TV+WNGP+GVFE E F   T  VA  +A LTKE   I+I GGGD++ A
Sbjct: 379 IDQFQDALKGAKTVLWNGPMGVFEFEKFADGTTAVAKTLAGLTKE-GAITIIGGGDSVAA 437

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +  AG++++ ++VST GGA LE LEGK LPG+ AL  
Sbjct: 438 VEKAGLADQMSHVSTGGGASLELLEGKVLPGVAALDN 474


>gi|183601620|ref|ZP_02962990.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|241190881|ref|YP_002968275.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196287|ref|YP_002969842.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|183219226|gb|EDT89867.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|240249273|gb|ACS46213.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250841|gb|ACS47780.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|289178620|gb|ADC85866.1| Phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295793870|gb|ADG33405.1| phosphoglycerate kinase [Bifidobacterium animalis subsp. lactis V9]
          Length = 401

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 227/402 (56%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L ++ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIEALRKEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   ++  +D  G      +A++ +G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLSELLGVPVVLASDTYGEDAQAKVAAMKDGDVVLLENVRFNP 120

Query: 124 EEERNDPDFVRMLSRNG----DFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D       ++      D +++D F V HRA  S   ++  LP+  G  ++KE++ 
Sbjct: 121 EETSKDEAERAAYAKKLAALGDVFVSDGFGVVHRAQGSDYDVAADLPAAAGLLVEKEVNA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++P   ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATEDPERPFTVVLGGSKVSDKLGVIENLLDKADRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  D V      A ++  E+++P D+VV +        +  +VV A  +P D + LD
Sbjct: 241 LEEDMIDQVKGYIETADKNGVELVLPVDIVVNKGFPAGDTPVDPKVVPADQIPSDMMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T E    +I GGG
Sbjct: 301 IGPESCKLFHDKIVDSKTVVWNGPMGVFEVPAFAAGTKAVAQALVDAT-EHGAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+  A+   G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 DSAAAVRQLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 401


>gi|166031732|ref|ZP_02234561.1| hypothetical protein DORFOR_01432 [Dorea formicigenerans ATCC
           27755]
 gi|166028185|gb|EDR46942.1| hypothetical protein DORFOR_01432 [Dorea formicigenerans ATCC
           27755]
          Length = 397

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 142/402 (35%), Positives = 242/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+   +PTI +L+    K+++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLVAALPTIKKLIADGGKIILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G+    ++A++ +G +IL EN
Sbjct: 60  HLGKPKGQPVPELSLAPVAVRLSELLGQEVKFAADPEVVGANAKAAVANMKDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N+  F + L+   + ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNEDAFSKDLASLCEVFVNDAFGTAHRAHCSNVGITKYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  AQG  VG 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVIENLIDKVDTLIIGGGMSYTFSKAQGGTVGD 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+      +  +A+    ++++P D V+A +   G   +VV +  +P     LD+
Sbjct: 240 SLLEADYCQYALDMLKKAQEKGVKLLLPVDTVIADDFSNGANKKVVKSGEIPDGWQGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    +   ++I GGGD
Sbjct: 300 GPETEKIFCDAVKDAKTVVWNGPMGCFEMPNFAHGTEAVAKALA----DTDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|308067012|ref|YP_003868617.1| phosphoglycerate kinase [Paenibacillus polymyxa E681]
 gi|305856291|gb|ADM68079.1| Phosphoglycerate kinase [Paenibacillus polymyxa E681]
          Length = 393

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/398 (38%), Positives = 232/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DGK+ D  RI   +PTI  L+EK AKV++ SH
Sbjct: 1   MNKKSVRDI-ELNGKRVFVRVDFNVPVEDGKITDDKRIRETLPTINYLIEKGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ +  +   L  V      +L K ++ V++ +G  +   +A L  G ++L ENVRF
Sbjct: 60  FGRPKGQVVESMRLTPVGVRLSELLKKPVVKVDESVGEAVKAKVAELQNGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H+LP+  G  M++ELS++ 
Sbjct: 120 YAGEEKNDPELAKQFAELADVFVNDAFGAAHRAHASTEGIAHILPAVSGLLMERELSVIG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GGSKV  KI ++ NL+   D ++IGGG+  +F  AQG  VG+SL  
Sbjct: 180 KALSNPDRPFTAIIGGSKVKDKIDVIDNLLNIADNVIIGGGLTYTFFKAQGHEVGQSLLD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D       +AK+      +P D+VV+ +      T +V    +P D   +D+G KT
Sbjct: 240 ESKLDVALGFIEKAKKLGKNFYLPVDIVVSDDFSATANTDIVDIDGIPADWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +    VI  ++ V+WNGP+GVFEIEPF   T EVA   A         +I GGGD+  A
Sbjct: 300 RKIYADVIKNSKLVVWNGPMGVFEIEPFAGGTREVAEACAT----TEAYTIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
                ++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 AEKFHLADKMDHISTGGGASLEFMEGKALPGVVALNDK 393


>gi|254561562|ref|YP_003068657.1| phosphoglycerate kinase [Methylobacterium extorquens DM4]
 gi|254268840|emb|CAX24801.1| phosphoglycerate kinase [Methylobacterium extorquens DM4]
          Length = 400

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 204/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + ++A+L +G +IL EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSEKLGRPVAFGEDCVGEAAASAVAALKDGDVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEVPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAQRILAAAKEKNCTIILPVDALVAREFKANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|170754551|ref|YP_001779858.1| phosphoglycerate kinase [Clostridium botulinum B1 str. Okra]
 gi|229620060|sp|B1IDB6|PGK_CLOBK RecName: Full=Phosphoglycerate kinase
 gi|169119763|gb|ACA43599.1| phosphoglycerate kinase [Clostridium botulinum B1 str. Okra]
          Length = 398

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/403 (36%), Positives = 242/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+ K AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMGKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKRAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        V   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVVTEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKSFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|168274229|dbj|BAG09537.1| phosphoglycerate kinase [Porphyra yezoensis]
          Length = 457

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/395 (41%), Positives = 241/395 (61%), Gaps = 4/395 (1%)

Query: 5   RTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ DL   D+ G R L+R D NVP     + D TRI   +PTI  L    AKV++ SHL
Sbjct: 61  KSIKDLTAADLAGKRVLVRCDLNVPLDGKTITDDTRIRASIPTIEYLTAAGAKVLLSSHL 120

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+S  +   SL  V +    +L K++    DCIG  +++ ++ +S G + L ENVRFY
Sbjct: 121 GRPKSGPEDKFSLAPVATRLSELLKKDVKMAPDCIGDGVAEIVSGMSNGDVTLLENVRFY 180

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLE 181
            EE  ND +F + L+ N D ++NDAF  +HRAH S  G++    PS  G  ++KEL+ L 
Sbjct: 181 KEETANDTEFAKKLAANADMFVNDAFGTAHRAHGSTAGVTEFLRPSVAGLLLEKELAYLA 240

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  K+P  AIVGGSKVS+KI ++ +++ KVDKLVI GGM  +FL A+G+  G SL +
Sbjct: 241 GAVSNPKRPFAAIVGGSKVSSKIGVIESMLDKVDKLVIVGGMVFTFLKARGLSTGSSLVE 300

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   ++   A +   +II+P DVV A +      TQ+VS  ++P D++ LD G K+
Sbjct: 301 DDKIELAKELEEIAAKKGVKIILPVDVVAADKFAPDAKTQLVSVDAIPDDTMGLDQGPKS 360

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E I   +A  +TV+WNGP GVFE + F   T  +A+ +A++T      +I GGGD++ A
Sbjct: 361 TELINAELADCKTVLWNGPAGVFEFDAFATGTYAIANTLAEVT-ANGATTIIGGGDSVAA 419

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 420 VEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 454


>gi|194476823|ref|YP_002049002.1| Phosphoglycerate kinase [Paulinella chromatophora]
 gi|171191830|gb|ACB42792.1| Phosphoglycerate kinase [Paulinella chromatophora]
          Length = 401

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D++  R L+RVD+NVP  D G + D TRI   +PTI +L+ K AK++
Sbjct: 1   MAK-RSLASLSANDVKDKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLISKNAKII 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ K ++   L  V +    +L K ++  + CIGS     + +++ G +IL E
Sbjct: 60  LAAHFGRPKGKVNESMRLTPVATRLSELLGKTVVKTDSCIGSEAEAKVNAMAAGDVILLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N+RF++EEE+ND +F   L+   D Y+NDAF  +HRAHAS  G++    P+  G  M+KE
Sbjct: 120 NIRFFAEEEKNDSEFAAKLASLADMYVNDAFGAAHRAHASTEGVTKHLSPNVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDEPKRPLAAIVGGSKVSSKIGVLETLIDKCDKILIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +A     + ++P DVV+A         +  S  ++P   + LD
Sbjct: 240 KSLVEEDKLELAKSLEAKAAMKGVQFLLPTDVVLADNFAPDANVKTTSINAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  ++ +A  +T++WNGP+GVFE E F   T  +A+ +A LT      +I GGG
Sbjct: 300 IGPDSIKSFQEALADCKTIIWNGPMGVFEFEKFAAGTDAIANTLANLTATGTC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVADKMSHISTGGGASLELLEGKILPGVAAL 398


>gi|116074041|ref|ZP_01471303.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
 gi|116069346|gb|EAU75098.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
          Length = 401

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLTGADLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K ++  + CIG      + ++++G ++L E
Sbjct: 60  LSAHFGRPKGQVNDSMRLTPVAARLSELLGKPVVKTDSCIGPDAEAKVGAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+ND  F   L+   + Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNDAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPSVGGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PL AIVGGSKVS+KI +L  L+ K DK+++GGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDAPKRPLAAIVGGSKVSSKIGVLEALMDKCDKILVGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DVV+A        +Q     ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQTAPVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSVKVFQNALADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|218530597|ref|YP_002421413.1| phosphoglycerate kinase [Methylobacterium chloromethanicum CM4]
 gi|259530770|sp|B7KNP6|PGK_METC4 RecName: Full=Phosphoglycerate kinase
 gi|218522900|gb|ACK83485.1| Phosphoglycerate kinase [Methylobacterium chloromethanicum CM4]
          Length = 400

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 203/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + ++A+L +G +IL EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSEKLGRPVAFGEDCVGEAAASAVAALKDGDVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE +     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAKRILAAAKEKNCTIILPVDALVAREFRANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|87123533|ref|ZP_01079384.1| Phosphoglycerate kinase [Synechococcus sp. RS9917]
 gi|86169253|gb|EAQ70509.1| Phosphoglycerate kinase [Synechococcus sp. RS9917]
          Length = 402

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLSGTDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLLGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L K ++  + CIG      +A+++ G ++L E
Sbjct: 60  LAAHFGRPKGQVNEGMRLTPVAARLGELLGKPVVKTDSCIGPDAEAKVAAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF++EEE+ND  F   L+   D Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 120 NVRFFAEEEKNDAGFAEKLAGLADVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +A     ++++P DVV+A        +QV S  ++P   + LD
Sbjct: 240 KSLVEDDKLELAKELEAKAAAKGVQLLLPTDVVLADNFAPDANSQVASINAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  ++ +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSIKVFQEALADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|163851791|ref|YP_001639834.1| phosphoglycerate kinase [Methylobacterium extorquens PA1]
 gi|259530774|sp|A9W5A7|PGK_METEP RecName: Full=Phosphoglycerate kinase
 gi|163663396|gb|ABY30763.1| Phosphoglycerate kinase [Methylobacterium extorquens PA1]
          Length = 400

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 205/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + +IA+L +G +IL EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSEKLGRPVAFGEDCVGEAAASAIAALKDGDVILLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAKRILAAAKEKNCTIILPVDALVAREFKANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|114386664|gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
          Length = 402

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 170/400 (42%), Positives = 247/400 (61%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D+RG +  +R D NVP  D  K+ D TRI   VPT+  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  +++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P DVVVA +      ++ V+A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESRTVAASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +    T++WNGP+GVFE E F   T  +A  +A LT  +   +I GGG
Sbjct: 300 VGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|268317353|ref|YP_003291072.1| Phosphoglycerate kinase [Rhodothermus marinus DSM 4252]
 gi|262334887|gb|ACY48684.1| Phosphoglycerate kinase [Rhodothermus marinus DSM 4252]
          Length = 402

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 175/407 (42%), Positives = 258/407 (63%), Gaps = 14/407 (3%)

Query: 1   MSRLR--TMNDLRDIRGLRCLLRVDWNVPFIDGK-----VADVTRIERVVPTILELVEKK 53
           MS LR  T++DL D++G R L+RVD+NVP  + +     VAD TRI   +PTI  L++  
Sbjct: 1   MSTLRKLTIDDL-DVKGKRVLVRVDFNVPLKEDEQGNLVVADDTRIREALPTIRALMQAG 59

Query: 54  AKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGI 113
           AKV++ SHLGRP+ + D   SL  V    E +L   + FV++ +G  + Q+I S+ EGG+
Sbjct: 60  AKVILMSHLGRPKGQPDPKYSLAPVARRLEELLGVRVRFVSNIVGEAVRQAINSMPEGGV 119

Query: 114 ILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRA 172
           IL EN RF+  E +NDP+  R L+   D Y+NDAF  +HRAHAS  G++H +    +G  
Sbjct: 120 ILLENTRFHPGETKNDPELARQLAELADVYVNDAFGSAHRAHASTEGVAHYVKQAAMGYL 179

Query: 173 MQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQG 232
           M++E+  L       + P VAI+GG+KVS KI ++ NL+ +VD+L+IGG M+ +FL A G
Sbjct: 180 MKREVEYLSRLLENPEHPFVAILGGAKVSDKIGVIKNLLPRVDRLLIGGAMSYTFLKALG 239

Query: 233 MGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDS 292
             VG S  + D  +   Q+  EA+    +I++P D VVA E     P QVV    +P   
Sbjct: 240 HNVGASRVEEDRLEEARQLYEEAQ---GKILLPVDHVVAPEFSNEAPAQVVEGD-IPDGL 295

Query: 293 IILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISI 352
           + LD+G KT+E  ++ I QARTV+WNGP+GVFE+  F + T  +A  +A+ T +R  +++
Sbjct: 296 MGLDIGPKTIERYREEILQARTVVWNGPMGVFEMPNFAKGTFAIAEALAEAT-DRGALTV 354

Query: 353 AGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            GGGD++ A+  AG ++  ++VST GGA LE+LEGK+LPG+VAL+  
Sbjct: 355 VGGGDSVAAITQAGYADRVSHVSTGGGAMLEFLEGKELPGLVALTDK 401


>gi|115444481|ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 gi|49388607|dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica
           Group]
 gi|113535551|dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gi|119395228|gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gi|218190147|gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gi|222622261|gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
          Length = 402

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 170/400 (42%), Positives = 247/400 (61%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D+RG +  +R D NVP  D  K+ D TRI   VPT+  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  +++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P DVVVA +      ++ V+A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +    T++WNGP+GVFE E F   T  +A  +A LT  +   +I GGG
Sbjct: 300 VGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|87300807|ref|ZP_01083649.1| Phosphoglycerate kinase [Synechococcus sp. WH 5701]
 gi|87284678|gb|EAQ76630.1| Phosphoglycerate kinase [Synechococcus sp. WH 5701]
          Length = 401

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 251/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D++G R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLTSLSAADLQGKRVLVRVDFNVPLDESGAITDDTRIRAALPTIHDLISKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L K ++  + CIG      +A++++G ++L E
Sbjct: 60  LAAHFGRPKGEVNEAMRLTPVAARLSELLGKPVVKTDSCIGPDAEAKVAAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+ND +F + L+   + Y+NDAF  +HRAHAS  G++    P+  G  M+KE
Sbjct: 120 NVRFFAEEEKNDTEFAKKLAALAEVYVNDAFGAAHRAHASTEGVTEYLKPNVAGHLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    ++++P DVV+A        T   S   +P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVQLLLPTDVVLADSFSPDAKTLTTSVNVIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A  +TV+WNGP+GVFE + F   T  VAH +A+L+ +    +I GGG
Sbjct: 300 IGPDSLKAFQAALADCKTVIWNGPMGVFEFDKFAAGTNGVAHTLAELSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|159901356|ref|YP_001547603.1| phosphoglycerate kinase [Herpetosiphon aurantiacus ATCC 23779]
 gi|229620379|sp|A9B312|PGK_HERA2 RecName: Full=Phosphoglycerate kinase
 gi|159894395|gb|ABX07475.1| Phosphoglycerate kinase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 394

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 166/399 (41%), Positives = 241/399 (60%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+    G R L+RVD+NVP     KV D TRI   +PTI  L+E+ A V++ S
Sbjct: 1   MNKQTIRDVA-WSGKRALVRVDFNVPLDQARKVTDDTRIRAALPTINYLLEQGASVILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K  ++  L  V    +S+L   + ++    G+    +  +L  G ++L EN R
Sbjct: 60  HLGRPKKKVAEEFRLKPVADHLQSLLDAPVNYIQTTTGAEAEAAAQALQAGQVLLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE NDP     L++ GD Y+NDAF  +HRAHAS  GL+  LP+  G  M+ EL+ L
Sbjct: 120 FDPREESNDPAMAEELAKLGDIYVNDAFGAAHRAHASTEGLAKFLPAVAGFLMEAELAAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                + ++P V I+GG+K+S KI ++ NL+ KVD L+IGGGMAN+FL+AQ   VG SL 
Sbjct: 180 GKALDDPQRPFVTIIGGAKISDKIGVIENLLGKVDSLLIGGGMANTFLLAQNKAVGASLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D      ++  EA+    ++++P DVVVA        TQV+S   VP    ILD+G +
Sbjct: 240 EADSVAEAGRLIDEAQGRGVKLLLPSDVVVADAFSAEANTQVLSIDDVPDGWRILDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T +   QV+++A+TV+WNGP+GVFE+EPF   T  VA  +A    +   I+I GGGD++ 
Sbjct: 300 TRQTYSQVVSEAKTVIWNGPMGVFELEPFAAGTRAVAQALA----DSSAITIIGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G++ + +++ST GGA LE LEGK LPGI AL+  
Sbjct: 356 AIEQMGLAEKMSHISTGGGASLELLEGKVLPGIAALNDK 394


>gi|114705100|ref|ZP_01438008.1| phosphoglycerate kinase [Fulvimarina pelagi HTCC2506]
 gi|114539885|gb|EAU43005.1| phosphoglycerate kinase [Fulvimarina pelagi HTCC2506]
          Length = 398

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 194/398 (48%), Positives = 277/398 (69%), Gaps = 2/398 (0%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+ + RT++D  D+ G R L+RVD+N+P  DGKV D TRI+R +PTI EL +K A+V++ 
Sbjct: 1   MTFQFRTIDD-ADVTGKRVLVRVDFNLPMKDGKVTDATRIDRALPTIAELADKGARVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+ K + + SL  +  +    L K + F +DCIG   +  I  L +G ++L EN 
Sbjct: 60  AHFGRPKGKPNPEMSLKPIAPVLSDRLGKPVGFADDCIGPVAAGIIEMLKDGDVVLLENT 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF++ EE N+ +F   L+  GD Y+NDAFS +HRAH S  G++H LPSY GR MQ E+  
Sbjct: 120 RFHAGEEANEAEFAESLASLGDIYVNDAFSAAHRAHGSTEGIAHHLPSYAGRTMQAEIEA 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L++     +KP+VAIVGGSKVSTKI +L NL+ +VD LVIGGGMAN+FL A+G+ +G+SL
Sbjct: 180 LQAGLEAPEKPVVAIVGGSKVSTKIDVLTNLLDRVDYLVIGGGMANTFLAAKGVDIGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ D +D    +   A+   CEI++P D VVAR +++G PT+ V  +  P D +ILD G 
Sbjct: 240 CEHDLADTARSVMSRAEEKGCEILLPTDAVVARHLRSGAPTETVPVEETPEDMMILDAGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +++ +   +  A+T++WNGPLG FE+EPFD ATV  A + A+LT+  +++SIAGGGDT+
Sbjct: 300 LSLKAVVARLDLAKTLVWNGPLGAFEVEPFDEATVGAARHAAELTRAGKLVSIAGGGDTV 359

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AL  AG+S++F+Y+STAGGAFLEW+EGK LPG+  L 
Sbjct: 360 AALNQAGVSDDFSYISTAGGAFLEWMEGKALPGVEVLK 397


>gi|240138954|ref|YP_002963429.1| phosphoglycerate kinase [Methylobacterium extorquens AM1]
 gi|240008926|gb|ACS40152.1| phosphoglycerate kinase [Methylobacterium extorquens AM1]
          Length = 400

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 203/396 (51%), Positives = 274/396 (69%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ +   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIADAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  ++S     L + + F  DC+G   + ++A+L +G ++L EN R
Sbjct: 61  HFGRPKGKPDPKDSLKPILSTLSDKLGRPVAFGEDCVGEAAASAVAALKDGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+NDPDF + L+ NGD Y+N+AFS +HRAHAS   L+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDPDFAKALAANGDIYVNEAFSAAHRAHASTEALARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V   +VP D++ILDVG  
Sbjct: 241 EKDLAETAKRILAAAKEKNCTIILPVDALVAREFKANAENETVPVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIEEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTKAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEAL 396


>gi|269837281|ref|YP_003319509.1| Phosphoglycerate kinase [Sphaerobacter thermophilus DSM 20745]
 gi|269786544|gb|ACZ38687.1| Phosphoglycerate kinase [Sphaerobacter thermophilus DSM 20745]
          Length = 394

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/398 (41%), Positives = 240/398 (60%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             +RT++DL D+ G R L+RVD+NVP  DG++ D TRI   +PTI  L E+ A +++ SH
Sbjct: 1   MPIRTLDDL-DVAGKRVLVRVDYNVPLDDGRITDDTRIRATLPTIQALRERGAAIILVSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V +    +L + + +  D +G       +SL  GG+ L ENVRF
Sbjct: 60  LGRPKGKVREELRLAPVAARLGELLGEPVKYARDVVGPEAQAMASSLQPGGVGLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
              EE NDP+F R L+   D Y+NDAF  +HRAHAS T ++ LLPS  G  MQ+E++ L 
Sbjct: 120 EPGEEANDPEFARQLASLADCYVNDAFGAAHRAHASTTAVADLLPSAAGLLMQREIAALT 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 + P   I+GG+KVS K+ ++ +L+ +VD L++GGGMAN+FL A+G  VGRSL +
Sbjct: 180 KVLESPEHPAALILGGAKVSDKVGVIEHLLDRVDLLLLGGGMANTFLKAEGFPVGRSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D        A+     +++P DVVVA  ++   PT++V  + V  D  I D+G +T
Sbjct: 240 DDKLDVARATLDRARERGVTVLLPVDVVVAPRLENDAPTRIVPVEQVGDDDAIYDIGPQT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V    + +  ARTV+WNGP+GVFE+  F   T  VA  VA         ++ GGGD++ A
Sbjct: 300 VARFAEALRSARTVVWNGPMGVFEVPAFAAGTRGVAEAVASC----EGFTLIGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G+++  +++ST GGA LE+LEGKDLPG+  L   
Sbjct: 356 VEQMGLADRVSHISTGGGASLEFLEGKDLPGVAVLRKK 393


>gi|170078194|ref|YP_001734832.1| phosphoglycerate kinase [Synechococcus sp. PCC 7002]
 gi|238692808|sp|B1XNQ1|PGK_SYNP2 RecName: Full=Phosphoglycerate kinase
 gi|169885863|gb|ACA99576.1| phosphoglycerate kinase [Synechococcus sp. PCC 7002]
          Length = 398

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 248/400 (62%), Gaps = 9/400 (2%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ +L   D+ G R  +RVD+NVP  + G + D TRI   +PTI  L EK AKV+
Sbjct: 1   MAK-KSVANLTEADLSGKRVFVRVDFNVPLNESGVITDDTRIRAALPTIKYLTEKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH+GRP+ +      L  V +    +L +++   +DC+G  ++Q+IA+L  G + L E
Sbjct: 60  LGSHMGRPKGQVVDSMRLTPVAARLSELLGQSVTKCDDCVGDAVNQAIANLGNGQVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N+RF   EE+NDP+F + L+ N D Y+NDAF  +HRAH S  G++H    S  G  ++KE
Sbjct: 120 NLRFNPGEEKNDPEFAKQLAANADIYVNDAFGTAHRAHGSTEGVTHHVDTSVAGLLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PLVAIVGGSKVS+KI ++  L++K DKL+IGGGM  +F  AQG  VG
Sbjct: 180 LQFLKGAIEAPKRPLVAIVGGSKVSSKIGVIETLLEKCDKLLIGGGMIFTFYKAQGKSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +A+    +I++P DV+VA +       + VS  ++P   + LD
Sbjct: 240 GSLVEDDKIDLAKSLMEKAQ---GKILLPTDVIVADKFAPDAEAKTVSVDAIPDGWMGLD 296

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  ++ +    T +WNGP+GVFE + F   T  +A  +A  T E   ++I GGG
Sbjct: 297 IGADSVKVFQEALDGCGTAIWNGPMGVFEFDKFAVGTEAIAKTLAGAT-ETGTVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK+LPGIVAL
Sbjct: 356 DSVAAVEKVGVADKMSHISTGGGASLELLEGKELPGIVAL 395


>gi|212696111|ref|ZP_03304239.1| hypothetical protein ANHYDRO_00647 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676740|gb|EEB36347.1| hypothetical protein ANHYDRO_00647 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 398

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 167/403 (41%), Positives = 252/403 (62%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVI 58
              +T+NDL ++ G + L+RVD+NVP     + ++AD TRI   +PTI  L+E  AKV++
Sbjct: 1   MNKKTVNDL-NVNGKKVLVRVDFNVPLSKENNEEIADDTRIRAALPTIDYLLENDAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVN--DCIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ ++  + +L  V    E+       F    + +   + + +A+L EG + L 
Sbjct: 60  MSHLGRPKGEAKPEFALKPVADWLENHYKDKFHFFPSPEVVDDKVKEEVANLKEGEVCLI 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+ + E +NDP+F + L+   D Y+NDAF  SHRAHAS  G++ +LPS +G  ++KE
Sbjct: 120 ENTRYVAGETKNDPEFAKKLASLADLYVNDAFGTSHRAHASNVGVASILPSAVGFLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           + ++       + P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 IDVMGKALEAPEHPFVSILGGAKVSDKIGVIENLITKVDTILIGGGMAYTFLKAQGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +A+ +  EI++P DVV+A E+K G  T++V   S+P D   LD
Sbjct: 240 KSLLEEDKMDLSLELIKKAEANNVEILLPVDVVIADEIKAGAETEIVDIDSIPEDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT E     I +A+TV+WNGP+GVFEI+ F   T +VA  +A    E   I+I GGG
Sbjct: 300 IGPKTAELFSSKIKEAKTVVWNGPMGVFEIKEFADGTNKVAAALA----ESDAITIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG+ ++ T+VST GGA LE+LEGK LPGI  +   
Sbjct: 356 DSALAIELAGLKDKITHVSTGGGASLEFLEGKTLPGIDCIDEK 398


>gi|323488682|ref|ZP_08093924.1| phosphoglycerate kinase [Planococcus donghaensis MPA1U2]
 gi|323397700|gb|EGA90504.1| phosphoglycerate kinase [Planococcus donghaensis MPA1U2]
          Length = 394

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 160/399 (40%), Positives = 242/399 (60%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M +  TM DL D++G R   RVD+NVP  +GKV D TRI   VPTI  LVE+ AKV++ S
Sbjct: 1   MQQKMTMKDL-DLKGKRVFCRVDFNVPMSEGKVTDDTRIRAAVPTIEYLVEQGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + +++  +         +LHK +  +N+ IG  + + I+S+ EG I+L ENVR
Sbjct: 60  HLGRPKGEVNEEMRIAATGVRLGELLHKEVKSLNESIGEEVEKEISSMQEGDIVLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+ND +  +  +   D ++NDAF  +HRAHAS  G++  LPS  G  ++KEL +L
Sbjct: 120 FHAGEEKNDEELSKAFASLADVFVNDAFGAAHRAHASTAGIASHLPSVSGLLLEKELDVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               SE  +P  AI+GG+KV  KI ++ +L+ KVD L+IGGG++ +F+ AQG  +G SL 
Sbjct: 180 GKALSEPDRPFTAIIGGAKVKDKIGVIDHLLDKVDNLIIGGGLSYTFIKAQGYEIGDSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D  +    +AK+   +  +P D  VA E      T+ V    +P D + LD+G +
Sbjct: 240 EEDKLDLANSFIEKAKQKGVKFYLPVDATVANEFSKDAETKSVKITEIPADWMGLDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV     VI  ++ ++WNGP+GVFE+  F+  T  VA  +A    E    ++ GGGD+  
Sbjct: 300 TVALYSDVIKNSKLIIWNGPMGVFEMPAFENGTKSVAKAMA----ETSGYTVIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+    ++ +  ++ST GGA LE++EGKDLPG+ AL+  
Sbjct: 356 AVEKFDVAEKMDHISTGGGASLEFMEGKDLPGVSALTDK 394


>gi|294786906|ref|ZP_06752160.1| phosphoglycerate kinase [Parascardovia denticolens F0305]
 gi|315226541|ref|ZP_07868329.1| phosphoglycerate kinase [Parascardovia denticolens DSM 10105]
 gi|294485739|gb|EFG33373.1| phosphoglycerate kinase [Parascardovia denticolens F0305]
 gi|315120673|gb|EFT83805.1| phosphoglycerate kinase [Parascardovia denticolens DSM 10105]
          Length = 398

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 146/398 (36%), Positives = 224/398 (56%), Gaps = 6/398 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI   +PTI EL +  AKV++ +HLG
Sbjct: 1   MKTLEDLGDLKGKRVLVRADFNVPLDGTTITDDGRIRAALPTITELRKDGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V S    +L+  +    D  G      + ++ +G ++L ENVRF  
Sbjct: 61  RPKGQVVPELSLAPVASRLSELLNAPVALAKDTYGPDAHAKVDAMQDGDVVLLENVRFNP 120

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D      + + ++  GD +++D F V HRA  S   ++  LPS  GR ++KE++ 
Sbjct: 121 EETSKDEAERSAYAKKIAELGDVFVSDGFGVVHRAQGSDYDVAADLPSAAGRLVEKEVAA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A G   G+SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVISNLLDKADRLVIGGGMVFTFLKALGYETGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D      +    AK++  EI++P D+V A       P +VV A  +P D + LD+G 
Sbjct: 241 LEEDMVAQAKEYLETAKKNGVEIVLPADIVAADAFAADSPYEVVDADKIPADKMGLDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ +     I  ++TV+WNGP+GVFE   F + T  VA  +   +K     SI GGGD+ 
Sbjct: 301 RSQKLFHDKIVDSKTVVWNGPMGVFEFPEFAKGTAAVAQALIDSSK-NGAFSIVGGGDSA 359

Query: 360 TALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G   + F+++ST GGA LE+LEGK LPG+  L
Sbjct: 360 AAVRRLGFDEDGFSHISTGGGASLEFLEGKALPGLSVL 397


>gi|118481158|gb|ABK92531.1| unknown [Populus trichocarpa]
          Length = 401

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 249/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DV+VA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|224101333|ref|XP_002312237.1| predicted protein [Populus trichocarpa]
 gi|222852057|gb|EEE89604.1| predicted protein [Populus trichocarpa]
          Length = 401

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 248/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DV+VA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  ++    + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSITTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|153941441|ref|YP_001389590.1| phosphoglycerate kinase [Clostridium botulinum F str. Langeland]
 gi|166219320|sp|A7G9Y0|PGK_CLOBL RecName: Full=Phosphoglycerate kinase
 gi|152937337|gb|ABS42835.1| phosphoglycerate kinase [Clostridium botulinum F str. Langeland]
 gi|295317686|gb|ADF98063.1| phosphoglycerate kinase [Clostridium botulinum F str. 230613]
          Length = 398

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/403 (36%), Positives = 242/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+ K AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMGKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        V   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVVTEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKSFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|216263892|ref|ZP_03435886.1| phosphoglycerate kinase [Borrelia afzelii ACA-1]
 gi|215979936|gb|EEC20758.1| phosphoglycerate kinase [Borrelia afzelii ACA-1]
          Length = 393

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 160/397 (40%), Positives = 253/397 (63%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFNSFAGKRVLVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L++++   +DCIGS +  +   + +G ++L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANRLSELLNQDVKMFSDCIGSEIVNNTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD +++DAF  +HRAHAS  G+S  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVSDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 +KP V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 EVLKNPEKPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLYSKGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 SEYIDTASSFLRKAKELGVKVILPLDHIVADDFNKNSTPEYIDSLNIPENKIGMDIGVNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|297583418|ref|YP_003699198.1| phosphoglycerate kinase [Bacillus selenitireducens MLS10]
 gi|297141875|gb|ADH98632.1| Phosphoglycerate kinase [Bacillus selenitireducens MLS10]
          Length = 394

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/398 (39%), Positives = 246/398 (61%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  +G+V D TRI   +PTI  LVEK AKV++ SH
Sbjct: 1   MNKQSIRDI-DVKGKRVFCRVDFNVPMSEGQVTDDTRIRAAIPTIELLVEKGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +  +D  L  V      ++ K +  V++ +GS   +++  L EG ++L ENVRF
Sbjct: 60  LGRPKGQVAEDLRLDPVAKRLSDLMQKEVYKVDEVVGSDAEKAVNGLEEGDVVLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
            + EE+ND +  + ++   D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L 
Sbjct: 120 EAGEEKNDAELAKQMAALADVYVNDAFGAAHRAHASTEGIAKHIPAVAGLLMEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A+G  +G SL +
Sbjct: 180 KAMANPERPFTAIIGGAKVKDKIGVIDNLLDKVDNLIIGGGLAYTFIKAKGYEIGTSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   Q   +A+++     +P D V+A+E    +    V    +P D + LD+G KT
Sbjct: 240 EDKIDLAKQFMEKAEKNNVNFYMPVDAVIAKEFGADVEADTVDIDKIPADQMSLDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E  ++VI+++R V+WNGP+GVFE E F   T  VA     L +     S+ GGGD+  A
Sbjct: 300 LETYRKVISESRLVIWNGPMGVFEFEKFAAGTKGVA---EALAEAENAYSVIGGGDSAAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +    ++++ +++ST GGA LE++EGK+LPG+VAL+  
Sbjct: 357 VEKFHLADKMSHISTGGGASLEFIEGKELPGVVALNDK 394


>gi|325846704|ref|ZP_08169619.1| phosphoglycerate kinase [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325481462|gb|EGC84503.1| phosphoglycerate kinase [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 398

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/403 (38%), Positives = 246/403 (61%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI---DGKVADVTRIERVVPTILELVEKKAKVVI 58
              +T+ DL ++ G R L+RVD+NVP     +  ++D TRI+  +PTI  L+E  AKV++
Sbjct: 1   MNKKTVKDL-NVDGKRVLVRVDFNVPLSKDGNNTISDDTRIKAALPTIDYLLENNAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILF--VNDCIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ ++  + SL  V +  E        F   +  +   + +  + L+ G + L 
Sbjct: 60  MSHLGRPKGEAKPEFSLKPVANWLEKHYGDKFHFIPSDTVVDEKVKEEASKLNNGELALL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+ + E +NDP+F + LS   D ++NDAF  SHRAH+S  G++  L S +G  ++KE
Sbjct: 120 ENTRYVAGETKNDPEFAKELSSLADLFVNDAFGTSHRAHSSNVGVASNLESAVGFLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           + ++       ++P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 IEIMGKALENPERPFVSILGGAKVSDKIGVIENLISKVDYILIGGGMAYTFLKAQGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +A+ +  +I++P+DVV+A E+K    T++V   ++P D   LD
Sbjct: 240 KSLLEEDKMDLSLELIKKAEANNVKILLPKDVVIADEIKDDAETEIVDIDNIPTDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G +T +    +I  A+TV+WNGP+GVFE++ F   T EVA  +A    +    +I GGG
Sbjct: 300 IGPETAKEYADIIKDAKTVVWNGPMGVFEVKVFANGTNEVAKALA----DSSATTIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG  ++ T+VST GGA LE+LEGK LPGI  +   
Sbjct: 356 DSALAIEQAGFKDKITHVSTGGGASLEFLEGKTLPGIDCIDEK 398


>gi|126695553|ref|YP_001090439.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9301]
 gi|166987794|sp|A3PAR3|PGK_PROM0 RecName: Full=Phosphoglycerate kinase
 gi|126542596|gb|ABO16838.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9301]
          Length = 402

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/401 (38%), Positives = 248/401 (61%), Gaps = 5/401 (1%)

Query: 1   MSRLRTMN--DLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+L +++  D   + G + L+RVD+NVP   DG++ D TRI   +PTI  LV   AKV+
Sbjct: 1   MSKL-SLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLVNHSAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L +++   N CIG        SLS   ++L E
Sbjct: 60  LAAHFGRPKGQVNEKMRLTPVAARLSELLGQSVALTNSCIGDEAVAKSNSLSNRDVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+ND +F + L+ + D Y+NDAF  +HRAHAS  G+++   PS  G  ++KE
Sbjct: 120 NVRFFGEEEKNDLEFAQKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+       +PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAVDSPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIMIGGGMIFTFYKARGLDVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DVV+A E      +++    S+  + + LD
Sbjct: 240 KSLVEEDKLELAKDLEAKAKAKGVELLLPTDVVLANEFSPDAESKISQIDSISGNWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A+ +T++WNGP+GVFE + F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPDSIKVFQNALAECKTIIWNGPMGVFEFDKFADGTNAIATTLADLSAFSEVCTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL+
Sbjct: 360 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKILPGVAALN 400


>gi|187934425|ref|YP_001887251.1| phosphoglycerate kinase [Clostridium botulinum B str. Eklund 17B]
 gi|238691658|sp|B2TPX4|PGK_CLOBB RecName: Full=Phosphoglycerate kinase
 gi|187722578|gb|ACD23799.1| phosphoglycerate kinase [Clostridium botulinum B str. Eklund 17B]
          Length = 396

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/401 (38%), Positives = 238/401 (59%), Gaps = 10/401 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +T+ D++ ++G + L+R D+NVP  DG + D  R+   +PTI  LVE  AKV++ 
Sbjct: 1   MNFNKKTIEDIQ-VKGKKVLVRCDFNVPLKDGVITDENRLNGALPTIKYLVENGAKVILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIG--STLSQSIASLSEGGIILAE 117
           SH+G+P+ +   + SL  V      +L K I F  D          ++A + +G ++L E
Sbjct: 60  SHMGKPKGEPKPELSLAPVAKRLSELLGKEIKFAPDNTVVGENAKAAVAEMKDGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKE 176
           N R+  EE +N  +F + L+   + ++NDAF  +HRAH S  G++  + +   G  +QKE
Sbjct: 120 NTRYRKEETKNGEEFSKELASLAEIFVNDAFGTAHRAHCSTVGVTDYIDTAVCGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +     +KP VAI+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 LKFLGNAVETPEKPFVAILGGAKVSDKIAVINNLLDKVDTIIIGGGMAYTFLKAQGYEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D   ++  +A+  + + ++P D  VA E K  +   V + Q++P  ++ LD
Sbjct: 240 TSLVEEDRLDYAKEMIAKAEEKSVKFLLPVDHRVAAEFKD-VEATVTNDQNIPTGNMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT       I  A+TV+WNGP+GVFE E F++ T+ VA  +A    +    +I GGG
Sbjct: 299 IGPKTETVYANAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMA----DSNATTIIGGG 354

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+  A+   G  ++ T++ST GGA LE+LEGK LPGI AL+
Sbjct: 355 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKVLPGISALN 395


>gi|253578499|ref|ZP_04855771.1| phosphoglycerate kinase [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850817|gb|EES78775.1| phosphoglycerate kinase [Ruminococcus sp. 5_1_39BFAA]
          Length = 397

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 140/402 (34%), Positives = 233/402 (57%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  DGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLQDGKITDENRLVAALPTIKKLIADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++A + +G +IL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAKRLSELLGQEVKFAADPEVVGPNAKAAVAEMKDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGDEFSKELASLCDVFVNDAFGTAHRAHCSNVGVTKYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  +G 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMSYTFSKAMGGHIGT 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+      +  +A+    ++++P D  +          QVV    +P     +D+
Sbjct: 240 SLCEDDYLQYALDMMKKAEDKGVKLLLPVDNRIGDNFSNDCNIQVVKRGEIPDGWEGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    E    +I GGGD
Sbjct: 300 GPETEKLFADAVKDAKTVVWNGPMGCFEMPNFAHGTEAVAKALA----ETDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNILGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|158333828|ref|YP_001515000.1| phosphoglycerate kinase [Acaryochloris marina MBIC11017]
 gi|189036805|sp|B0CD95|PGK_ACAM1 RecName: Full=Phosphoglycerate kinase
 gi|158304069|gb|ABW25686.1| phosphoglycerate kinase [Acaryochloris marina MBIC11017]
          Length = 401

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 169/400 (42%), Positives = 248/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +T+ +L   D+ G R L+R D+NVP   DGK+ D TRI   +PTI +L  K AKV+
Sbjct: 1   MSK-KTIANLTSADLSGKRVLVRADFNVPLDGDGKITDDTRIRAALPTIQDLTSKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+ + ++   L  V +    +L + +   +DCIG  ++  + +L  G + L E
Sbjct: 60  LASHFGRPKGQVNESMRLTPVAARLSELLGQAVTKCDDCIGDEVAAKVGALQNGQVALLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+S EE NDP+F R L+   D Y+NDAF  +HRAHAS  G++H   PS  G  ++KE
Sbjct: 120 NVRFHSGEEANDPEFARQLASVADLYVNDAFGTAHRAHASTEGVTHHLSPSVAGYLIEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AIVGGSKVS+KI ++  L+ KVDKL+IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQAAIEGPQRPLAAIVGGSKVSSKIGVIETLLDKVDKLLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D    +  +AK     +++P DVVVA         Q VS  ++P   + LD
Sbjct: 240 KSLVEEDKLDLARTLEAKAKEKGVALLLPSDVVVADNFAADANAQTVSINNIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  ++  +TV+WNGP+GVFE + F   T  VAH +A +T E    +I GGG
Sbjct: 300 IGPNSVKEFQAALSDCKTVIWNGPMGVFEFDKFAAGTDAVAHSLAAIT-ETGADTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPGI AL
Sbjct: 359 DSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAAL 398


>gi|111114877|ref|YP_709495.1| phosphoglycerate kinase [Borrelia afzelii PKo]
 gi|122956431|sp|Q0SPA9|PGK_BORAP RecName: Full=Phosphoglycerate kinase
 gi|110890151|gb|ABH01319.1| phosphoglycerate kinase [Borrelia afzelii PKo]
          Length = 393

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 160/397 (40%), Positives = 253/397 (63%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFNSFAGKRVLVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L++++   +DCIGS +  +   + +G ++L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANRLSGLLNQDVKMFSDCIGSEIVNNTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD +++DAF  +HRAHAS  G+S  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVSDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 +KP V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 EVLKNPEKPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLYSKGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 SEYIDTASSFLRKAKELGVKVILPLDHIVADDFNKNSTPEYIDSLNIPENKIGMDIGVNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|219685334|ref|ZP_03540153.1| phosphoglycerate kinase [Borrelia garinii Far04]
 gi|219673107|gb|EED30127.1| phosphoglycerate kinase [Borrelia garinii Far04]
          Length = 393

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 252/397 (63%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L EK A++V+ SH
Sbjct: 1   MSIKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L +++  ++DCIGS +  +   + +G ++L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGSEIVNNTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 EVLKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + +  +P + I +DVG  T
Sbjct: 241 SEYIDVASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEYIDSFDIPENKIGMDVGGNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++VI  A+T++WNGPLGVFE + F + T +VA  VA  +     ++I GGGD++ A
Sbjct: 301 LKEIEKVIKTAKTIIWNGPLGVFEFDSFAKGTAKVAEMVASCSG----LTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|170760450|ref|YP_001785558.1| phosphoglycerate kinase [Clostridium botulinum A3 str. Loch Maree]
 gi|238688506|sp|B1KTJ5|PGK_CLOBM RecName: Full=Phosphoglycerate kinase
 gi|169407439|gb|ACA55850.1| phosphoglycerate kinase [Clostridium botulinum A3 str. Loch Maree]
          Length = 398

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 146/403 (36%), Positives = 238/403 (59%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ D+ D++  + L+R D+NVP  +GK+ D  R+   +PT+  L+EK AK+++ 
Sbjct: 1   MNYNKKSIEDI-DVKSKKVLVRCDFNVPLNEGKITDENRLVGALPTVKYLMEKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G I+L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVVFADDDNVVGENAKKAVEDMKDGDIVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G++H    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEIFSKELASLADVFVNDAFGTAHRAHCSTVGVTHYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +     ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL + G  VG
Sbjct: 180 LKFLGNAVETPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKSLGYTVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK      ++P D+ +A          V   Q+V    + LD
Sbjct: 240 DSLLEEDKVEYAKEMINKAKEKGVNFLLPVDITIADRFDKDAEPIVTEDQNVKEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGSKTAKIYADAIKSAKTVIWNGPMGVFEFKNFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ +++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNIFGFGDKMSHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|297588468|ref|ZP_06947111.1| phosphoglycerate kinase [Finegoldia magna ATCC 53516]
 gi|297573841|gb|EFH92562.1| phosphoglycerate kinase [Finegoldia magna ATCC 53516]
          Length = 395

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 243/397 (61%), Gaps = 7/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ DL ++   R L+RVD+NVP  DG + D  RIE  + TI  L++  AKV++ SH
Sbjct: 1   MNKKTLKDL-NVENKRVLVRVDFNVPIKDGIITDTNRIEASIATIKYLIDNNAKVILMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ +   + SL  V      IL + + FV++   + +++ +    L    I+L +N 
Sbjct: 60  LGRPKGEPKPEFSLKPVAEKLSEILGQEVKFVDNDKVVDNSVIEQSKQLQPKEIMLIQNT 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           R+  EEE+ND +F + LS+  D Y+NDAF  SHRAHAS  G+S  LPS +G  +QKE+ +
Sbjct: 120 RYRKEEEKNDEEFSKELSQLADLYVNDAFGTSHRAHASNVGVSKFLPSAVGFLVQKEIEI 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +     + ++P  AI+GG+KVS KI ++ NL++KVD ++IGG MA +F+ +QG  VG+SL
Sbjct: 180 MGKALEDPERPFTAILGGAKVSDKIGVIENLLEKVDTILIGGAMAYTFIKSQGKNVGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D    +  +A+    +I +P D V A+EM     ++V+       D    D+G 
Sbjct: 240 IEEDKLDLAKSLLEKAQEKGVKIFLPVDFVAAKEMTEESDSKVIGVDEFTDDIAGFDIGT 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++   + I +++TV+WNGP+GVFEI+ F + T EVA+ + K        +I GGGD+ 
Sbjct: 300 KTIKIFDEEIQKSKTVVWNGPMGVFEIKQFSKGTFEVANSLVK----SDATTIVGGGDSA 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+A +G  ++ T+VST GGA LE+LEGK LPGI  +
Sbjct: 356 SAIAKSGNKDKVTHVSTGGGASLEFLEGKVLPGIDCI 392


>gi|188581576|ref|YP_001925021.1| phosphoglycerate kinase [Methylobacterium populi BJ001]
 gi|259530778|sp|B1Z980|PGK_METPB RecName: Full=Phosphoglycerate kinase
 gi|179345074|gb|ACB80486.1| Phosphoglycerate kinase [Methylobacterium populi BJ001]
          Length = 400

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 200/399 (50%), Positives = 275/399 (68%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D   ++G R LLRVD NVP   G+V D TRIERVVPTI E+ E   +V++ +
Sbjct: 1   MTDFRTLDDAGPLQGKRVLLRVDLNVPMEGGRVTDATRIERVVPTIREIAEAGGRVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +   SL  ++      L + + F  DC+G   ++++A+L +G ++L EN R
Sbjct: 61  HFGRPKGKPEPKDSLKPILPTLSEKLGRPVAFGEDCVGEAAAKAVAALKDGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+N P+F + L+ NGD Y+N+AFS +HRAHAS  GL+ LLP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNAPEFAQALAANGDLYVNEAFSAAHRAHASTEGLARLLPAYAGRLMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLEAPARPVIAIVGGAKVSTKIDLLENLVAKVDMLVIGGGMANTFLHAQGKDVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   AK   C II+P D +VARE K     + V+  +VP D++ILDVG  
Sbjct: 241 EKDLAETAQRILAAAKEKNCTIILPADALVAREFKANAENETVTVDAVPSDAMILDVGAS 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++  I   I +ART++WNGPLG FE+ PFD  TV VA + A+ T+  +++S+AGGGDT+ 
Sbjct: 301 SIATIDGAIDEARTLVWNGPLGAFELTPFDTGTVAVAQHAARRTRAGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           AL HAG+  +F+YVSTAGGAFLEWLEGK+LPG+ AL   
Sbjct: 361 ALNHAGVGEDFSYVSTAGGAFLEWLEGKELPGVEALRAK 399


>gi|3738259|dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
          Length = 401

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 247/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPT+  L++  A+V+
Sbjct: 1   MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTVKYLMDHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   NDCIG  + + +A +  GG++L E
Sbjct: 61  LCSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF+ EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDFLFLGGGMIFTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +A+    ++++P DVVVA +  +   ++VV A  +    + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKARVKGVKLLLPTDVVVADKFASDANSKVVPASEIADGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|297736144|emb|CBI24182.3| unnamed protein product [Vitis vinifera]
          Length = 405

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 251/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +RVD NVP  D  K+ D TR+   +PTI  L++  AKV+
Sbjct: 1   MAK-KSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   I+  +DCIG  + + + +L +GG++L E
Sbjct: 60  LSSHLGRPKG-VTPKFSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 119 NVRFYKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 179 LDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D       +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 239 SSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE + F   TV VA  +A+L+  + + +I GGG
Sbjct: 299 IGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKKLAELSG-KDVTTIIGGG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 358 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 397


>gi|225464995|ref|XP_002263796.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
 gi|147843756|emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
          Length = 478

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 251/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +RVD NVP  D  K+ D TR+   +PTI  L++  AKV+
Sbjct: 74  MAK-KSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVI 132

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   I+  +DCIG  + + + +L +GG++L E
Sbjct: 133 LSSHLGRPKG-VTPKFSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLE 191

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 192 NVRFYKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 251

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 252 LDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 311

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D       +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 312 SSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLD 371

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE + F   TV VA  +A+L+  + + +I GGG
Sbjct: 372 IGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKKLAELSG-KDVTTIIGGG 430

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 431 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 470


>gi|102139814|gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
          Length = 401

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 167/401 (41%), Positives = 246/401 (61%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  +++  L   D++G +  +RVD NVP  +  KV D TRI   VPTI  L+E+ A+++
Sbjct: 1   MATKKSVGALTEADLKGKKVFVRVDLNVPLDENLKVTDDTRIRASVPTIKYLMERGARII 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  VV     +L  N+   NDCIG  + + I++L +GG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPVVPRLSELLGVNVAMANDCIGVEVEKLISALPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  KKP  AIVGGSKVSTKI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVSNPKKPFAAIVGGSKVSTKIGVMESLLEKVDILILGGGMIFTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVVVA +      +++V A  +P   + LD
Sbjct: 240 SSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAESKIVPASGIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++     +   +T++WNGP+GVFE E F   T  +A  +A L+    + +I GGG
Sbjct: 300 IGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAIAKKLADLSG-SGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL 
Sbjct: 359 DSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVLALE 399


>gi|119025853|ref|YP_909698.1| phosphoglycerate kinase [Bifidobacterium adolescentis ATCC 15703]
 gi|154487304|ref|ZP_02028711.1| hypothetical protein BIFADO_01149 [Bifidobacterium adolescentis
           L2-32]
 gi|189036809|sp|A1A1N3|PGK_BIFAA RecName: Full=Phosphoglycerate kinase
 gi|118765437|dbj|BAF39616.1| phosphoglycerate kinase [Bifidobacterium adolescentis ATCC 15703]
 gi|154083822|gb|EDN82867.1| hypothetical protein BIFADO_01149 [Bifidobacterium adolescentis
           L2-32]
          Length = 401

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 144/401 (35%), Positives = 233/401 (58%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKALREQGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   +    D  G      +A++S+G ++L +NVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGITVPLAADTYGEDAQAKVAAMSDGDVVLLQNVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP+    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDPEERAAYAKKIAALGEVFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL  ++GGSKVS K+ ++ NL+ K ++LVIGGGMA +FL A+G  VG SL
Sbjct: 181 LSRATVNPERPLTVVLGGSKVSDKLGVIDNLLDKANRLVIGGGMAYTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP---TQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVV+             +VV+A ++P D + LD
Sbjct: 241 LEEDQIETVKGYMERAEKNGVELVLPTDVVINPVFPKSDEDIAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPTFAEGTKAVAQALVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|302840184|ref|XP_002951648.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
 gi|11134148|sp|Q9SBN4|PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|5902588|gb|AAD55564.1|AF110782_1 phosphoglycerate kinase precursor [Volvox carteri f. nagariensis]
 gi|300263257|gb|EFJ47459.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
          Length = 462

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 171/400 (42%), Positives = 253/400 (63%), Gaps = 6/400 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKVVIFS 60
           +++ DL   D+ G R  +R D NVP       + D TRI   VPT+  L++  AKV++ S
Sbjct: 64  KSVGDLGKADLEGKRVFVRADLNVPLDKKTLAITDDTRIRAAVPTLKYLLDNGAKVLLTS 123

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +    L  VV+    +L K +  V+DCIG ++ Q++ASL  G ++L ENVR
Sbjct: 124 HLGRPKGGPEDKYRLTPVVARLSELLGKEVKKVDDCIGPSVEQAVASLKSGELLLLENVR 183

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           FY EEE+NDP+F + L+ N D Y+NDAF  +HRAHAS  G++    PS  G  +QKEL  
Sbjct: 184 FYKEEEKNDPEFAKKLASNADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDY 243

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+   S  K+P VAIVGGSKVS+KIT++  L++K DK++IGGGM  +F  A+G+ VG SL
Sbjct: 244 LDGAVSAPKRPFVAIVGGSKVSSKITVIEKLMEKCDKIIIGGGMIFTFYKARGLKVGSSL 303

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +    +   AK    ++++P DVVVA +      TQ VS +++P   + LD+G 
Sbjct: 304 VEEDKLELAKNLEAIAKAKGVQLLLPSDVVVADKFDANANTQTVSVEAIPDGWMGLDIGP 363

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +++  +  +A A+TV+WNGP+GVFE   F   TV +A+ +++LT  +  I+I GGGD++
Sbjct: 364 DSIKTFQDALADAKTVVWNGPMGVFEFPKFAVGTVAIANTLSELTP-KGAITIIGGGDSV 422

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+  AG++ + +++ST GGA LE LEGK LPG+ AL   
Sbjct: 423 AAVEQAGVAEKMSHISTGGGASLELLEGKVLPGVAALDEK 462


>gi|160881004|ref|YP_001559972.1| phosphoglycerate kinase [Clostridium phytofermentans ISDg]
 gi|160429670|gb|ABX43233.1| Phosphoglycerate kinase [Clostridium phytofermentans ISDg]
          Length = 397

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 151/402 (37%), Positives = 248/402 (61%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G R L+R D+NVP  +GK+ D TR+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKRVLVRCDFNVPLQEGKITDDTRLVAALPTIKKLINDGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L K + F  D   +G     ++A++++G ++L EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAEALAKLLSKEVKFAADATVVGENAKAAVAAMNDGDVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKELASLCDVFVNDAFGTAHRAHCSNVGITQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +   +PLVAI+GGSKVS+KI+++ NL+ KVD L+IGGGMA +F+ A G  VG 
Sbjct: 180 DFLGNAVNNPVRPLVAILGGSKVSSKISVINNLLDKVDTLIIGGGMAYTFMKALGEEVGN 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ D   ++  +AK++   +++P D VVA+E     P+++V    +  D   LD+
Sbjct: 240 SLLEADYIDYAKEMMEKAKKNGVNLLLPIDTVVAKEFSNDAPSRIVGRGEIEADEEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E     +  A+TV+WNGP+GVFE+  + + T+ VA  +A +       +I GGGD
Sbjct: 300 GPKTCELYADALKSAKTVVWNGPMGVFEMSNYAKGTIAVAQAMADI----DATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ +++ST GGA LE+LEGK+LPG+VA +  
Sbjct: 356 SAAAVNQLGFGDKMSHISTGGGASLEFLEGKELPGVVAANDK 397


>gi|300863560|ref|ZP_07108506.1| Phosphoglycerate kinase [Oscillatoria sp. PCC 6506]
 gi|300338427|emb|CBN53648.1| Phosphoglycerate kinase [Oscillatoria sp. PCC 6506]
          Length = 399

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 168/399 (42%), Positives = 251/399 (62%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +T+ +L   D+ G R L+R D+NVP  +G + D TRI   +PTI +L  K AKV++
Sbjct: 1   MTK-KTLANLSASDLSGKRVLVRADFNVPLDNGNITDDTRIRAALPTIEDLTSKGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP+  SDK   L  V +    +L K +   +DCIG  ++  +A++ +G +IL EN
Sbjct: 60  CSHFGRPKGVSDK-LRLTPVAARLSELLGKEVKKPSDCIGEEVAGVVAAMQDGDVILLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           VRFY EEE NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G+ ++KEL
Sbjct: 119 VRFYPEEEANDPEFAKNLASVADLYVNDAFGTAHRAHASTEGVTKYLSPSVAGKLIEKEL 178

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      ++PL AI+GGSKVS+KI ++  L++K DKL++GGGM  +F  A+G+ VG+
Sbjct: 179 EYLQGAIENPQRPLAAIIGGSKVSSKIGVIEKLLEKCDKLILGGGMVFTFYKARGLNVGK 238

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK      ++P DVVVA +      TQ+VS +++P   + LD+
Sbjct: 239 SLVEDDKLELAKSLEAKAKERGVTFLLPTDVVVADKFAADANTQIVSVEAIPDGWMGLDI 298

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +V+  +  +A  +TV+WNGP+GVFE+E F   T  +A  +A LTK     +I GGGD
Sbjct: 299 GPDSVKTFQDALADCKTVIWNGPMGVFEMEKFAAGTEGIARTLAGLTK-TGTSTIIGGGD 357

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+    +  E +++ST GGA LE LEGK+LPGI AL
Sbjct: 358 SVAAVEMLDLGAEMSHISTGGGASLELLEGKELPGIAAL 396


>gi|95930091|ref|ZP_01312830.1| Phosphoglycerate kinase [Desulfuromonas acetoxidans DSM 684]
 gi|95133785|gb|EAT15445.1| Phosphoglycerate kinase [Desulfuromonas acetoxidans DSM 684]
          Length = 396

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 236/388 (60%), Gaps = 6/388 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           ++ G R   RVD+NVP    + + D TRI   +PTI  ++E+  K+++ SHLGRP+    
Sbjct: 11  ELTGKRVFCRVDFNVPLDSAQTITDDTRIVAALPTIRYIIEQGGKLILASHLGRPKGSFK 70

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
            + SL  V      +L + +    DC+G  +   IA++++G ++L EN+RFY  EE+NDP
Sbjct: 71  PESSLAPVAPYLSKLLDQPVTMAKDCVGDEVKAQIAAMNDGDVLLLENMRFYPGEEKNDP 130

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSH-LLPSYIGRAMQKELSMLESCFSESKK 189
            F   L+   D Y+NDAF  +HRAHAS  G++  L P+  G  M KEL  L       K+
Sbjct: 131 AFCAELAELADIYVNDAFGTAHRAHASTEGIARLLQPAAAGFLMAKELEYLGQALDAPKR 190

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  A++GG+KVS KIT++  L+ KV+ L+IGGGMA +FL AQG+ +G SL + D  D   
Sbjct: 191 PFAAVIGGAKVSDKITVIDTLLDKVNALLIGGGMAYTFLKAQGVEIGTSLVEIDQLDLAR 250

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           ++  +A+++  E+++P D V A+         V + ++ P + + LD+G +T +     +
Sbjct: 251 ELMAKAEKNGVELMLPVDHVTAKAFDKEAAASVYTNEAFPTNEMGLDIGPQTAQAYAAKM 310

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
            +A TV+WNGP+GVFE   F + T  VA  +AK       ISI GGGD++ A+  AG+++
Sbjct: 311 TEAATVVWNGPMGVFEFPAFAKGTFAVAEALAK----SDAISIIGGGDSVAAVNQAGLND 366

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + T++ST GGA LE+LEGK LPGI AL+
Sbjct: 367 QMTHISTGGGASLEFLEGKTLPGIAALT 394


>gi|18310285|ref|NP_562219.1| phosphoglycerate kinase [Clostridium perfringens str. 13]
 gi|110799767|ref|YP_695953.1| phosphoglycerate kinase [Clostridium perfringens ATCC 13124]
 gi|168207662|ref|ZP_02633667.1| phosphoglycerate kinase [Clostridium perfringens E str. JGS1987]
 gi|168211757|ref|ZP_02637382.1| phosphoglycerate kinase [Clostridium perfringens B str. ATCC 3626]
 gi|168215121|ref|ZP_02640746.1| phosphoglycerate kinase [Clostridium perfringens CPE str. F4969]
 gi|168218200|ref|ZP_02643825.1| phosphoglycerate kinase [Clostridium perfringens NCTC 8239]
 gi|169343213|ref|ZP_02864228.1| phosphoglycerate kinase [Clostridium perfringens C str. JGS1495]
 gi|182626604|ref|ZP_02954350.1| phosphoglycerate kinase [Clostridium perfringens D str. JGS1721]
 gi|21263803|sp|Q8XKU0|PGK_CLOPE RecName: Full=Phosphoglycerate kinase
 gi|123049839|sp|Q0TQY7|PGK_CLOP1 RecName: Full=Phosphoglycerate kinase
 gi|18144965|dbj|BAB81009.1| phosphoglycerate kinase [Clostridium perfringens str. 13]
 gi|110674414|gb|ABG83401.1| phosphoglycerate kinase [Clostridium perfringens ATCC 13124]
 gi|169298672|gb|EDS80751.1| phosphoglycerate kinase [Clostridium perfringens C str. JGS1495]
 gi|170660998|gb|EDT13681.1| phosphoglycerate kinase [Clostridium perfringens E str. JGS1987]
 gi|170710270|gb|EDT22452.1| phosphoglycerate kinase [Clostridium perfringens B str. ATCC 3626]
 gi|170713467|gb|EDT25649.1| phosphoglycerate kinase [Clostridium perfringens CPE str. F4969]
 gi|177908084|gb|EDT70657.1| phosphoglycerate kinase [Clostridium perfringens D str. JGS1721]
 gi|182379786|gb|EDT77265.1| phosphoglycerate kinase [Clostridium perfringens NCTC 8239]
          Length = 397

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 149/403 (36%), Positives = 240/403 (59%), Gaps = 10/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +T+ D++ ++G + L+R D+NVP  DG + D  R+   +PTI  LV+  AKV++ 
Sbjct: 1   MNFNKKTIEDVQ-VKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ ++  + SL  V      +L K ++F  D   +G    +++A + +G ++L +
Sbjct: 60  SHMGKPKGEAKPEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKE 176
           N R+  EE +N  +  + L+   + ++NDAF  +HRAH S  G++  L     G  +QKE
Sbjct: 120 NTRYRKEETKNGEELSKELASLAEMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L       ++P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  VG
Sbjct: 180 LKFLGDAVETPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +A+    ++++P D  VA+E K  +   V   Q++    + LD
Sbjct: 240 SSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKD-VEAVVTEDQNIAEGFMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT     + I  A+TV+WNGP+GVFE E F++ T+ VA  +A+        +I GGG
Sbjct: 299 IGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEA----DATTIIGGG 354

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ +++ST GGA LE+LEGK LPGI AL+  
Sbjct: 355 DSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK 397


>gi|129915|sp|P12782|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|21833|emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 gi|3293043|emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
          Length = 480

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 245/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D+ G R L+R D NVP  D + + D TRI   +PTI  L+   AKV+
Sbjct: 73  MAK-KSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVI 131

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +    D IG  + + +A L+ G ++L E
Sbjct: 132 LTSHLGRPKG-VTPKFSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLE 190

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D ++NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 191 NVRFYKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 250

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+   S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 251 LDYLDGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 310

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DV++A +      +Q V A ++P   + LD
Sbjct: 311 SSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASAIPDGWMGLD 370

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+     +   +T++WNGP+GVFE + F   T  +A  +A+L+K + + +I GGG
Sbjct: 371 IGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSK-KGVTTIIGGG 429

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 430 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 469


>gi|332591479|emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
          Length = 507

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 253/400 (63%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ R++ DL+  D++G +  +R D NVP  + + + D TRI   VPTI  L+   AKV+
Sbjct: 103 MAK-RSVGDLKESDLKGKKVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVI 161

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  N++  +DCIG+ + +++ASL  GG++L E
Sbjct: 162 LTSHLGRPKG-VTPKYSLKPLVPRLTELLGVNVVKADDCIGAEVEKAVASLPNGGVLLLE 220

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  +QKE
Sbjct: 221 NVRFYKEEEKNDPEFAKKLASIADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLLQKE 280

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  KKP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG+ VG
Sbjct: 281 LDYLVGAVSNPKKPFAAIVGGSKVSSKIGVIESLLEKVDILLLGGGMIFTFYKAQGLKVG 340

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      ++VV A  +P   + LD
Sbjct: 341 SSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLD 400

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + +I+I GGG
Sbjct: 401 IGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESIAKKLAELSG-KGVITIIGGG 459

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 460 DSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLAL 499


>gi|224534935|ref|ZP_03675504.1| phosphoglycerate kinase [Borrelia spielmanii A14S]
 gi|224513875|gb|EEF84200.1| phosphoglycerate kinase [Borrelia spielmanii A14S]
          Length = 393

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 163/397 (41%), Positives = 253/397 (63%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L ++ AKVV+ SH
Sbjct: 1   MAIKTLKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLRKRGAKVVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L +++  ++DCIGS +  S   + +G I+L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANRLSELLDQDVKMLSDCIGSEIVNSTLQMKDGDIVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS +GD +++DAF  +HRAHAS  G+S  LPS+ G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSESGDVFVSDAFGAAHRAHASTVGVSEYLPSFGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 +KP V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GVLKNPEKPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGHSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + + ++P + I +DVG  T
Sbjct: 241 MEYIDTASSFLRKAKELGVKVILPLDHIVADDFNKNSTPEYIDSFNIPENKIGMDVGVNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE   F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEEVVKTAKTIIWNGPLGVFEFNSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|327438832|dbj|BAK15197.1| 3-phosphoglycerate kinase [Solibacillus silvestris StLB046]
          Length = 394

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/399 (39%), Positives = 246/399 (61%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++MND+ D++G R  +RVD+NVP  +G++ D TRI   +PTI +LV   AKV++ S
Sbjct: 1   MFLKKSMNDV-DVKGKRVFVRVDFNVPMDEGRITDETRIRAAIPTIEQLVNAGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + ++D  L  V      ++ K +  +++ IGS +  ++ ++ +G IIL ENVR
Sbjct: 60  HLGRPKGEVNEDMRLTAVGERLSELMDKPVNKLDESIGSDVEAAVNNMQDGEIILLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+ND    +  ++  D Y+NDAF  +HRAHAS  G++  +P+  G  M+KEL +L
Sbjct: 120 FHKGEEKNDEALAKEFAKLADLYVNDAFGAAHRAHASTEGIAKHVPAVSGLLMEKELDVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S  ++P  AI+GG+KV  KI ++ NL+ KVD L+IGGG+  +F+ A G  +G+SL 
Sbjct: 180 GKALSNPERPFTAIIGGAKVKDKIGVIENLLDKVDHLIIGGGLVFTFVKAMGHNIGKSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +       +AK    ++ +P D VVA E      T+VV+  ++P D + LD+G K
Sbjct: 240 EEDKIELAKGFIEQAKEKGVQLHMPVDAVVANEFSKDAETKVVAIDAIPSDWMGLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E   +VI Q++ ++WNGP+GVFE+E F   T  VA  +A         +I GGGD+  
Sbjct: 300 TAENYAEVIKQSKLIIWNGPMGVFEMEKFANGTKTVADAMAT----TDGYTIIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+    ++++  ++ST GGA LE +EGK+LPGIVAL+  
Sbjct: 356 AVEKFEVASKMDHISTGGGASLELMEGKELPGIVALNDK 394


>gi|226947448|ref|YP_002802539.1| phosphoglycerate kinase [Clostridium botulinum A2 str. Kyoto]
 gi|254782198|sp|C1FQW3|PGK_CLOBJ RecName: Full=Phosphoglycerate kinase
 gi|226842512|gb|ACO85178.1| phosphoglycerate kinase [Clostridium botulinum A2 str. Kyoto]
          Length = 398

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/403 (36%), Positives = 242/403 (60%), Gaps = 9/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +++ +  D++G + L+R D+NVP  +GK+ D  R+   +PTI  L+EK AK+++ 
Sbjct: 1   MNYNKKSI-EYIDVKGKKVLVRCDFNVPLNEGKITDENRLVGALPTIKYLMEKGAKIILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ +  K+ SL  V      +L+K ++F +D   +G    +++  + +G ++L +
Sbjct: 60  SHMGKPKGEPKKELSLLPVAKRLSEMLNKEVIFADDDNVVGENAKKAVEDMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           N R+  EE +N+  F + L+   D ++NDAF  +HRAH S  G+++    +  G  +QKE
Sbjct: 120 NTRYRKEETKNEEVFSKELASLADVFVNDAFGTAHRAHCSTVGVTNYLKEAACGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +   + ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGM  +FL AQG  +G
Sbjct: 180 LKFLGNAVEKPERPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMGYTFLKAQGYTIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P D VVA +        V   Q++    + LD
Sbjct: 240 NSLVEEDKVEYSKEMIDKAKEKGVNLLLPIDNVVADKFDKDASPVVTEDQNIGEGYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     I  A+TV+WNGP+GVFE + F   T+EVA  +A    +   ++I GGG
Sbjct: 300 IGPKTAKIYSDAIKSAKTVVWNGPMGVFEFKSFANGTIEVAKAMA----DSDAVTIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 356 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 398


>gi|159482940|ref|XP_001699523.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
 gi|158272790|gb|EDO98586.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
          Length = 462

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 167/400 (41%), Positives = 248/400 (62%), Gaps = 6/400 (1%)

Query: 5   RTMNDL--RDIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKVVIFS 60
           +++ DL   D+ G R  +R D NVP       + D TRI   VPT+  L++  AKV++ S
Sbjct: 64  KSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVLLTS 123

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +    L  VV+    +L K +  V+DCIG  + +++ ++  G ++L ENVR
Sbjct: 124 HLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLENVR 183

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           FY EEE+N+P+F + L+ N D Y+NDAF  +HRAHAS  G++    PS  G  +QKEL  
Sbjct: 184 FYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDY 243

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+   S  K+P VAIVGGSKVS+KIT++  L++K DK++IGGGM  +F  A+G+ VG SL
Sbjct: 244 LDGAVSNPKRPFVAIVGGSKVSSKITVIEALMEKCDKIIIGGGMIFTFYKARGLKVGSSL 303

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++   AK    ++++P DVVVA +      TQ V   ++P   + LD+G 
Sbjct: 304 VEDDKIELAKKLEEMAKAKGVQLLLPTDVVVADKFDANANTQTVPITAIPDGWMGLDIGP 363

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +V+     +A A+TV+WNGP+GVFE   F   TV +A+ +A LT  +  I+I GGGD++
Sbjct: 364 DSVKTFNDALADAKTVVWNGPMGVFEFPKFANGTVSIANTLAGLTP-KGCITIIGGGDSV 422

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+  AG++ + +++ST GGA LE LEGK LPG+ AL   
Sbjct: 423 AAVEQAGVAEKMSHISTGGGASLELLEGKVLPGVAALDEK 462


>gi|254780653|ref|YP_003065066.1| phosphoglycerate kinase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040330|gb|ACT57126.1| phosphoglycerate kinase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 400

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 400/400 (100%), Positives = 400/400 (100%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS
Sbjct: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR
Sbjct: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML
Sbjct: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC
Sbjct: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK
Sbjct: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT
Sbjct: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400
           ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
Sbjct: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400


>gi|129916|sp|P12783|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic
 gi|21835|emb|CAA33302.1| unnamed protein product [Triticum aestivum]
          Length = 401

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 168/400 (42%), Positives = 251/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D++G +  +R D NVP  D  K+ D TRI   +PTI  L+EK AKV+
Sbjct: 1   MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V+    +L   ++   DCIG  + +  A+L +GG++L E
Sbjct: 61  LASHLGRPKG-VTPKFSLKPLVARLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L+ KVD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +   AK    ++++P DVVVA +      +++V A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG  +++   + +   +TV+WNGP+GVFE E F   T  +A  +A+LT  + + +I GGG
Sbjct: 300 VGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|188587791|ref|YP_001922190.1| phosphoglycerate kinase [Clostridium botulinum E3 str. Alaska E43]
 gi|251779925|ref|ZP_04822845.1| phosphoglycerate kinase [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|238689630|sp|B2UY23|PGK_CLOBA RecName: Full=Phosphoglycerate kinase
 gi|188498072|gb|ACD51208.1| phosphoglycerate kinase [Clostridium botulinum E3 str. Alaska E43]
 gi|243084240|gb|EES50130.1| phosphoglycerate kinase [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 396

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 152/401 (37%), Positives = 236/401 (58%), Gaps = 10/401 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +T+ D++ ++G + L+R D+NVP  DG + D  R+   +PTI  LVE  AKV++ 
Sbjct: 1   MNFNKKTIEDIQ-VKGKKVLVRCDFNVPLKDGVITDENRLNGALPTIKYLVENGAKVILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIG--STLSQSIASLSEGGIILAE 117
           SH+G+P+ +   + SL  V      +L K I F  D          ++A + +G ++L E
Sbjct: 60  SHMGKPKGEPKPELSLAPVAKRLSELLGKEIKFAPDNTVVGENAKAAVAEMKDGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKE 176
           N R+  EE +N  +F + L+   + ++NDAF  +HRAH S  G++  + +   G  +QKE
Sbjct: 120 NTRYRKEETKNGEEFSKELASLAEIFVNDAFGTAHRAHCSTVGVTDYIDTAVCGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L +     +KP VAI+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 LKFLGNAVETPEKPFVAILGGAKVSDKIAVINNLLDKVDTIIIGGGMAYTFLKAQGYEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D   ++  +A+      ++P D  VA E K  +   V   Q++P  ++ LD
Sbjct: 240 TSLVEEDRLDYAKEMIAKAEEKGVNFLLPVDHRVAAEFKD-VEATVTEDQNIPAGTMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     +  A+TV+WNGP+GVFE E F++ T+ VA  +A    +    +I GGG
Sbjct: 299 IGPKTEKLYADAVKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMA----DSNATTIIGGG 354

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+  A+   G  ++ T++ST GGA LE+LEGK LPGI AL+
Sbjct: 355 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKVLPGISALN 395


>gi|33864370|ref|NP_895930.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9313]
 gi|46576736|sp|Q7V461|PGK_PROMM RecName: Full=Phosphoglycerate kinase
 gi|33641150|emb|CAE22280.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9313]
          Length = 401

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 253/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++++L   D+R  R L+RVD+NVP   +G + D TRI   +PTI +L++K A+V+
Sbjct: 1   MAK-RSLSNLSAADLRSKRVLVRVDFNVPLNENGAITDDTRIRAALPTINDLIDKGARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V      +L KN+     C+GS     + ++++G ++L E
Sbjct: 60  LSAHFGRPKGQINEGMRLTPVAKRLSELLGKNVTKTESCVGSDAEAKVNAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+SEEE+ND +F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFSEEEKNDANFAQKLAALADAYVNDAFGAAHRAHASTEGVTKFLNPSVAGHLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    + K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDDPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    ++++P DVV+A +      +Q VS  ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVQLLLPTDVVLADDFAPAANSQTVSIDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  ++   +  +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSINLFQDALADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|78185710|ref|YP_378144.1| phosphoglycerate kinase [Synechococcus sp. CC9902]
 gi|123580989|sp|Q3AVX6|PGK_SYNS9 RecName: Full=Phosphoglycerate kinase
 gi|78170004|gb|ABB27101.1| phosphoglycerate kinase [Synechococcus sp. CC9902]
          Length = 401

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 160/402 (39%), Positives = 244/402 (60%), Gaps = 6/402 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +LV K AKVV
Sbjct: 1   MAK-RSLASLNAGDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVV 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L K +   + CIG      + +++ G ++L E
Sbjct: 60  LAAHFGRPKGQVNEAMRLTPVAARLSELLGKTVTKTDSCIGPDAEAKVGAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF +EEE+ND  F   L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFVAEEEKNDSGFAEKLAALADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DVV+A        +Q+    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQIADVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   ++  +  +A  +TV+WNGP+GVFE + F   T  +A  +A++  +    +I GGG
Sbjct: 300 IGPDAIKVFQAALADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAEIGGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL  
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALDN 400


>gi|257784726|ref|YP_003179943.1| Phosphoglycerate kinase [Atopobium parvulum DSM 20469]
 gi|257473233|gb|ACV51352.1| Phosphoglycerate kinase [Atopobium parvulum DSM 20469]
          Length = 396

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/393 (39%), Positives = 239/393 (60%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D  D+ G R L+RVD+NVP  DG V D TR+   +PTI  L++  AKV++ SHLGR
Sbjct: 6   KTVRD-ADVDGKRVLMRVDFNVPLKDGVVTDDTRVRAALPTIQYLLDHNAKVILMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P       + SL         +L + + FV D  G    +++ +L +G +++ ENVRF  
Sbjct: 65  PDGTGFQPELSLRPAAEKLAELLGREVKFVEDTYGEKAREAVDALKDGEVLVLENVRFDK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  ++L+  GD ++ DAF  +HRA  S+ G +  LP+Y G  ++KE+  L S 
Sbjct: 125 REKKNDPEIAKILASYGDIFVLDAFGTAHRAQGSVVGPAAYLPAYAGFLLEKEVDTLTSI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           FS  ++PLVAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G  VG SL + D
Sbjct: 185 FSNPERPLVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAKGYTVGTSLQEPD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+    +I++P D VV          +VV +  +P D + +D+G KTVE
Sbjct: 245 WIERAGEMLKKAEEKGVKILLPVDNVVTDHFGEDAVGEVVPSDQIPADRMGMDIGPKTVE 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I  A+TV WNGP+GVFE + F + T  +A  VA         SI GGGD++ A+ 
Sbjct: 305 LYTEAIKGAKTVFWNGPMGVFEFDQFAKGTEAIARAVADA----NCTSIIGGGDSVAAVN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              ++++ +++ST GGA +E +EGK LPG+ AL
Sbjct: 361 KFHLADKMSWISTGGGASMELVEGKALPGVEAL 393


>gi|224101335|ref|XP_002312238.1| predicted protein [Populus trichocarpa]
 gi|3738261|dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gi|222852058|gb|EEE89605.1| predicted protein [Populus trichocarpa]
          Length = 481

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 251/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  +  K+ D TRI   VPTI  L+ K AKV+
Sbjct: 77  MAK-KSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  +DCIG  + + +ASL EGG++L E
Sbjct: 136 LSSHLGRPKG-VTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLAVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++ V A ++P   + LD
Sbjct: 315 SSLVEEDKLDLATTLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+   + +   +TV+WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 375 IGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKKLAELSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG++AL
Sbjct: 434 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLAL 473


>gi|302380711|ref|ZP_07269176.1| phosphoglycerate kinase [Finegoldia magna ACS-171-V-Col3]
 gi|302311654|gb|EFK93670.1| phosphoglycerate kinase [Finegoldia magna ACS-171-V-Col3]
          Length = 395

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 155/397 (39%), Positives = 242/397 (60%), Gaps = 7/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ DL ++   R L+RVD+NVP  DG + D  RIE  + TI  L++  AKV++ SH
Sbjct: 1   MNKKTLKDL-NVENKRVLVRVDFNVPIKDGVITDTNRIEASLTTIKYLIDNNAKVILMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ +   + SL  V      I+ +++ F++    +  ++ +    L    I++ +N 
Sbjct: 60  LGRPKGEPKPEFSLKPVAQKLSEIIGQDVKFIDSDKVVDDSVIEESKKLQPKEIMIIQNT 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF  EEE+ND  F + LS+  D Y+NDAF  SHRAHAS  G+S  LPS +G  +QKE+ +
Sbjct: 120 RFRKEEEKNDEKFSKELSQLADLYVNDAFGTSHRAHASNVGVSKFLPSAVGFLVQKEIEI 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P  AI+GG+KVS KI ++ NL+ KVD ++IGG MA +F+ +QG  VG+SL
Sbjct: 180 MGKALENPERPFTAILGGAKVSDKIGVIENLLDKVDTILIGGAMAFTFIKSQGKNVGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D    +  +A+    +I +P D VVA+EM     ++V++      D    D+G 
Sbjct: 240 IEEDKLDLAKSLLEKAQEKGVKIFLPVDFVVAKEMSEDSDSKVINIDDFTDDIAGFDIGT 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++   + I +++T++WNGP+GVFEIE F + T E+A+ + K     +  +I GGGD+ 
Sbjct: 300 KTIKIFDEEIQKSKTIVWNGPMGVFEIEQFSKGTFEIANSLVK----SKATTIVGGGDSA 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+A +G  ++ T+VST GGA LE+LEGK LPGI  +
Sbjct: 356 SAIAKSGNKDKVTHVSTGGGASLEFLEGKVLPGIDCI 392


>gi|317500543|ref|ZP_07958765.1| phosphoglycerate kinase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089357|ref|ZP_08338257.1| phosphoglycerate kinase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|316898053|gb|EFV20102.1| phosphoglycerate kinase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330405420|gb|EGG84955.1| phosphoglycerate kinase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 399

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 146/404 (36%), Positives = 242/404 (59%), Gaps = 10/404 (2%)

Query: 1   MS--RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+    ++++D+ +++G R L+R D+NVP IDGK+ D  RI   +PTI +L+    KV++
Sbjct: 1   MAALNKKSVDDI-NVKGQRVLVRCDFNVPLIDGKITDENRIVAALPTIKKLIADGGKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLG+P+ +   + SL  V      +L +++ F  D   +G     ++ ++ +G ++L 
Sbjct: 60  CSHLGKPKGEPKPELSLAPVAVRLAELLGQDVKFAADPEVVGENAKAAVEAMKDGDVVLL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQK 175
           EN R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQK
Sbjct: 120 ENTRYRAEETKNGEAFSKELASLCDVFVNDAFGTAHRAHCSNVGVTEYVDTAVVGYLMQK 179

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  L +     ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  AQG  V
Sbjct: 180 EIDFLGNAVENPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMSYTFTKAQGGSV 239

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G SL + D+      +  +A+    ++++P D +VA E      T+VVS  ++P   + L
Sbjct: 240 GASLLEEDYLQYALDMIKKAEEKGVKLLLPVDTIVADEFSNDANTKVVSRDAIPDGWMGL 299

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G +T +   + +  A+TV+WNGP+G FE+  F   T  VA  +A        ++I GG
Sbjct: 300 DIGPETAKIFAEAVKSAKTVVWNGPMGCFEMPKFAEGTKVVAEALA----NTEAVTIIGG 355

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GD+  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 GDSAAAVNQLGFGDKMTHISTGGGASLEFLEGKELPGVAAANDK 399


>gi|118488917|gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gi|118489457|gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 481

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 251/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  +  K+ D TRI   VPTI  L+ K AKV+
Sbjct: 77  MAK-KSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  +DCIG  + + +ASL EGG++L E
Sbjct: 136 LSSHLGRPKG-VTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLAVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++ V A ++P   + LD
Sbjct: 315 SSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+   + +   +TV+WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 375 IGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKKLAELSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG++AL
Sbjct: 434 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLAL 473


>gi|224109060|ref|XP_002315066.1| predicted protein [Populus trichocarpa]
 gi|222864106|gb|EEF01237.1| predicted protein [Populus trichocarpa]
          Length = 481

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 250/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV+
Sbjct: 77  MAK-KSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  +DCIG  + + +ASL +GG++L E
Sbjct: 136 LSSHLGRPKG-VTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVSGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSTPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLPVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D       +  +AK     +++P DV++A +      +++V A ++P   + LD
Sbjct: 315 SSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSKIVPASAIPDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 375 IGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG++AL
Sbjct: 434 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLAL 473


>gi|193213710|ref|YP_001999663.1| phosphoglycerate kinase [Chlorobaculum parvum NCIB 8327]
 gi|238692615|sp|B3QLX7|PGK_CHLP8 RecName: Full=Phosphoglycerate kinase
 gi|193087187|gb|ACF12463.1| Phosphoglycerate kinase [Chlorobaculum parvum NCIB 8327]
          Length = 397

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 162/398 (40%), Positives = 254/398 (63%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
            + +T++D+  ++G R L+RVD+NVP   D  + D  RI   +P+I +++E+  ++++ S
Sbjct: 1   MQKKTLSDIS-LQGKRVLMRVDFNVPLDQDRNITDDKRIVGALPSIRKVIEEGGRLILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K +   SL         +L   +   NDCIG+ + Q + +L +G +++ EN+R
Sbjct: 60  HLGRPKGKVNPAFSLAPAAKRLSELLGMPVTMANDCIGTEVMQEVLALQDGEVMMLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSM 179
           F+ EEE NDPDF R L+  G+ Y+NDAF  +HRAHAS  G++H +P+ + G  ++KEL  
Sbjct: 120 FHPEEEANDPDFARELASMGEIYVNDAFGTAHRAHASTEGITHYVPTAVAGYLIEKELRY 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +  +++K+P VAI+GG+K+S KI +L +L  KVD +++GG M  +F  AQG+ VG SL
Sbjct: 180 LGTALNDAKRPFVAILGGAKISGKIDVLEHLFDKVDTVLVGGAMVFTFFKAQGLPVGNSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + +  +    +  +AK     +I+P DVVVA E+     ++V    ++      LD+G 
Sbjct: 240 VEDNKIELAISLLEKAKEKGVRLILPEDVVVAAEISADAASRVEPVTTISDGMSGLDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            T+E   + I  A+TV+WNGP+GVFEI+ F + T  VA  +A  T +   I+I GGGD+ 
Sbjct: 300 ATIETYAKEILGAKTVLWNGPMGVFEIDQFAKGTFAVAQALADAT-DAGAITIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+A AG+S++ T+VST GGA LE+LEGK+LPGI AL+
Sbjct: 359 AAIAKAGLSDKVTHVSTGGGASLEFLEGKELPGIAALN 396


>gi|29124969|gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
          Length = 401

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVVVA +      ++VV+A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVAASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFNEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|225549329|ref|ZP_03770302.1| phosphoglycerate kinase [Borrelia burgdorferi 94a]
 gi|225370187|gb|EEG99627.1| phosphoglycerate kinase [Borrelia burgdorferi 94a]
          Length = 393

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 249/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRVLVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYIDSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|269118868|ref|YP_003307045.1| phosphoglycerate kinase [Sebaldella termitidis ATCC 33386]
 gi|268612746|gb|ACZ07114.1| Phosphoglycerate kinase [Sebaldella termitidis ATCC 33386]
          Length = 399

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/404 (38%), Positives = 249/404 (61%), Gaps = 10/404 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T+ DL D++G + L+RVD+NVP  DGK+ D  RI   +PTI  ++E   KV+ FS
Sbjct: 1   MAK-KTVKDL-DVKGKKVLMRVDFNVPMKDGKITDENRIVAALPTIKYVLEHGGKVIAFS 58

Query: 61  HLGRPQSKSDK-DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLG+ + ++DK   SL  V      +L + + F+ +  G+ L ++++ L +G I++ EN 
Sbjct: 59  HLGKVKEEADKASKSLKPVAERLSELLGQPVKFIPETRGAELEKAVSELKDGEIMMFENT 118

Query: 120 RFY----SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQK 175
           RF      +E +NDP+  +  +  GD ++NDAF  +HRAHAS  G++  L +  G  M+K
Sbjct: 119 RFEDIDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVGIASHLETAAGFLMEK 178

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  +    +   +PLVAI+GG+KVS KI ++ NL++K DK++IGGGM  +FL AQG  +
Sbjct: 179 EIEFIGGVVNNPARPLVAILGGAKVSDKIGVIENLIEKADKILIGGGMMFTFLKAQGKNI 238

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G SL + D  +   Q+  +AK +  E+++P D VVA+E K     + VS  ++    + L
Sbjct: 239 GSSLLEEDKVELAKQLLEKAKANGKELVLPIDTVVAKEFKNDTEFKTVSVDAIEDGWMGL 298

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G  +++   + +  A+TV+WNGP+GVFE+  F + T+ V   +A L       +I GG
Sbjct: 299 DIGADSIKLFSEKLNGAKTVVWNGPMGVFEMPNFAKGTIGVCEAIAHL---EGATTIIGG 355

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GD+  A    G +++FT++ST GGA LE+LEGK LPG+ A+S  
Sbjct: 356 GDSAAAAIQLGYADKFTHISTGGGASLEYLEGKVLPGVEAISDK 399


>gi|256545224|ref|ZP_05472589.1| phosphoglycerate kinase [Anaerococcus vaginalis ATCC 51170]
 gi|256399051|gb|EEU12663.1| phosphoglycerate kinase [Anaerococcus vaginalis ATCC 51170]
          Length = 398

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 161/403 (39%), Positives = 250/403 (62%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGK--VADVTRIERVVPTILELVEKKAKVVI 58
              +T+ DL ++ G + L+RVD+NVP   DG   ++D TRI+  +PTI  L+E  AKV++
Sbjct: 1   MNKKTVKDL-NVEGKKVLVRVDFNVPLSKDGNHTISDDTRIKAALPTIDYLLENNAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLGRP+ +++ + SL  V S  E+   +   F+     +   + + +  L  G + L 
Sbjct: 60  MSHLGRPKGEANPEFSLKPVASWLENHYGEKFHFLPSDVVVDEKVKEEVEKLENGNLALL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN R+   E +NDP+F + LS   D ++NDAF  SHRAHAS  G+++ L S +G  +QKE
Sbjct: 120 ENTRYVKGETKNDPEFAKELSSLADLFVNDAFGTSHRAHASNVGVANNLESAVGFLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           + ++       ++P V+I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQG  +G
Sbjct: 180 IEIMGKALENPERPFVSILGGAKVSDKIGVIENLISKVDYILIGGGMAYTFLKAQGKEIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +A+ +  +I++P+DVV+A E+K    T++V   ++P D   LD
Sbjct: 240 KSLLEEDKMDLSLELIKKAEANNVKILLPKDVVIADEIKEDAETEIVDIDNIPTDKEALD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +    +I +A+TV+WNGP+GVFE++ F   T EVA  +A    +    +I GGG
Sbjct: 300 IGPKTAKEYADIIKKAKTVVWNGPMGVFEVKVFANGTNEVAKALA----DSSATTIVGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+  AG  ++ T+VST GGA LE+LEGK LPGI  +   
Sbjct: 356 DSALAIEEAGYKDKITHVSTGGGASLEFLEGKTLPGIDCIDEK 398


>gi|323135577|ref|ZP_08070660.1| Phosphoglycerate kinase [Methylocystis sp. ATCC 49242]
 gi|322398668|gb|EFY01187.1| Phosphoglycerate kinase [Methylocystis sp. ATCC 49242]
          Length = 398

 Score =  368 bits (944), Expect = e-99,   Method: Composition-based stats.
 Identities = 196/396 (49%), Positives = 274/396 (69%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++++ D++G R LLRVD NVP  + +V D TRIER++PTI E+ EK  KV++ S
Sbjct: 1   MASFRTLDNV-DVKGKRVLLRVDLNVPMEETRVTDATRIERILPTINEIAEKGGKVILLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL +V+   E  L + I F +DC+G+  S  + ++ +G I L EN R
Sbjct: 60  HFGRPKGQRVDEDSLRQVLPTLEHYLKRKIAFADDCVGAPASAVVDAMKDGDIALLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+NDP FV  +++ GD +++DAFS +HRAHA+  G++H LP+Y GR MQ EL  L
Sbjct: 120 FQKGEEKNDPAFVEEIAKLGDIFVHDAFSAAHRAHATTEGVAHRLPAYAGRTMQAELEAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           ES  +   +P++AIVGG+KVSTK+ LL NLV KV  LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 180 ESSLTNPARPVMAIVGGAKVSTKLELLGNLVSKVQYLVIGGGMANTFLAAQGKAVGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D + +   I  +AK + C +++P D  VA++ +   P+ +VS   V  + +ILDVG K
Sbjct: 240 EHDLAGSARGILEKAKAANCVVVLPVDATVAQKFEEHAPSHIVSVDHVGENDMILDVGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV +++ ++AQ RT++WNGP G FE+ PFD  T  VA   A+LT E +++S+AGGGDT+ 
Sbjct: 300 TVAHVEALLAQCRTLVWNGPFGAFELPPFDEGTNAVAQTAARLTVEGKLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL  A    EF+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 360 ALNQAHAGQEFSYVSTAGGAFLEWLEGKTLPGVAAL 395


>gi|225552308|ref|ZP_03773248.1| phosphoglycerate kinase [Borrelia sp. SV1]
 gi|225371306|gb|EEH00736.1| phosphoglycerate kinase [Borrelia sp. SV1]
          Length = 393

 Score =  368 bits (944), Expect = e-99,   Method: Composition-based stats.
 Identities = 159/397 (40%), Positives = 252/397 (63%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIKAALPTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  +++CIGS ++ S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSNCIGSEVANSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + + + +VP + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEHIDSFNVPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEN 393


>gi|51598317|ref|YP_072505.1| phosphoglycerate kinase [Borrelia garinii PBi]
 gi|81691595|sp|Q662V8|PGK_BORGA RecName: Full=Phosphoglycerate kinase
 gi|51572888|gb|AAU06913.1| phosphoglycerate kinase [Borrelia garinii PBi]
          Length = 393

 Score =  368 bits (944), Expect = e-99,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 250/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L EK A++V+ SH
Sbjct: 1   MSIKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L +++  ++DCIG  +  +   + +G ++L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGREIVNNTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 EVLKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + +  +P + I +DVG KT
Sbjct: 241 SEYIDIASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEYIDSFDIPENKIGMDVGGKT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++VI  A+T++WNGPLGVFE + F + T  VA  VA        ++I GGGD++ A
Sbjct: 301 LKEIEKVIKTAKTIIWNGPLGVFEFDSFSKGTAMVAEMVASCAG----LTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|219684893|ref|ZP_03539835.1| phosphoglycerate kinase [Borrelia garinii PBr]
 gi|219671838|gb|EED28893.1| phosphoglycerate kinase [Borrelia garinii PBr]
          Length = 393

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 251/397 (63%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L EK A++V+ SH
Sbjct: 1   MSIKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTIEYLKEKGARIVLISH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L +++  ++DCIGS +  +   + +G ++L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGSEIVNNTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 EVLKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSKGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + +  +P + I +DVG  T
Sbjct: 241 SEYIDVASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEYIDSFDIPENKIGMDVGGNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++VI  A+T++WNGPLGVFE + F + T  VA  VA  +     ++I GGGD++ A
Sbjct: 301 LKEIEKVIKTAKTIIWNGPLGVFEFDSFSKGTAMVAEMVASCSG----LTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|253575496|ref|ZP_04852833.1| phosphoglycerate kinase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845143|gb|EES73154.1| phosphoglycerate kinase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 393

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 149/398 (37%), Positives = 233/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DG++ D TRI   +PTI  LVE+ AKV++ SH
Sbjct: 1   MNKKSVRDV-EVTGKRVFVRVDFNVPMQDGQITDDTRIRETLPTIKYLVEQGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + ++D  L         +L K +  V++ +G  +   + +++ G +++ ENVRF
Sbjct: 60  LGRPKGQVNEDMRLTLPAKRLSELLGKEVAKVDEAVGEAVKAKVNAMNNGDVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS+L 
Sbjct: 120 YPGEEKNDPELAKQFAELADLFVNDAFGAAHRAHASTEGIAHYLPAVSGLLMEKELSVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +   +P  AI+GGSKV  KI ++ NL+   D ++IGGG+A +F  AQG  +G+SL  
Sbjct: 180 KALTNPDRPFTAIIGGSKVKDKIDVIDNLLNIADNVLIGGGLAYTFFKAQGYEIGKSLLD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D       +AK+     ++P D +VA +       + V   S+P D   +D+G KT
Sbjct: 240 ETKLDVALGFIEKAKKLGKNFLLPVDCIVADDFSPTANHKAVDIDSIPADWEGVDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
                ++I  ++ V+WNGP+GVFEI+ F   T EVA   A         +I GGGD+  A
Sbjct: 300 RAKYAEIIKNSKLVVWNGPMGVFEIDIFSNGTREVAEACAT----TEGYTIIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
                ++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 AEKFNLASKMDHISTGGGASLEFMEGKALPGVVALNDK 393


>gi|332972919|gb|EGK10861.1| phosphoglycerate kinase [Desmospora sp. 8437]
          Length = 393

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 153/399 (38%), Positives = 238/399 (59%), Gaps = 6/399 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++L  ++   D+RG R   RVD+NVP   G++ D  RI   +PTI  L E  AKV++ S
Sbjct: 1   MNKLSILD--VDVRGKRVFCRVDFNVPLDQGRITDDNRIRAALPTIRHLTEHGAKVILAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP  +  ++  L  V      +L ++++  ++ +G  + + +A L EG ++L ENVR
Sbjct: 59  HLGRPNGRVVEELRLTPVAERLSQLLGQSVVKTDETVGEEVEKEVAGLKEGDVLLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   EE+NDP+  R  ++  D Y+NDAF  +HRAHAS  G++  LP+  G  MQ+EL  L
Sbjct: 119 FCPGEEKNDPELSRAFAKLADLYVNDAFGTAHRAHASTAGIAEHLPAVAGFLMQQELETL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P  A++GG+KV  KI ++ NL+ KVD L+IGGG++ +FL A+G+ +G+SL 
Sbjct: 179 GRALQNPDRPFTAVIGGAKVKDKIGVIDNLLDKVDNLLIGGGLSFTFLKAKGLEIGQSLL 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D       +A++    +++P D  VA+      P ++V  +++P DS+ LD+G K
Sbjct: 239 EPDKIDLAESFMEKAEQKGVRLLLPVDAAVAKSFAPDAPAELVDVEAIPRDSMGLDIGPK 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T E    VI  ++ V+WNGP+GVFE + F   T  VA  VA  T     ++I GGGD++ 
Sbjct: 299 TREAFADVIRASKLVIWNGPMGVFEFDRFADGTFAVARAVATCTG----MTIIGGGDSVA 354

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+  +G++ +  ++ST GGA LE +EGK LPG+  L   
Sbjct: 355 AVKKSGLAGQVGHISTGGGASLELMEGKTLPGVAVLQNK 393


>gi|229817563|ref|ZP_04447845.1| hypothetical protein BIFANG_02826 [Bifidobacterium angulatum DSM
           20098]
 gi|229785352|gb|EEP21466.1| hypothetical protein BIFANG_02826 [Bifidobacterium angulatum DSM
           20098]
          Length = 401

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 143/401 (35%), Positives = 233/401 (58%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   +    D  G      +A++++G ++L +NVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGVEVPLAADTYGEDAQAKVAAMNDGDVVLLQNVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP+    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDPEERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL  ++GGSKVS K+ ++ NL+ K ++LVIGGGMA +FL A+G  VG SL
Sbjct: 181 LSRATENPERPLTVVLGGSKVSDKLGVIDNLLDKANRLVIGGGMAYTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP---TQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVV+             +VV+A ++P D + LD
Sbjct: 241 LEEDQIETVKGYMERAEKNGVELVLPTDVVLNPVFPKSDEDIAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPTFAEGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|121485004|gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
          Length = 401

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 248/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L   D++G R  +RVD NVP  D  K+ D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLTEGDLKGKRVFVRVDLNVPLDDTFKITDDTRIRAAVPTIKYLMSHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   +DCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKG-VTPKFSLKPLVPRLSELLGIEVKMADDCIGPDVEKLVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  +QKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKHLKPAVAGFLVQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  KKP  AIVGGSKVS+KI ++ +L++KVD LV+GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVSNPKKPFAAIVGGSKVSSKIGVIESLLEKVDILVLGGGMIFTFYKAQGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A S+P   + LD
Sbjct: 240 SSLVEEDKLDLATTLLEKAKSKGVSLLLPSDVVIADKFAADANSKIVPASSIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKSFSEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVPAL 398


>gi|320458078|dbj|BAJ68699.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 420

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 232/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 20  MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 79

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 80  RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 139

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 140 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 199

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 200 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 259

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 260 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 319

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 320 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 378

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 379 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 420


>gi|213691969|ref|YP_002322555.1| Phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|254782189|sp|B7GQU7|PGK_BIFLI RecName: Full=Phosphoglycerate kinase
 gi|213523430|gb|ACJ52177.1| Phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 401

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 232/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 401


>gi|116330861|ref|YP_800579.1| phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122281385|sp|Q04TE9|PGK_LEPBJ RecName: Full=Phosphoglycerate kinase
 gi|116124550|gb|ABJ75821.1| Phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 396

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 158/398 (39%), Positives = 250/398 (62%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             L  + ++ D+ G R  LRVD+NVP  +GKV D TRIE+ +PTI  L++K A+++I SH
Sbjct: 1   MELPRLENV-DLSGKRVFLRVDFNVPIENGKVTDKTRIEKTLPTIELLIKKGARIIIASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +++ + SL  VV + + ++  N+ F    IG    +    L +G I++ ENVRF
Sbjct: 60  LGRPKGQTNPEFSLAPVVEVFKGLVKSNVYFSKTVIGDEPIKLSKELRDGEILVIENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EEE N+P F + L+   D Y+NDAF  +HRAHAS  G++HLLP+Y G  M KE+  L 
Sbjct: 120 HKEEEENEPGFSKKLAALADVYVNDAFGAAHRAHASTEGIAHLLPAYAGLLMHKEIVELS 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +  ++  +P VAI+GGSKVS+KI +L NL  KV+ L+IGGGMA +FL ++ + VG SL +
Sbjct: 180 ALLAKPARPFVAIIGGSKVSSKIKVLNNLFDKVNHLLIGGGMAYTFLKSRAVPVGNSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           +DF     Q+  +A  +  ++ +P D ++  +      T+ V    +    + +D+G KT
Sbjct: 240 KDFEVQAFQLIEKAGVAGVDLQLPVDHIIGDQFNEKAKTKSVDKMGILDGWMGMDIGSKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V   +++I  A T+ WNGP+GVFE++ F   T+ +A  ++K     +  ++ GGGD+I A
Sbjct: 300 VSNYEKIIKNAGTIFWNGPMGVFEMDKFAGGTMAIAKAISK----SKAKTVVGGGDSIAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A ++++ T++ST GGA LE++EG+ LPG+ AL   
Sbjct: 356 INKAKVADKITHISTGGGASLEFMEGRKLPGVEALKKK 393


>gi|317483285|ref|ZP_07942279.1| phosphoglycerate kinase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322691293|ref|YP_004220863.1| phosphoglycerate kinase [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|316915248|gb|EFV36676.1| phosphoglycerate kinase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456149|dbj|BAJ66771.1| phosphoglycerate kinase [Bifidobacterium longum subsp. longum JCM
           1217]
          Length = 401

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 231/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  L +  G  ++KE+  
Sbjct: 121 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLSAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 401


>gi|227547278|ref|ZP_03977327.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|227212237|gb|EEI80133.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           ATCC 55813]
          Length = 420

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 231/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 20  MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 79

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 80  RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 139

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  L +  G  ++KE+  
Sbjct: 140 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLSAAAGLLVEKEVKA 199

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 200 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 259

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 260 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 319

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 320 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 378

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 379 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 420


>gi|124024485|ref|YP_001018792.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9303]
 gi|166987797|sp|A2CDG7|PGK_PROM3 RecName: Full=Phosphoglycerate kinase
 gi|123964771|gb|ABM79527.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9303]
          Length = 401

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 252/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R+++ L   D+R  R L+RVD+NVP   +G + D TRI   +PTI +L++K A+V+
Sbjct: 1   MAK-RSLSSLSAADLRSKRVLVRVDFNVPLNENGAITDDTRIRAALPTINDLIDKGARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V      +L K ++    C+GS     + ++++G ++L E
Sbjct: 60  LSAHFGRPKGQINEGMRLTPVAKRLSELLGKTVIKTESCVGSDAEAKVNAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+SEEE+ND +F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFSEEEKNDANFAQKLAALADAYVNDAFGAAHRAHASTEGVTKFLNPSVAGHLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    + K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDDPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    ++++P DVV+A +      +Q VS  ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVQLLLPTDVVLADDFSPDANSQTVSIDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  ++   +  +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSINLFQDALADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|169824489|ref|YP_001692100.1| phosphoglycerate kinase [Finegoldia magna ATCC 29328]
 gi|238687746|sp|B0S1H0|PGK_FINM2 RecName: Full=Phosphoglycerate kinase
 gi|167831294|dbj|BAG08210.1| phosphoglycerate kinase [Finegoldia magna ATCC 29328]
          Length = 395

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 155/397 (39%), Positives = 243/397 (61%), Gaps = 7/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ DL ++   R L+RVD+NVP  +G + D  RIE  + TI  L++  AKV++ SH
Sbjct: 1   MNKKTLKDL-NVENKRVLVRVDFNVPIKEGIITDTNRIEASLTTIKYLIDNNAKVILMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ +   + SL  V      ++ +++ F++    +  ++ +    L    I+L +N 
Sbjct: 60  LGRPKGEPKPEFSLKPVAQKLSEMIGQDVKFIDSDKVVDDSVIEESKKLQPKEIMLIQNT 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF  EEE+ND  F + LS+  D Y+NDAF  SHRAHAS  G+S  LPS +G  +QKE+ +
Sbjct: 120 RFRKEEEKNDQTFSKELSQLADLYVNDAFGTSHRAHASNVGVSKFLPSAVGFLVQKEIEI 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P  AI+GG+KVS KI ++ NL+ KVD ++IGG MA +F+ +QG  VG+SL
Sbjct: 180 MGKALENPERPFTAILGGAKVSDKIGVIENLLDKVDTILIGGAMAFTFIKSQGKNVGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D    +  +A+    +I +P D VVA+EM     ++V++      D    D+G 
Sbjct: 240 IEEDKLDLAKSLLEKAQEKGVKIFLPVDFVVAKEMTEESDSKVINIDDFTDDIAGFDIGT 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++   + I +++T++WNGP+GVFEIE F + T E+A+ + K     + I+I GGGD+ 
Sbjct: 300 KTIKIFDEEIQKSKTIVWNGPMGVFEIEQFSKGTFEIANSLVK----SKAITIVGGGDSA 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+A +G  ++ T+VST GGA LE+LEGK LPGI  +
Sbjct: 356 SAIAKSGNKDKVTHVSTGGGASLEFLEGKVLPGIDCI 392


>gi|291456769|ref|ZP_06596159.1| phosphoglycerate kinase [Bifidobacterium breve DSM 20213]
 gi|291382046|gb|EFE89564.1| phosphoglycerate kinase [Bifidobacterium breve DSM 20213]
          Length = 424

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 145/402 (36%), Positives = 229/402 (56%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L EK AKV++ +HLG
Sbjct: 24  MKTLKDLGDLKGKRILVRADFNVPLDGTTITDDGRIKAALPTIKTLHEKGAKVILMAHLG 83

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 84  RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 143

Query: 124 EEER----NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE          + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 144 EETSKDAAERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 203

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A+G  VG SL
Sbjct: 204 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKADRLVIGGGMVFTFLKAKGYEVGTSL 263

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  D V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 264 LEEDQLDKVKGYIATAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPSDKMGLD 323

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 324 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 382

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 383 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 424


>gi|27376633|ref|NP_768162.1| phosphoglycerate kinase [Bradyrhizobium japonicum USDA 110]
 gi|46576802|sp|Q89U95|PGK_BRAJA RecName: Full=Phosphoglycerate kinase
 gi|27349774|dbj|BAC46787.1| phosphoglycerate kinase [Bradyrhizobium japonicum USDA 110]
          Length = 398

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 201/397 (50%), Positives = 272/397 (68%), Gaps = 3/397 (0%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+ + RT++D+ D++G R LLRVD NVP  +G+V D TR+ERV PTI EL +K  KV++ 
Sbjct: 1   MANKFRTLDDV-DVKGKRVLLRVDLNVPMENGRVTDATRLERVAPTITELADKGGKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+   D   SL  V      +L+K + F +DCIG   + ++A+L +G I+  EN 
Sbjct: 60  AHFGRPKG-RDAKESLKPVTEALSKVLNKPVAFADDCIGEPAATAVAALKDGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  
Sbjct: 119 RFHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE       KP++AI+GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+G+G+SL
Sbjct: 179 LEKALGSPTKPVIAIIGGAKVSTKIDLLENLVSKVDALVIGGGMANTFLHAQGVGIGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D +    +I  +A+ + C II+P D  VA       P+      ++P D +ILDVG 
Sbjct: 239 AEKDLAPTALRIIEKAEAANCAIILPVDATVAYHFAANAPSHAYGLDAIPADGMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++V  +   I  A T++WNGPLG FE++PFDR TV  A + A+ TK +++ISIAGGGDT+
Sbjct: 299 QSVARVHAAIDDAATLVWNGPLGAFEMQPFDRGTVAAAKHAAERTKAKKLISIAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AL  A ++ +FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 359 AALNQAHVAGDFTYVSTAGGAFLEWMEGKPLPGVEVL 395


>gi|296454214|ref|YP_003661357.1| phosphoglycerate kinase [Bifidobacterium longum subsp. longum
           JDM301]
 gi|296183645|gb|ADH00527.1| Phosphoglycerate kinase [Bifidobacterium longum subsp. longum
           JDM301]
          Length = 401

 Score =  367 bits (942), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 143/402 (35%), Positives = 231/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DV V          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAEKNGVELVLPTDVAVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFASGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 401


>gi|291516859|emb|CBK70475.1| phosphoglycerate kinase [Bifidobacterium longum subsp. longum F8]
          Length = 420

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 232/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 20  MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 79

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 80  RPKGKVVPELSLAPVAARLGELLGANVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 139

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 140 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 199

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 200 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 259

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 260 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 319

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 320 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 378

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 379 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 420


>gi|46191241|ref|ZP_00120381.2| COG0126: 3-phosphoglycerate kinase [Bifidobacterium longum DJO10A]
 gi|189439295|ref|YP_001954376.1| phosphoglycerate kinase [Bifidobacterium longum DJO10A]
 gi|312132670|ref|YP_004000009.1| pgk [Bifidobacterium longum subsp. longum BBMN68]
 gi|322689281|ref|YP_004209015.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           157F]
 gi|238692053|sp|B3DRV9|PGK_BIFLD RecName: Full=Phosphoglycerate kinase
 gi|189427730|gb|ACD97878.1| 3-phosphoglycerate kinase [Bifidobacterium longum DJO10A]
 gi|311773626|gb|ADQ03114.1| Pgk [Bifidobacterium longum subsp. longum BBMN68]
 gi|320460617|dbj|BAJ71237.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           157F]
          Length = 401

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 232/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGANVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 401


>gi|153814502|ref|ZP_01967170.1| hypothetical protein RUMTOR_00716 [Ruminococcus torques ATCC 27756]
 gi|145847996|gb|EDK24914.1| hypothetical protein RUMTOR_00716 [Ruminococcus torques ATCC 27756]
          Length = 444

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 146/404 (36%), Positives = 242/404 (59%), Gaps = 10/404 (2%)

Query: 1   MS--RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+    ++++D+ +++G R L+R D+NVP IDGK+ D  RI   +PTI +L+    KV++
Sbjct: 46  MAALNKKSVDDI-NVKGQRVLVRCDFNVPLIDGKITDENRIVAALPTIKKLIADGGKVIL 104

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLG+P+ +   + SL  V      +L +++ F  D   +G     ++ ++ +G ++L 
Sbjct: 105 CSHLGKPKGEPKPELSLAPVAVRLAELLGQDVKFAADPEVVGENAKAAVEAMKDGDVVLL 164

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQK 175
           EN R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQK
Sbjct: 165 ENTRYRAEETKNGEAFSKELASLCDVFVNDAFGTAHRAHCSNVGVTEYVDTAVVGYLMQK 224

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  L +     ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  AQG  V
Sbjct: 225 EIDFLGNAVENPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMSYTFTKAQGGSV 284

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G SL + D+      +  +A+    ++++P D +VA E      T+VVS  ++P   + L
Sbjct: 285 GASLLEEDYLQYALDMIKKAEEKGVKLLLPVDTIVADEFSNDANTKVVSRDAIPDGWMGL 344

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G +T +   + +  A+TV+WNGP+G FE+  F   T  VA  +A        ++I GG
Sbjct: 345 DIGPETAKIFAEAVKSAKTVVWNGPMGCFEMPKFAEGTKVVAEALA----NTEAVTIIGG 400

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GD+  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 401 GDSAAAVNQLGFGDKMTHISTGGGASLEFLEGKELPGVAAANDK 444


>gi|113476890|ref|YP_722951.1| phosphoglycerate kinase [Trichodesmium erythraeum IMS101]
 gi|123160489|sp|Q10Z46|PGK_TRIEI RecName: Full=Phosphoglycerate kinase
 gi|110167938|gb|ABG52478.1| phosphoglycerate kinase [Trichodesmium erythraeum IMS101]
          Length = 398

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 163/399 (40%), Positives = 250/399 (62%), Gaps = 7/399 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +T+  L   D+ G + L+R D+NVP  +G + D TRI   +PTI +L EK AKV++
Sbjct: 1   MTK-KTVASLSKSDLSGKKVLMRADFNVPVDNGSITDDTRIRAALPTIQDLTEKGAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH GRP+ K ++   L  V      +L K +   +DCIG  ++ ++A + +G ++L EN
Sbjct: 60  TSHFGRPKGKVNEKMRLTLVGERLSEVLGKEVKKCDDCIGDEVTSTVAEMKDGDVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           VRFYS EE NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +++EL
Sbjct: 120 VRFYSGEEGNDPEFAKQLASVADLYVNDAFGTAHRAHASTEGVTKYLSPSVAGYLIEQEL 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      +KPL AI+GGSKVS+KI ++  L+ K DKL++GGGM  +F  A+G+ VG+
Sbjct: 180 KFLQGAIDSPQKPLAAIIGGSKVSSKIGVIEALLDKCDKLLLGGGMIFTFYKARGLSVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK     +++P DVVVA +      TQ VS +++P   + LD+
Sbjct: 240 SLVEEDKIELAKSLEAKAKEKGVTMLLPTDVVVADKFDPEANTQTVSIEAIPDGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G ++ +  +  +A  +TV+WNGP+GVFE+E F + T  +A  +A    ++  I+I GGGD
Sbjct: 300 GPESAKVFQDALADCKTVIWNGPMGVFEMEKFAKGTEAIAQTLAD---KQDAITIIGGGD 356

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+   G+  + +++ST GGA LE LEGK LPGIVAL
Sbjct: 357 SVAAVEQLGLGEKMSHISTGGGASLELLEGKKLPGIVAL 395


>gi|160947584|ref|ZP_02094751.1| hypothetical protein PEPMIC_01519 [Parvimonas micra ATCC 33270]
 gi|158446718|gb|EDP23713.1| hypothetical protein PEPMIC_01519 [Parvimonas micra ATCC 33270]
          Length = 398

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 165/403 (40%), Positives = 249/403 (61%), Gaps = 10/403 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPF---IDGKVADVTRIERVVPTILELVEKKAKVVI 58
              + + DL ++R  R ++RVD+NVP     +GK+ D  RI   +PTI  L+E  AKV++
Sbjct: 1   MNKKVITDL-EVRSKRVIVRVDFNVPMSKTEEGKITDNARIVAALPTIKYLIENNAKVIL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDC--IGSTLSQSIASLSEGGIILA 116
            SHLGRP+ ++ K+ SL  V      +L+K++ F+     +   +   +  L +G + L 
Sbjct: 60  LSHLGRPKGEAKKEFSLAPVAKELSKLLNKDVKFLQSNLVVDDNVKDEVLKLKDGEVALL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN RF +EE +N  DF + L+  G+ YINDAF  SHRAH S  GL   LPS +G  ++KE
Sbjct: 120 ENTRFRNEETKNIDDFSKELAELGELYINDAFGTSHRAHCSNVGLCKFLPSAVGFLVEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           +S++    S  ++P VAI+GG+KVS KIT++ NL++KVD ++IGGGMA +FL + G  VG
Sbjct: 180 ISIMGKALSNPERPFVAILGGAKVSDKITVIENLIEKVDSIIIGGGMAFTFLKSLGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +AK    +I++P DVVV++E       ++V+  S+  D + LD
Sbjct: 240 KSLLEDDKVDFAKELIEKAKSKNVKILLPIDVVVSKEFSNDSEFKIVNIDSIGDDYMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KTV+     I  A+TV+WNGP+GVFE+  F + T E+A  +A    E   ISI GGG
Sbjct: 300 IGEKTVKLFSDEINNAKTVVWNGPMGVFEMSNFAKGTFEIAKAIA----ESEAISIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+ +A   +G  ++ T++ST GGA LE+LEGK LPGI ++   
Sbjct: 356 DSASAAEKSGYKDKITHISTGGGASLEFLEGKILPGIDSIDNK 398


>gi|304407269|ref|ZP_07388922.1| Phosphoglycerate kinase [Paenibacillus curdlanolyticus YK9]
 gi|304343710|gb|EFM09551.1| Phosphoglycerate kinase [Paenibacillus curdlanolyticus YK9]
          Length = 393

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 147/398 (36%), Positives = 232/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  +G++ D TRI   +PTI  L+E  AKV++ SH
Sbjct: 1   MNKKSVRDV-EVAGKRVFVRVDFNVPLENGQITDDTRIRETLPTIKFLIEGGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  +  ++  L    +    +L K ++  ++ +G  +   +A+L EG ++L ENVRF
Sbjct: 60  LGRPAGQVVEELRLTPAAARLSELLGKPVVKADEAVGEAVKAQVAALKEGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  ++KEL +L 
Sbjct: 120 YPGEESNDPELAKQFAELADLFVNDAFGAAHRAHASTEGIAHQLPAVSGLLVEKELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AIVGGSKV  KI ++  +++  D ++IGGG++ +F  AQG  +G+SL  
Sbjct: 180 KALNNPERPFTAIVGGSKVKDKIDVINKMIEIADNIIIGGGLSYTFFKAQGNEIGKSLVD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D   +   +AK+      +P DVV+  +      TQ+V    +  +   +D+G KT
Sbjct: 240 NSKLDLALEFIEKAKKLGKNFYLPVDVVITDDFSANANTQIVDVDGMLPEWEGIDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E   +VI  ++ V+WNGP+GVFEIEPF   T  VA   A    E    ++ GGGD+  A
Sbjct: 300 REIYSEVIKNSKLVVWNGPMGVFEIEPFSHGTQAVAKACA----ETAGYTVIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
                +++   ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 AEKFHLADRMDHISTGGGASLEFMEGKQLPGVVALNDK 393


>gi|229916591|ref|YP_002885237.1| phosphoglycerate kinase [Exiguobacterium sp. AT1b]
 gi|259530755|sp|C4L5H7|PGK_EXISA RecName: Full=Phosphoglycerate kinase
 gi|229468020|gb|ACQ69792.1| Phosphoglycerate kinase [Exiguobacterium sp. AT1b]
          Length = 394

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 154/399 (38%), Positives = 239/399 (59%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ D++G R   RVD+NVP  DG + D TRI+  +PTI  L++  AK+V+ SH
Sbjct: 1   MNKQSIRDI-DVKGKRVFCRVDFNVPLKDGVIQDETRIQAALPTIKHLLDGGAKLVLASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +   + SL  V      +L K++  V +  G    +++A+LSEG +++ ENVRF
Sbjct: 60  LGRPKGEKKPEFSLAPVAKRLAELLGKDVPLVEEAYGPVAEEAVANLSEGDVVVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSML 180
           Y  E +NDP+  +  +   D Y+NDAF  +HRAHAS  G++H + + + G  M+KEL +L
Sbjct: 120 YPGETKNDPELAKGFAALADVYVNDAFGAAHRAHASTEGIAHHVDTAVAGLLMEKELEVL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               S   +P  AI+GGSKV+ KI ++ +L+  VD L+IGGG++ +F  A G  VG SL 
Sbjct: 180 GKALSNPDRPFTAIIGGSKVADKIGVIDHLLDIVDTLIIGGGLSYTFSKALGHEVGTSLL 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D   Q   +A+    + ++P D V+ +E         V   S+P D + LD+G K
Sbjct: 240 EEDKLDLARQFMKKAEDKGVKFLMPVDCVITKEFGEETYVGPVDIDSIPADHMGLDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVE     I +++ V+WNGP+GVFE++ +   T  VA  +A    +    SI GGGD+  
Sbjct: 300 TVELYADAIRESKLVVWNGPMGVFELDKYANGTKGVAQALA----DSDAYSIIGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A A  G++++ +++ST GGA LE++EGK LPG+ AL+  
Sbjct: 356 AAAKFGLADKMSHISTGGGASLEFMEGKKLPGVEALNDK 394


>gi|85714405|ref|ZP_01045393.1| phosphoglycerate kinase [Nitrobacter sp. Nb-311A]
 gi|85698852|gb|EAQ36721.1| phosphoglycerate kinase [Nitrobacter sp. Nb-311A]
          Length = 398

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 194/400 (48%), Positives = 266/400 (66%), Gaps = 3/400 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   RT++D+ D+RG R LLRVD NVP   G+V D TR+ERV PTI E+ +K  K ++ 
Sbjct: 1   MTNSFRTLDDV-DVRGKRVLLRVDLNVPMEQGRVTDATRLERVAPTIKEIADKGGKAILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+   D   SL  V +    +L K + F +DC+G +  ++I+ + +G I+  EN 
Sbjct: 60  AHFGRPKG-PDPKNSLRPVAAELAKVLGKPVAFADDCVGESAQKAISEMKDGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP Y GR MQ EL  
Sbjct: 119 RFHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPGYAGRTMQAELEA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++A++GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL
Sbjct: 179 LNKALEAPTKPVIAVIGGAKVSTKIDLLENLVNKVDALVIGGGMANTFLHAQGVNIGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D +    +I  +A+ + C II+P D  VA       P+      ++P + +ILDVG 
Sbjct: 239 AEKDLAATALRIMEKAEAANCAIILPVDATVAFHFAANAPSHAYGLDAIPAEGMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++VE +   I  A T++WNGPLG FE+ PFDR TV  A + A+ TK  +++S+AGGGDT+
Sbjct: 299 QSVERVHSAIDDAATLVWNGPLGAFELSPFDRGTVVAAKHAAERTKAGKLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            AL  AG++ +FTYVSTAGGAFLEW+EGK LPG+  L   
Sbjct: 359 AALNQAGVAGDFTYVSTAGGAFLEWMEGKPLPGVEVLRAK 398


>gi|303241064|ref|ZP_07327573.1| Phosphoglycerate kinase [Acetivibrio cellulolyticus CD2]
 gi|302591324|gb|EFL61063.1| Phosphoglycerate kinase [Acetivibrio cellulolyticus CD2]
          Length = 397

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 157/399 (39%), Positives = 238/399 (59%), Gaps = 8/399 (2%)

Query: 1   MS--RLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M+    +T+ D+ D++G + ++RVD+NVP   + K+ D  RI   +PTI  LV+K AK +
Sbjct: 1   MAFINKKTIEDV-DVKGKKVIVRVDFNVPLDENKKITDDNRIVGALPTIKYLVDKGAKTI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+   +   S+         +L K ++   D IG       A+L +G +++ E
Sbjct: 60  LVSHLGRPKDGFEDKYSMKPTAVRLGELLGKEVIMAKDVIGEDAKAKAAALKDGEVLMLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVRF+ EE +ND  F + L+   + Y+NDAF  +HRAH+S  GL+  LP+  G  +QKE+
Sbjct: 120 NVRFHKEETKNDAAFSKELASMAEVYVNDAFGTAHRAHSSTAGLADYLPAVCGYLIQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
            ++    S  ++P VAI+GG+KVS KI ++ NL+ KVD L++GGGMA +F  A+G G+G 
Sbjct: 180 EVMGKALSNPERPFVAILGGAKVSDKIAVIENLIDKVDTLIVGGGMAYTFFKAKGYGIGT 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           S+C+ D  D    +  +A     ++++P D V+ +E       Q V +  +P   + +D+
Sbjct: 240 SICEDDKVDLAKSLLDKAASKGVKLLLPLDNVLGKEFNNDTERQTVDSDKIPDGWMGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KTV      I  A+TV+WNGP+GVFE   F+  T EVA  VA    E   +SI GGGD
Sbjct: 300 GPKTVAAYSSEIKNAKTVVWNGPMGVFEFSNFENGTKEVAKAVA----ESGSVSIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  A+   G +++ T++ST GGA LE+LEGK LPGI  L
Sbjct: 356 SAAAVEQLGFADKITHISTGGGASLEFLEGKVLPGIDVL 394


>gi|303233789|ref|ZP_07320443.1| phosphoglycerate kinase [Finegoldia magna BVS033A4]
 gi|302495223|gb|EFL54975.1| phosphoglycerate kinase [Finegoldia magna BVS033A4]
          Length = 395

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 154/397 (38%), Positives = 242/397 (60%), Gaps = 7/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T+ DL ++   R L+RVD+NVP  +G + D  RIE  + TI  L++  AKV++ SH
Sbjct: 1   MNKKTLKDL-NVENKRVLVRVDFNVPIKEGIITDTNRIEASLTTIKYLIDNNAKVILMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENV 119
           LGRP+ +   + SL  V      ++ +++ F++    +  ++ +    L    I+L +N 
Sbjct: 60  LGRPKGEPKPEFSLKPVAQKLSEMIGQDVKFIDSDKVVDDSVIEESKKLQPKEIMLIQNT 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF  EEE+ND  F + LS+  D Y+NDAF  SHRAHAS  G+S  LPS +G  +QKE+ +
Sbjct: 120 RFRKEEEKNDEKFSKELSQLADLYVNDAFGTSHRAHASNVGVSKFLPSAVGFLVQKEIEI 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P  AI+GG+KVS KI ++ NL+ KVD ++IGG MA +F+ +QG  VG+SL
Sbjct: 180 MGKALENPERPFTAILGGAKVSDKIGVIENLLDKVDTILIGGAMAFTFIKSQGKNVGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D    +  +A+    +I +P D VVA+EM     ++V++      D    D+G 
Sbjct: 240 IEEDKLDLAKSLLEKAQEKGVKIFLPVDFVVAKEMTEESDSKVINIDDFTDDIAGFDIGT 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++   + I +++T++WNGP+GVFEIE F + T E+A+ + K     +  +I GGGD+ 
Sbjct: 300 KTIKIFDEEIQKSKTIVWNGPMGVFEIEQFSKGTFEIANSLVK----SKATTIVGGGDSA 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+A +G  ++ T+VST GGA LE+LEGK LPGI  +
Sbjct: 356 SAIAKSGNKDKVTHVSTGGGASLEFLEGKVLPGIDCI 392


>gi|227824578|ref|ZP_03989410.1| phosphoglycerate kinase [Acidaminococcus sp. D21]
 gi|226905077|gb|EEH90995.1| phosphoglycerate kinase [Acidaminococcus sp. D21]
          Length = 641

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 147/396 (37%), Positives = 237/396 (59%), Gaps = 6/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ +++G + L+RVD+NVP  D G++ D  RI+  +PT+  L+++ A +++ +
Sbjct: 1   MEKKTVRDI-NVKGKKVLVRVDYNVPMNDKGEITDTIRIDATLPTLNYLLDQGAAIILMA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K     SL         ++ K + F  DCIG   +++   L  G I++ EN+R
Sbjct: 60  HLGRPKGKVVPSMSLKPCAEYLSQVMKKEVKFAPDCIGPEATEAARELQPGEILMLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+ND  F   L+   D Y+N+ F VSHRAHAS+ G++H LP+  G  ++KE+  L
Sbjct: 120 FHPEEEKNDMAFAASLASLADIYVNNGFGVSHRAHASVEGVAHYLPAVSGFLLEKEIKYL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +      +P  AIVGG+KV+ KI ++ +L++K D ++IGGGMAN+FL AQG  +G+SL 
Sbjct: 180 GNAVDHPVRPFAAIVGGAKVADKIGVIRSLIEKADIILIGGGMANTFLAAQGYDLGKSLV 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +++  D   ++   AK    ++++P D+ +A            +   +  + + LD+G K
Sbjct: 240 EKESIDVAKELIALAKEKNKKMLLPIDLEMAASFSADSEHASQTLDQLNPEWMALDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T +     +   +T++WNGP+GVFE+ PF   T  VA  +A    +   I+I GGGD+  
Sbjct: 300 TAQLYADTLKNCKTIVWNGPMGVFEMAPFAAGTRRVAEAMA----DNEGITIVGGGDSAA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+ H G+ +   +VST GGA LE+LEGK LPG+ AL
Sbjct: 356 AVKHMGLDSRMKHVSTGGGASLEYLEGKVLPGVAAL 391


>gi|302336048|ref|YP_003801255.1| phosphoglycerate kinase [Olsenella uli DSM 7084]
 gi|301319888|gb|ADK68375.1| phosphoglycerate kinase [Olsenella uli DSM 7084]
          Length = 396

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 150/393 (38%), Positives = 238/393 (60%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G R L+RVD+NVP  DG V D TR+   +PTI  L E+ A +++ SHLGR
Sbjct: 6   KTVRDI-DVAGKRVLMRVDFNVPLKDGVVTDDTRVRAAIPTIKYLKEQGAGIILMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+    + + SL         +   ++ FV+D  G    ++++ +  G I++ ENVRF  
Sbjct: 65  PKGDGPEPELSLRPAAEKLAELTGYDVRFVDDTYGEKAEKAVSEVKPGDILVLENVRFLK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  + L+  GD ++ DAF  +HRA  S+ G +  +P+  G  ++KE+  L S 
Sbjct: 125 AEKKNDPEVAKKLASYGDVFVLDAFGTAHRAQGSVVGPAAYIPAVAGFLLEKEVDTLTSI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           F++  +P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G  VG SL + D
Sbjct: 185 FADPARPFVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAKGYAVGTSLKEED 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+    +I++P D VVA         +VV +  +P D + +D+G KT  
Sbjct: 245 WVERAAEMLKKAEDKGVKILLPVDNVVADHFGEDAEGEVVDSDKIPDDRMGMDIGPKTCA 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I  A+TV WNGP+GVFE++ F + T  VA  VA    +    SI GGGD++ A+ 
Sbjct: 305 LYVEAIKGAKTVFWNGPMGVFEMDQFAKGTEAVARAVA----DSDCTSIIGGGDSVAAIN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              ++++ +++ST GGA +E +EGK LPG+ AL
Sbjct: 361 KFDLADKMSWISTGGGASMELVEGKALPGVEAL 393


>gi|307111054|gb|EFN59289.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
          Length = 399

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 163/401 (40%), Positives = 248/401 (61%), Gaps = 8/401 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M++ +++ DL   D+ G    +R D NVP    K+ D TRI   VPT+  LV+  AKV++
Sbjct: 1   MAK-KSVGDLSKADLEGKVVFVRADLNVPLDGDKITDDTRIRAAVPTLKYLVDNGAKVLL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP+   +    L  VV     ++   +    DCIG  ++  +A +S G ++L EN
Sbjct: 60  TSHLGRPKKGPEDKFRLTPVVGRLSELMGAAVEKAEDCIGEAVTSKLAKMSNGSVLLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           VRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKEL
Sbjct: 120 VRFYPEEEKNDPEFAKKLAAPADLYVNDAFGTAHRAHASTEGVTKFLSPSVAGFLLQKEL 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+   +  K+P VAIVGGSKVS+KI ++ +L+ K DK+++GGGM  +F  A+G+ VG 
Sbjct: 180 DYLDGAVTTPKRPFVAIVGGSKVSSKIGVIESLLAKCDKIILGGGMIFTFYKAKGLAVGG 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +   ++  +AK    E ++P DV+VA +      TQVV   ++P   + LD+
Sbjct: 240 SLVEEDKLELALELMEKAKAKGVEFVLPTDVIVADKFAPDAATQVVDVTAIPDGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G K+++ +K  +  A+TV+WNGP+GVFE + F + T  +A+ +A +      I+I GGGD
Sbjct: 300 GPKSIDLLKDTLKGAKTVIWNGPMGVFEFDAFAKGTFAIANELAAMD---DCITIIGGGD 356

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLP-GIVALS 397
           ++ A+  AG++ + +++ST GGA LE LEGK LP G+ AL+
Sbjct: 357 SVAAVEKAGVAEKMSHISTGGGASLELLEGKVLPAGVAALN 397


>gi|251794214|ref|YP_003008945.1| phosphoglycerate kinase [Paenibacillus sp. JDR-2]
 gi|247541840|gb|ACS98858.1| Phosphoglycerate kinase [Paenibacillus sp. JDR-2]
          Length = 393

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 151/398 (37%), Positives = 234/398 (58%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DGK+ D  RI   +PTI  L+EK AKV++ SH
Sbjct: 1   MNKKSVRDV-EVAGKRVFVRVDFNVPLEDGKITDDKRIRETLPTINYLIEKGAKVILASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  +  ++            +L K ++  ND +G  +   I +L+ G ++L ENVRF
Sbjct: 60  LGRPNGEVVEELRHTASAVRLSELLGKPVVKANDSVGEEVKAQINALNNGDVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           ++ EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M++EL +L 
Sbjct: 120 HAGEEKNDPELAKQFAELADLFVNDAFGAAHRAHASTEGIAHHLPAVSGLLMERELDVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              +  ++P  AIVGGSKV  KI ++  +++  D ++IGGG++ +F  AQG  +G+SL  
Sbjct: 180 KALNNPERPFTAIVGGSKVKDKIDVINKMIEIADNIIIGGGLSYTFFKAQGHEIGQSLVD 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D   +   +AK      ++P D+VV  E      T++V    +P D   +D+G KT
Sbjct: 240 NSKLDLALEFIEKAKTLGKNFLIPVDIVVTDEFSKDANTKIVDVDGIPADWEGIDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            E    VI  ++ V+WNGP+GVFEIEPF   T  VA+  A    E    ++ GGGD+  A
Sbjct: 300 REIYADVIKNSKLVVWNGPMGVFEIEPFSHGTRAVANACA----ETAGYTVIGGGDSAAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
               G++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 356 AEKFGVADKMDHISTGGGASLEFMEGKALPGVVALNDK 393


>gi|116071998|ref|ZP_01469266.1| phosphoglycerate kinase [Synechococcus sp. BL107]
 gi|116065621|gb|EAU71379.1| phosphoglycerate kinase [Synechococcus sp. BL107]
          Length = 401

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 160/402 (39%), Positives = 244/402 (60%), Gaps = 6/402 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +LV K AKVV
Sbjct: 1   MAK-RSLASLNAGDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVV 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +   + CIG      + +++ G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAARLSELLGKTVTKTDSCIGPDAEAKVGAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+ND  F   L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNDAGFAEKLAGLADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    E+++P DVV+A        +Q+    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQIADVTAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   ++  +  +A  +TV+WNGP+GVFE + F   T  +A  +A++  +    +I GGG
Sbjct: 300 IGPDAIKVFQAALADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAEIGGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL  
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALDN 400


>gi|51891380|ref|YP_074071.1| phosphoglycerate kinase [Symbiobacterium thermophilum IAM 14863]
 gi|81692233|sp|Q67SW6|PGK_SYMTH RecName: Full=Phosphoglycerate kinase
 gi|51855069|dbj|BAD39227.1| phosphoglycerate kinase [Symbiobacterium thermophilum IAM 14863]
          Length = 392

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 172/398 (43%), Positives = 251/398 (63%), Gaps = 10/398 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+ + T+ D+ D++G R  +RVD+NVP  DG++ D TRI   VPTI  LVE+ A  V+ S
Sbjct: 1   MALM-TVRDI-DVKGKRVFVRVDFNVPLEDGRITDDTRIRAAVPTIRYLVEEGAVAVLAS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + ++  SL         +L + ++F  DCIG  + + +A    G ++L ENVR
Sbjct: 59  HLGRPKGQRNEKYSLAPCARRLSELLGREVVFAPDCIGEEVERLVAEQPPGSVVLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           FY+EEE+NDP+F   L+R G+ ++NDAF  +HRAHAS  G+  H+     G  MQKE+ +
Sbjct: 119 FYAEEEKNDPEFAAKLARLGEIFVNDAFGTAHRAHASTRGVADHMPVRVAGFLMQKEVDI 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +    S+  +P VAI+GG+KVS KI ++ NL+ KVD+L+IGGGMAN+FL A+G   G+SL
Sbjct: 179 MGKALSDPDRPFVAIIGGAKVSDKIMVIENLLTKVDRLIIGGGMANTFLRARGFATGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D    V        +   +I++P D+VVA E K     +VV   ++P   + LD+G 
Sbjct: 239 VEED---RVDTARELLAKGGDKILLPTDLVVASEFKADAEQKVVPVDAIPEGWMALDIGP 295

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T      VI  A TV+WNGP+GVFE+EPF R T  VA  +A        ++I GGGD++
Sbjct: 296 ETARAFADVIRGAHTVVWNGPMGVFEMEPFARGTFAVAQAMADC----EGVTIVGGGDSV 351

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+  AG+++  T+VST GGA LE+LEGK+LPG+  L+
Sbjct: 352 AAVEAAGLADRMTHVSTGGGASLEFLEGKELPGVACLA 389


>gi|21675031|ref|NP_663096.1| phosphoglycerate kinase [Chlorobium tepidum TLS]
 gi|30173004|sp|Q8KAE1|PGK_CHLTE RecName: Full=Phosphoglycerate kinase
 gi|21648266|gb|AAM73438.1| phosphoglycerate kinase [Chlorobium tepidum TLS]
          Length = 397

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 162/398 (40%), Positives = 256/398 (64%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
            + +T++D+  ++G R L+RVD+NVP   D  + D  RI   +P+I ++++   ++++ S
Sbjct: 1   MQKKTLSDIS-LQGKRVLMRVDFNVPLDQDRNITDEKRIVEALPSIRKVIDNGGRLILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K +   SL  V      +L   +    DCIG+ + Q + +L +G +++ EN+R
Sbjct: 60  HLGRPKGKVNPAFSLSPVAKRLSELLDCPVTMAGDCIGTEVMQQVLALQDGDVLMLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSM 179
           F+ EEE NDPDF R L+  G+ Y+NDAF  +HRAHAS  G++H + + + G  ++KEL  
Sbjct: 120 FHPEEEANDPDFARELASLGEIYVNDAFGTAHRAHASTEGITHFMQTAVAGYLIEKELRY 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +  +++++P VAI+GG+K+S KI +L +L +KVD +++GG M  +F  AQG+ VG SL
Sbjct: 180 LGTALNDAQRPFVAILGGAKISGKIDVLESLFEKVDTVLVGGAMVFTFFKAQGLDVGNSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + +  +    +  +AK     +++P DVVVA E+    P++V    ++    I LD+G 
Sbjct: 240 VEENKLELAVSLLEKAKAKNVRLLLPEDVVVAGEISADAPSRVEPVSAISAGMIGLDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            T+E  ++ I  A+TV+WNGP+GVFEI+ F R T  VA  +A  T E   I+I GGGD+ 
Sbjct: 300 ATIETYRKEILDAKTVLWNGPMGVFEIDQFARGTFAVAQALADATAE-GAITIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+A AG+S++ T+VST GGA LE+LEGK+LPGI AL+
Sbjct: 359 AAIAKAGLSDKVTHVSTGGGASLEFLEGKELPGIAALN 396


>gi|91978773|ref|YP_571432.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisB5]
 gi|91685229|gb|ABE41531.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisB5]
          Length = 398

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 196/397 (49%), Positives = 274/397 (69%), Gaps = 3/397 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++  RT++D+ D++G R LLRVD NVP   GKV D TR+ERVVPTI E+  K  KV++ 
Sbjct: 1   MTKSFRTLDDV-DVKGKRVLLRVDLNVPMDAGKVTDATRLERVVPTITEIAGKGGKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+   D+  SL  V +    ++ K + F  DCIG   +++IA++ +G ++  EN 
Sbjct: 60  AHFGRPKG-RDEKNSLKPVAAALADVIKKPVAFAEDCIGEPAAKAIAAMQDGDVLCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L+  GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ E+  
Sbjct: 119 RFHPEEEKNDPGFVAKLAELGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAEIVA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        +P++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SL
Sbjct: 179 LNKALEAPTRPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D ++   +I  +A+ + C II+P D  VA   +   P+      ++P D++ILDVG 
Sbjct: 239 CEKDLAETALRILNKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPPDAMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +++E I   I  A T++WNGP+G FE+ PFD+ TVE A + A+ TK   ++S+AGGGDT+
Sbjct: 299 RSIERIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAARRTKAGSLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AL HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 359 AALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|83859959|ref|ZP_00953479.1| phosphoglycerate kinase [Oceanicaulis alexandrii HTCC2633]
 gi|83852318|gb|EAP90172.1| phosphoglycerate kinase [Oceanicaulis alexandrii HTCC2633]
          Length = 395

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 187/394 (47%), Positives = 259/394 (65%), Gaps = 1/394 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +R + D  DI G R L+RVD+NVP  +G V+D TR+   +PTI  L E  AKV++ +H G
Sbjct: 2   IRRIED-ADIAGKRVLVRVDFNVPMQNGSVSDDTRLRAALPTIEHLREAGAKVILMAHFG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  V +    ++   + FV+DC+GS    +I+ +  G ++L EN RF+ 
Sbjct: 61  RPKGQRNPEMSLAPVATPLAELIGHPVKFVSDCVGSDPKGAISLMKAGDVLLLENTRFHE 120

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP F   L+   D Y+NDAFS +HRAHAS  G++ LLP+Y G A+Q+E+  + + 
Sbjct: 121 GEEKNDPAFAAQLAELADVYVNDAFSAAHRAHASTEGVARLLPAYAGLALQREIDHVTAA 180

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                +P++A+VGG+KVSTKI LL NLVKKVD+L +GG MAN+FL A+G  VG SL +RD
Sbjct: 181 LENPNRPVLAVVGGAKVSTKIELLKNLVKKVDRLFVGGAMANTFLAARGHDVGGSLYERD 240

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    I   A  + C+I++P D VVA+E K     +V     +    +ILD G +TV+
Sbjct: 241 LIDTAKAIEDAAGEAQCQILLPTDAVVAKEFKAHADRRVAEVDDIQATEMILDCGPETVD 300

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            +   IA +RT++WNGPLG FE  PFD ATVE A Y A   KE  + ++AGGGDT+ AL 
Sbjct: 301 QLADAIAASRTLVWNGPLGAFETPPFDTATVEAARYAASRCKEHGLTAVAGGGDTVAALN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AG+S++FT+VSTAGGAFLEWLEGK LPG+ AL 
Sbjct: 361 QAGVSDDFTFVSTAGGAFLEWLEGKALPGVEALK 394


>gi|124024984|ref|YP_001014100.1| phosphoglycerate kinase [Prochlorococcus marinus str. NATL1A]
 gi|166987795|sp|A2C025|PGK_PROM1 RecName: Full=Phosphoglycerate kinase
 gi|123960052|gb|ABM74835.1| Phosphoglycerate kinase [Prochlorococcus marinus str. NATL1A]
          Length = 401

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 155/400 (38%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ R+++ L   D+ G R L+RVD+NVP   +G++ D TRI   +PTI +L++K A+V+
Sbjct: 1   MSK-RSLSSLGAEDLCGKRVLVRVDFNVPLGDEGQITDDTRIRAALPTINDLLDKSARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V      +L K ++    CIG+     + ++S G ++L E
Sbjct: 60  LSAHFGRPKGEVNETMRLTAVAQRLSELLGKTVVKTESCIGAEAKSKVDAMSNGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF S EE+ND +F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 120 NVRFISGEEKNDTEFAKELASLAEVYVNDAFGAAHRAHASTEGVTKFLSPCVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    + K PL AIVGGSKVS+KI +L +L+ K DK+++GGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDQPKSPLAAIVGGSKVSSKIGVLESLIDKCDKIIVGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK    E ++P DVV+A        +++    ++    + LD
Sbjct: 240 NSLVEEDKLELASALEKKAKEKGVEFLLPTDVVLADNFSPDANSKLSKVDAISEGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++VE  +  +   +TV+WNGP+GVFE E F   T  +A+ +A+L+ +    +I GGG
Sbjct: 300 IGSESVELFQNALKDCKTVIWNGPMGVFEFEKFANGTNAIANTLAELSAQGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++   +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAKNMSHISTGGGASLELLEGKVLPGVSAL 398


>gi|150391311|ref|YP_001321360.1| phosphoglycerate kinase [Alkaliphilus metalliredigens QYMF]
 gi|149951173|gb|ABR49701.1| Phosphoglycerate kinase [Alkaliphilus metalliredigens QYMF]
          Length = 399

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 159/402 (39%), Positives = 239/402 (59%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M   +++ D   I G + L+R D+NVP   +GK+ D  RI   +PT+  L+E KA V++ 
Sbjct: 3   MLNKKSVKDQV-IEGKKVLVRCDFNVPMDKEGKITDDIRIRGAMPTVEYLLENKAAVILM 61

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SHLGRP+ ++    SL  V      +L K ++F +D   IG    +    L+ G ++L +
Sbjct: 62  SHLGRPKGEAQAKFSLKPVADRISQLLGKEVIFADDDVVIGERTKELAKQLAPGQVLLLQ 121

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKEL 177
           NVR+  EEE+N+  F + L+   D Y+NDAF  +HRAHAS  G++  LP+ +G  ++KE+
Sbjct: 122 NVRYRKEEEKNEEAFSKELASLADLYVNDAFGTAHRAHASTAGVAKFLPATMGFLIEKEV 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             +       ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +FL A G  +G 
Sbjct: 182 DFMGKALEAPERPFVAILGGAKVSDKIGVIENLIDKVDVLLIGGGMAYTFLKAMGYEIGT 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + +  D    +  +A+ +  ++++P D VVARE K       VS +S+P D + LD+
Sbjct: 242 SLLEAEKVDLAKMLIKKAQANHVDLLLPIDTVVAREFKADATYDTVSIESMPKDMMGLDI 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  T+    + I  A+TV+WNGP+GVFE+  F   T EVA  +A    E   I+I GGGD
Sbjct: 302 GKDTISLFTEKIKTAKTVIWNGPMGVFEMPAFAVGTKEVARAMA----ENDAITIVGGGD 357

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A    G +++ +++ST GGA LE+LEGK LPGI  L   
Sbjct: 358 SAAAAEQLGFADQMSHISTGGGASLEFLEGKILPGIDVLENK 399


>gi|138896643|ref|YP_001127096.1| phosphoglycerate kinase [Geobacillus thermodenitrificans NG80-2]
 gi|134268156|gb|ABO68351.1| 3-phosphoglycerate kinase [Geobacillus thermodenitrificans NG80-2]
          Length = 384

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 161/386 (41%), Positives = 233/386 (60%), Gaps = 3/386 (0%)

Query: 14  RGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDC 73
           RG R   RVD+NVP  DG + D TRI   +PTI  L+E  AKV++ SHLGRP+ K  ++ 
Sbjct: 2   RGKRVFCRVDFNVPMEDGAITDDTRIRAALPTIQYLIEHGAKVILASHLGRPKGKVVEEL 61

Query: 74  SLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFV 133
            L  V      +L + ++  N+ IG  +  ++A+L+EG ++L ENVRFY  EE+NDP+  
Sbjct: 62  RLDAVAKRLGELLERPVVKTNEAIGDEVKAAVANLNEGDVLLLENVRFYPGEEKNDPELA 121

Query: 134 RMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVA 193
           R  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KE+ +L    S   +P  A
Sbjct: 122 RAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKEIEVLGKALSNPDRPFTA 181

Query: 194 IVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAW 253
           I+GG+KV  KI ++ NL+ KVD L+IGGG+A +F+ A G  VG+SL + D  +       
Sbjct: 182 IIGGAKVKDKIGVIENLLDKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDKIELAKSFME 241

Query: 254 EAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQAR 313
           +AK       +P DVVVA        T+VV   ++P D   LD+G +T E  + VI Q++
Sbjct: 242 KAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPSDWEALDIGPQTRELYRDVIRQSK 301

Query: 314 TVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTY 373
            V+WNGP+GVFE+E F   T  VA     L +     S+ GGGD+  A+    ++++  +
Sbjct: 302 LVVWNGPMGVFEMETFSHGTRAVA---EALAEAADTYSVIGGGDSAAAVEKFDLADKMDH 358

Query: 374 VSTAGGAFLEWLEGKDLPGIVALSGH 399
           +ST GGA LE++EGK LPG+VAL+  
Sbjct: 359 ISTGGGASLEFMEGKQLPGVVALNDK 384


>gi|309388869|gb|ADO76749.1| phosphoglycerate kinase [Halanaerobium praevalens DSM 2228]
          Length = 394

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 168/393 (42%), Positives = 253/393 (64%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D +G + L+RVD+NVP  DG V D TRI+  +PTI  L++++AKV++ SHLGR
Sbjct: 3   KTLKDM-DFKGKKVLVRVDFNVPLKDGVVGDKTRIKAALPTIEYLIKEEAKVLLISHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P  +   D  +  V     ++L+K +   +DCIG  L ++  +L  G ++L EN RFY+ 
Sbjct: 62  PGGEVKSDLKMDPVAKALANLLNKEVKKADDCIGDELKKAANNLENGEVLLLENSRFYAG 121

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           E++NDP+F + L+   D Y+NDAF  +HRAHA+  G++  LP+  G  MQ+EL+ L    
Sbjct: 122 EKKNDPEFAKKLASLADLYVNDAFGAAHRAHATTVGVTEYLPAAAGFLMQRELNALGEVM 181

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
                P VAI+GG+KVS KI ++ NL+ KVDKL++ GG+AN+FL+A+G  VG SL + D 
Sbjct: 182 ENPASPFVAIMGGAKVSDKIDVIKNLINKVDKLIVAGGIANTFLLAKGYEVGDSLVEADK 241

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV-GFKTVE 303
            +   ++  EA+    EI++P DVV+A +      T+ VS + VP    ILD  G +++E
Sbjct: 242 VELAKELMAEAEEKGVEIVLPIDVVIADDFSNDANTKTVSVEKVPAGWQILDCGGPQSLE 301

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
             K++I  A+TV+WNGPLGVFE+E F   TVE+A  +A    E    S+ GGGD+  A+ 
Sbjct: 302 NYKEIIKTAKTVIWNGPLGVFEMEKFAHGTVELAKALA----ESDAHSVIGGGDSAAAIN 357

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AG++ + +++ST GGA L + EGK+LPG+ AL
Sbjct: 358 EAGVAEKMSHISTGGGASLMFFEGKELPGVAAL 390


>gi|291548067|emb|CBL21175.1| 3-phosphoglycerate kinase [Ruminococcus sp. SR1/5]
          Length = 398

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 139/402 (34%), Positives = 232/402 (57%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  DGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGQKVLVRCDFNVPLQDGKITDENRLVAALPTIKKLIADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++A + +G ++L EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADPEVVGPNAKAAVAEMKDGDVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N+  F   L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNEDKFSEDLASLCDVFVNDAFGTAHRAHCSNVGVTKYVKTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  +G 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMSYTFSKAMGGHIGT 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+      +  +A+    ++++P D  +          QVV    +P     +D+
Sbjct: 240 SLCEDDYLQYALDMMKKAEEKGVKLLLPVDNRIGDNFSNDCNIQVVKRGEIPDGWEGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    E    +I GGGD
Sbjct: 300 GPETEKLFADAVKDAKTVVWNGPMGCFEMPNFAHGTEAVAKALA----ETDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNILGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|167747913|ref|ZP_02420040.1| hypothetical protein ANACAC_02643 [Anaerostipes caccae DSM 14662]
 gi|317473575|ref|ZP_07932864.1| phosphoglycerate kinase [Anaerostipes sp. 3_2_56FAA]
 gi|167652644|gb|EDR96773.1| hypothetical protein ANACAC_02643 [Anaerostipes caccae DSM 14662]
 gi|316898865|gb|EFV20890.1| phosphoglycerate kinase [Anaerostipes sp. 3_2_56FAA]
          Length = 397

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 141/402 (35%), Positives = 237/402 (58%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  DGK+ D  R+   +PT+ +L+    K+++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLQDGKITDENRLVAALPTLKKLIADGGKLILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V +    +L + + F  D   +G     +  ++ +G +IL +N
Sbjct: 60  HLGKPKGEPKPELSLAPVAARLSELLGQEVKFAADDNVVGPNAKAAADAMQDGDVILLQN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEEFSKELAGLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P+VAI+GG+KVS+KI+++ NL+ KVD L+IGGGMA +F+ A G  VG 
Sbjct: 180 DFLGNAVNNPERPMVAILGGAKVSSKISVINNLLDKVDTLIIGGGMAYTFMKALGEEVGD 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ D   ++  +AK     +++P D VVA +       + V    +      LD+
Sbjct: 240 SLLEADYLDYAKEMMDKAKEKGVNLLIPVDTVVADDFSNDANIKTVERGGIEAGWQGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT       +  A+TV+WNGP+G FE+  F   TV VA  +A++       +I GGGD
Sbjct: 300 GPKTRALFADALKDAKTVVWNGPMGCFEMPNFAAGTVAVAEALAEI----DATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNQLGFGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|115526713|ref|YP_783624.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisA53]
 gi|115520660|gb|ABJ08644.1| phosphoglycerate kinase [Rhodopseudomonas palustris BisA53]
          Length = 398

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 193/398 (48%), Positives = 269/398 (67%), Gaps = 3/398 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++  +T++D  D++  R LLRVD NVP   G V D TR+ER++PTI+E+ +K  KV++ 
Sbjct: 1   MTKTFKTLDD-ADLKSKRVLLRVDLNVPMDKGVVTDDTRLERILPTIVEIADKGGKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +HLGRP+   D   SL  V +    +L + + F  DCIG   S +IA++ +G I+  EN 
Sbjct: 60  AHLGRPKG-VDPKESLKPVAAALAVVLKRPVGFAADCIGEVASSAIAAMQDGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+  EE+NDP FV  L++ GD ++NDAFS +HRAHA+  GL H LP+Y GR MQ E+  
Sbjct: 119 RFHKGEEKNDPAFVDELAKLGDLWVNDAFSAAHRAHATTEGLGHKLPAYAGRTMQAEIDA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        +P++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG+GVG+SL
Sbjct: 179 LNKALEAPTRPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGIGVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D +    +I  +A+ + C II+P D  VA       P+Q     ++P D +ILDVG 
Sbjct: 239 CEKDLAATALRILTKAEAANCAIILPVDATVAFHFAANAPSQAYGLDAIPADGMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            ++E I   I  A T++WNGP+G FE+ PFD+ TV  A++ A  TK  ++IS+AGGGDT+
Sbjct: 299 LSIERINAAIDDAATLVWNGPVGAFELTPFDKGTVSAANHAAARTKAGKLISVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            AL  AG++++FTY+STAGGAFLEW+EGK LPG+  L 
Sbjct: 359 AALNQAGVADQFTYISTAGGAFLEWMEGKPLPGVEVLK 396


>gi|186491325|ref|NP_001117503.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|332195236|gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 405

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 165/400 (41%), Positives = 251/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV+
Sbjct: 1   MAK-KSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   ++  +DCIG  +   +ASL EGG++L E
Sbjct: 60  LSTHLGRPKG-VTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+PDF + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 119 NVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 179 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 239 SSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+   + +   +TV+WNGP+GVFE E F + T  VA+ +A+L+K + + +I GGG
Sbjct: 299 IGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK-KGVTTIIGGG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++   +++ST GGA LE LEGK LPG+VAL
Sbjct: 358 DSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVAL 397


>gi|15223484|ref|NP_176015.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|332278232|sp|P50318|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags:
           Precursor
 gi|12321760|gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|15810505|gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|20466264|gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|23198084|gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gi|332195235|gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 478

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 165/400 (41%), Positives = 251/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV+
Sbjct: 74  MAK-KSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVI 132

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   ++  +DCIG  +   +ASL EGG++L E
Sbjct: 133 LSTHLGRPKG-VTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLE 191

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+PDF + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 192 NVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 251

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 252 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 311

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 312 SSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLD 371

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+   + +   +TV+WNGP+GVFE E F + T  VA+ +A+L+K + + +I GGG
Sbjct: 372 IGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK-KGVTTIIGGG 430

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++   +++ST GGA LE LEGK LPG+VAL
Sbjct: 431 DSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVAL 470


>gi|110802225|ref|YP_698622.1| phosphoglycerate kinase [Clostridium perfringens SM101]
 gi|123341809|sp|Q0STD5|PGK_CLOPS RecName: Full=Phosphoglycerate kinase
 gi|110682726|gb|ABG86096.1| phosphoglycerate kinase [Clostridium perfringens SM101]
          Length = 397

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 148/403 (36%), Positives = 240/403 (59%), Gaps = 10/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +T+ D++ ++G + L+R D+NVP  DG + D  R+   +PTI  LV+  A+V++ 
Sbjct: 1   MNFNKKTIEDVQ-VKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAQVILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SH+G+P+ ++  + SL  V      +L K ++F  D   +G    +++A + +G ++L +
Sbjct: 60  SHMGKPKGEAKPEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQ 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKE 176
           N R+  EE +N  +  + L+   + ++NDAF  +HRAH S  G++  L     G  +QKE
Sbjct: 120 NTRYRKEETKNGEELSKELASLAEMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L       ++P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  VG
Sbjct: 180 LKFLGDAVETPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +A+    ++++P D  VA+E K  +   V   Q++    + LD
Sbjct: 240 SSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKD-VEAVVTEDQNIAEGFMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT     + I  A+TV+WNGP+GVFE E F++ T+ VA  +A+        +I GGG
Sbjct: 299 IGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEA----DATTIIGGG 354

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ +++ST GGA LE+LEGK LPGI AL+  
Sbjct: 355 DSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK 397


>gi|86605036|ref|YP_473799.1| phosphoglycerate kinase [Synechococcus sp. JA-3-3Ab]
 gi|123507822|sp|Q2JXF0|PGK_SYNJA RecName: Full=Phosphoglycerate kinase
 gi|86553578|gb|ABC98536.1| phosphoglycerate kinase [Synechococcus sp. JA-3-3Ab]
          Length = 412

 Score =  366 bits (939), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 169/412 (41%), Positives = 245/412 (59%), Gaps = 17/412 (4%)

Query: 1   MSRLRTMNDLR----DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAK 55
           M++ +T+  L     D++G R L+R D+NVP    G + D TRI   +PTI  L +  AK
Sbjct: 1   MAK-QTLGSLLSSGFDLKGKRVLVRADFNVPLDPQGNITDDTRIRASLPTIQALAQAGAK 59

Query: 56  VVIFSHLGRPQSKSD---------KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIA 106
           V++ SHLGRP  K           +  SL  V      +L + + F  DCIG      ++
Sbjct: 60  VILTSHLGRPIQKDKATGAIQIAREGNSLAPVAVRLAQLLGQPVAFAPDCIGPEAEAVVS 119

Query: 107 SLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP 166
           SL  G + L ENVRF+ EEE NDP+F R L+   D ++NDAF  +HRAHAS  G++  L 
Sbjct: 120 SLENGQVALLENVRFHPEEEANDPEFARKLASLADLFVNDAFGSAHRAHASTAGVTAYLQ 179

Query: 167 SYI-GRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMAN 225
             + G  ++KEL  L       ++PL AI+GGSKVSTKI ++  L++KVDKL++GGGM  
Sbjct: 180 PAVAGYLVEKELQFLSGAIENPQRPLAAIIGGSKVSTKIGVIERLLEKVDKLLLGGGMIF 239

Query: 226 SFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA 285
           +F  AQG+  G+SL + D  D    +  +AK    E+++P DVVVA         Q VS 
Sbjct: 240 TFYQAQGIPTGKSLVETDKLDLARSLMEKAKARGVELLLPVDVVVADRFDKDANAQTVSI 299

Query: 286 QSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTK 345
            ++P D + LD+G ++V+  +  +   +TV+WNGP+GVFE + F   T  +A  +A LT+
Sbjct: 300 HAIPEDWMGLDIGPESVKAFQAALQGCKTVVWNGPMGVFEFDRFAAGTEAIARTLADLTQ 359

Query: 346 ERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
               I+I GGGD++ A+   G++++ T++ST GGA LE LEGK+LPGI ALS
Sbjct: 360 A-GAITIIGGGDSVAAVEKVGLADKMTHISTGGGASLELLEGKELPGIAALS 410


>gi|218290984|ref|ZP_03495032.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius LAA1]
 gi|218239066|gb|EED06270.1| Phosphoglycerate kinase [Alicyclobacillus acidocaldarius LAA1]
          Length = 395

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 158/401 (39%), Positives = 244/401 (60%), Gaps = 8/401 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIF 59
           M + +T+ D+   +G R L+RVD+NVP  D + + D TRI   +PTI  L +  A+V++ 
Sbjct: 1   MPK-KTVEDVA-WQGKRALVRVDFNVPMDDARRITDDTRIRAALPTITYLSDHGARVILM 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESI-LHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           SHLGRP+ + +   SL  V     S+  +K + F    IG     ++++L++G I+L EN
Sbjct: 59  SHLGRPKGEPNSKYSLQPVAEHLASLLPNKRVSFCPAAIGEEAQAAVSALADGDILLLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRFY  EE+NDP F R L+  GD ++NDAF  +HRAHAS  G++  LP   G  M+KE+ 
Sbjct: 119 VRFYPGEEKNDPAFARQLADLGDVFVNDAFGSAHRAHASTAGIAEYLPCVAGFLMEKEVG 178

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
           ++    +  ++P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMAN+FL  +G  + +S
Sbjct: 179 IMGKALANPERPFVAIIGGAKVSDKIKVIENLLPKVDALIIGGGMANTFLTVEGHDMAKS 238

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  D   ++   A+ S  ++++P DVV A+         V     +  D + LD+G
Sbjct: 239 LVEEDAKDTARRLLDLARASNRKLLLPVDVVAAKAFAPDAEHAVRLVSELQPDEMALDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             +VE  +  I  A+TV+WNGP+GVFE+  F + T  +A  +A+        +I GGGD+
Sbjct: 299 PASVEMFRNEILGAKTVIWNGPMGVFEMPAFAKGTFAIAQTMAEA----DATTIVGGGDS 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           + A+  AG++++ T+VST GGA LE+LEG+ LPG+  +   
Sbjct: 355 VAAVEQAGVADKMTHVSTGGGASLEFLEGRTLPGVAVIEDK 395


>gi|116327981|ref|YP_797701.1| phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|122284227|sp|Q052H7|PGK_LEPBL RecName: Full=Phosphoglycerate kinase
 gi|116120725|gb|ABJ78768.1| Phosphoglycerate kinase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 396

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 158/398 (39%), Positives = 250/398 (62%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             L  + ++ D+ G R  LRVD+NVP  +GKV D TRIE+ +PTI  L++K A+++I SH
Sbjct: 1   MELPRLENV-DLSGKRVFLRVDFNVPIENGKVTDKTRIEKTLPTIELLIKKGARIIIASH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ +++ + SL  VV + + ++  N+ F    IG    +    L +G I++ ENVRF
Sbjct: 60  LGRPKGQTNPEFSLAPVVEVFKGLVKSNVYFSKTVIGDEPIKLSKELRDGEILVIENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EEE N+P F + L+   D Y+NDAF  +HRAHAS  G++HLLP+Y G  M KE+  L 
Sbjct: 120 HKEEEENEPGFSKKLAALADVYVNDAFGAAHRAHASTEGIAHLLPAYAGLLMHKEIVELS 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +  ++  +P VAI+GGSKVS+KI +L NL  KV+ L+IGGGMA +FL ++ + VG SL +
Sbjct: 180 ALLAKPARPFVAIIGGSKVSSKIKVLNNLFDKVNHLLIGGGMAYTFLKSRAVPVGNSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           +DF     Q+  +A  +  ++ +P D ++  +      T+ V    +    + +D+G KT
Sbjct: 240 KDFEVQAFQLIEKAGVAGVDLQLPVDHIIGDQFNEKAKTKSVDKMGILDGWMGMDIGSKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V   +++I  A T+ WNGP+GVFE++ F   T+ +A  ++K     +  ++ GGGD+I A
Sbjct: 300 VSNYEKIIKNAGTIFWNGPMGVFEMDKFTGGTMAIAKAISK----SKAKTVVGGGDSIAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A ++++ T++ST GGA LE++EG+ LPG+ AL   
Sbjct: 356 INKAKVADKITHISTGGGASLEFMEGRKLPGVEALKKK 393


>gi|282901400|ref|ZP_06309325.1| Phosphoglycerate kinase [Cylindrospermopsis raciborskii CS-505]
 gi|281193679|gb|EFA68651.1| Phosphoglycerate kinase [Cylindrospermopsis raciborskii CS-505]
          Length = 400

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 165/400 (41%), Positives = 249/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +++  L   DI   R L+RVD+NVP  + G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MSK-KSLASLSAADISDKRALVRVDFNVPVDNQGNITDDTRIRAALPTIQDLISKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+   D+   L  V      +L + ++  +DCIG  ++  +A+L +G ++L E
Sbjct: 60  LASHFGRPKG-VDEKLRLTPVAKRLSELLGQEVIKTDDCIGDDVTTQVAALEKGQVLLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F R L+ N DFY+NDAF  +HRAHAS  G++    PS  G  ++KE
Sbjct: 119 NVRFYKEEEKNDPEFARQLAANADFYVNDAFGTAHRAHASTEGVTKYLSPSVAGYLVEKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      ++PLVAI+GGSKVS+KIT++  L++K DKL+IGGGM  +F  A+G+ VG
Sbjct: 179 LQYLQGAIEVPQRPLVAIIGGSKVSSKITVIETLLEKCDKLIIGGGMIFTFYKARGLNVG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D       +  +A      +++P D+V A           VS   +P D + LD
Sbjct: 239 KSLVEDDKLVLASSLEKKAAERGVTLLLPTDIVAANTFAPDADAVTVSIDHIPDDRMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  +TV+WNGP+GVFE + F   T  +A  +A+++K     +I GGG
Sbjct: 299 IGPDSVKVFQAALADCKTVIWNGPMGVFEFDKFAVGTEAIAQTLAEISK-NGATTIIGGG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPGI AL
Sbjct: 358 DSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAAL 397


>gi|115469436|ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 gi|52075828|dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica
           Group]
 gi|52076544|dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica
           Group]
 gi|113596357|dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gi|125556411|gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gi|125598169|gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 gi|215678721|dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215697936|dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 401

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 168/401 (41%), Positives = 248/401 (61%), Gaps = 6/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D++G +  LR D NVP  D  K+ D TRI   VPTI  L+ K AKV+
Sbjct: 1   MASKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  +++  NDCIG  + +  A+L +GG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F   L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHASTEGVTKYLRPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P D+VVA +      ++ V A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE E F   T  +A  +A +T  + + +I GGG
Sbjct: 300 IGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADIT-AKGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL+
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALN 399


>gi|78213967|ref|YP_382746.1| phosphoglycerate kinase [Synechococcus sp. CC9605]
 gi|123577418|sp|Q3AGU1|PGK_SYNSC RecName: Full=Phosphoglycerate kinase
 gi|78198426|gb|ABB36191.1| Phosphoglycerate kinase [Synechococcus sp. CC9605]
          Length = 401

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLNAGDLSGKRVLVRVDFNVPLNDTGAITDDTRIRAALPTINDLIGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +   + CIG      + +++ G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+N+  F   L+   + Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNEAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLDTLIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK +  ++++P DVV+A        +Q     ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKANGVQLLLPTDVVLADNFAPDANSQTADINAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  ++ +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSIKVFQEALADCQTVIWNGPMGVFEFDKFATGTNSIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|15230595|ref|NP_187884.1| PGK1 (PHOSPHOGLYCERATE KINASE 1); phosphoglycerate kinase
           [Arabidopsis thaliana]
 gi|75273138|sp|Q9LD57|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags:
           Precursor
 gi|7839389|gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gi|13430644|gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|16226508|gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|11994421|dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|15010644|gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|16648943|gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|17065610|gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|20334796|gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|21387107|gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|22022520|gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gi|110742702|dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 gi|222423303|dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gi|332641725|gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
          Length = 481

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 249/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV+
Sbjct: 77  MAK-KSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   +   +DCIG  +   +ASL EGG++L E
Sbjct: 136 LSTHLGRPKG-VTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P DVVVA +      +++V A  +    + LD
Sbjct: 315 SSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE+E F   T  +A+ +A+L+ E+ + +I GGG
Sbjct: 375 IGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELS-EKGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++   +++ST GGA LE LEGK LPG++AL
Sbjct: 434 DSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|269978202|ref|ZP_06185152.1| phosphoglycerate kinase [Mobiluncus mulieris 28-1]
 gi|269933711|gb|EEZ90295.1| phosphoglycerate kinase [Mobiluncus mulieris 28-1]
          Length = 397

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 231/400 (57%), Gaps = 9/400 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L+T+  L D+ G R L+R D+NVP  DG + D  RI   +PT+ +L++  AKV++ +HLG
Sbjct: 2   LKTIESLGDLTGKRVLVRSDFNVPLKDGVITDDGRIRAALPTLKKLLDGGAKVIVMAHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  V    E ++   +    D  G        +L  G I++ ENVRF  
Sbjct: 62  RPKGQVNPEFSLAPVAKRLEELIGAKVTLAADTTGVDAQAKAEALPAGEILMLENVRFDP 121

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E   D     +F   +++  D +++D F V HR  AS+  ++ LLP+  G  + KE+  
Sbjct: 122 RETSKDDGERAEFAAEMAKLADLFVSDGFGVVHRKQASVYDIAKLLPAAAGLLVVKEIES 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K D L+IGGGMA +FL AQG  VG+SL
Sbjct: 182 LRKATDNPERPYTVVLGGSKVSDKLGVIANLLTKADSLIIGGGMAFTFLAAQGYRVGKSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D V     +AK++  ++++P DVVVA E K   P  VVSA ++P D + LD+G 
Sbjct: 242 LESDQIDTVKGYLEKAKQNGVDLVLPVDVVVAPEFKAEAPATVVSADAIPEDQMGLDIGP 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+ E     IAQ++TV WNGP+GVFE E F   T  VA  +    ++    S+ GGGD+ 
Sbjct: 302 KSRENFAAKIAQSKTVAWNGPMGVFEFEAFAAGTKAVAQAL----QDGDCFSVVGGGDSA 357

Query: 360 TALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            A+   G   ++F+++ST GGA LE LEGK LPGI  L G
Sbjct: 358 AAVRLLGFDESKFSHISTGGGASLELLEGKVLPGIAVLEG 397


>gi|146338223|ref|YP_001203271.1| phosphoglycerate kinase [Bradyrhizobium sp. ORS278]
 gi|146191029|emb|CAL75034.1| phosphoglycerate kinase [Bradyrhizobium sp. ORS278]
          Length = 399

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 195/397 (49%), Positives = 268/397 (67%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ RT++D+ D +G R LLRVD NVP  +G V D TR+ERV PTI EL  K  KV++ +
Sbjct: 4   MTKFRTLDDV-DPKGKRVLLRVDLNVPMENGHVTDATRLERVAPTINELATKGGKVILLA 62

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+   D   SL  V      ++ + + F +DCIG   +++IA++ +G ++  EN R
Sbjct: 63  HFGRPKG-RDAKDSLKPVADALSKVIKRPVAFADDCIGEPAAKAIAAMKDGDVLCLENTR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  L
Sbjct: 122 FHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDAL 181

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           +       KP++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL 
Sbjct: 182 DKALGRPAKPVIAIVGGAKVSTKIDLLENLVTKVDALVIGGGMANTFLHAQGVQIGKSLA 241

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +    +I  +A+ + C II+P D  V+       P+      ++P DS+ILDVG +
Sbjct: 242 EKDLAATALRIMEKAEAANCAIILPVDATVSYHFAANSPSFAYGLDAIPPDSMILDVGPQ 301

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +   I   I  A T++WNGPLG FE+ PFDR T+  A + A+ TK +++IS+AGGGDT+ 
Sbjct: 302 STARIHAAIDDAATLVWNGPLGAFELNPFDRGTMVAAKHAAERTKAKKLISVAGGGDTVA 361

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL  AG++ +F+YVSTAGGAFLEW+EGK LPG+  L 
Sbjct: 362 ALNQAGVAGDFSYVSTAGGAFLEWMEGKPLPGVEVLK 398


>gi|297618011|ref|YP_003703170.1| phosphoglycerate kinase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145848|gb|ADI02605.1| Phosphoglycerate kinase [Syntrophothermus lipocalidus DSM 12680]
          Length = 396

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 247/397 (62%), Gaps = 6/397 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +R + D+ D++G R L+RVD+NVP    G + D  RI+  +PTI  L+++ AKV++ SHL
Sbjct: 1   MRGLKDI-DVKGKRVLVRVDFNVPTDKQGNILDDARIKASLPTIRYLIDQGAKVILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP  K  +   L KV     ++L + +  + DC+G  +  ++A +  G ++L ENVRF+
Sbjct: 60  GRPDGKVVEAYRLDKVAQHLSTLLGQEVKKLPDCVGKEVEDAVAQMQPGQVVLLENVRFH 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
           + EE+NDP+F   L+  GD ++NDAF  +HRAHAS  G++  LPS  G  M+KE+ ML S
Sbjct: 120 AGEEKNDPEFAAQLAALGDVFVNDAFGTAHRAHASTAGVTRYLPSAAGFLMEKEVKMLRS 179

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
               S+ P VAI+GG+KVS K+ LL N++ KVD ++IGGGMAN+FL A+G  +G SLC+ 
Sbjct: 180 VMESSESPRVAIIGGAKVSDKMGLLQNMLDKVDAIIIGGGMANTFLKAEGYYIGNSLCED 239

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              D    +  +A+     +++P DVVVA  +     ++ V    VP   II+D+G +T 
Sbjct: 240 KLLDFARSLLKQAEEKRIRVLLPVDVVVADRLAADAQSREVKVDQVPEGWIIVDIGSETA 299

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
               + I  A  ++WNGP+GV+E E F R T EVA  VA        +S+ GGGD++  +
Sbjct: 300 RLFGETIKSAHNIIWNGPMGVYEYERFARGTEEVARAVA----ASGAVSVVGGGDSLAII 355

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A  G+ ++ T++ST GGA LE+LEGK LPG+ +  G+
Sbjct: 356 ARLGLEDKMTHISTGGGATLEFLEGKVLPGVASCEGY 392


>gi|23465287|ref|NP_695890.1| phosphoglycerate kinase [Bifidobacterium longum NCC2705]
 gi|239621400|ref|ZP_04664431.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|23325923|gb|AAN24526.1| phosphoglycerate kinase [Bifidobacterium longum NCC2705]
 gi|239515861|gb|EEQ55728.1| phosphoglycerate kinase [Bifidobacterium longum subsp. infantis
           CCUG 52486]
          Length = 441

 Score =  366 bits (938), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 232/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 41  MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 100

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 101 RPKGKVVPELSLAPVAARLGELLGANVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 160

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 161 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 220

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 221 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 280

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 281 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 340

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 341 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDAT-AVGAFTIVGGG 399

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 400 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 441


>gi|46576827|sp|Q8G6D6|PGK_BIFLO RecName: Full=Phosphoglycerate kinase
          Length = 401

 Score =  366 bits (938), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 232/402 (57%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L  N+    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGANVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D D    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDAT-AVGAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE 401


>gi|1346698|sp|P29409|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|21272|emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
          Length = 433

 Score =  366 bits (938), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 161/401 (40%), Positives = 246/401 (61%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV+
Sbjct: 29  MAK-KSVGDLTSADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLINNGAKVI 87

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  +DCIG  + + +A L EGG++L E
Sbjct: 88  LSSHLGRPKG-VTPKFSLAPLVPRLSELLGLQVVKADDCIGPDVEKLVAELPEGGVLLLE 146

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 147 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 206

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQGM VG
Sbjct: 207 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGMSVG 266

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A  +P   + LD
Sbjct: 267 SSLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAADADSKIVPASGIPDGWMGLD 326

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE E F   T  +A  + +++K +   +I GGG
Sbjct: 327 IGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKKLEEISK-KGATTIIGGG 385

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+   G++   +++ST GGA LE LEGK LPG++AL+
Sbjct: 386 DSVAAVEKVGVAEAMSHISTGGGASLELLEGKQLPGVLALN 426


>gi|3738257|dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
          Length = 401

 Score =  366 bits (938), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 248/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  ++++ L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKKSVSSLKEADLKGKSVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  ++   NDCIG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVS+KI ++ +L++KVD L +GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK    ++++P DVVVA +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|325265027|ref|ZP_08131754.1| phosphoglycerate kinase [Clostridium sp. D5]
 gi|324029717|gb|EGB91005.1| phosphoglycerate kinase [Clostridium sp. D5]
          Length = 397

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 144/402 (35%), Positives = 239/402 (59%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP IDGK+ D  R+   +PTI +LV    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLIDGKITDENRLVAALPTIKKLVADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G+    ++ ++++G IIL EN
Sbjct: 60  HLGKPKGQPLPELSLAPVAVRLSELLGQEVKFAADPEVVGANAKAAVEAMNDGDIILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +      +P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  AQG  VG 
Sbjct: 180 DFLGNAVENPARPFVAILGGAKVSSKISVIENLLDKVDTLIIGGGMSYTFSKAQGGSVGN 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+      +  +A+    ++++P D V+A +      ++VV    +P     LD+
Sbjct: 240 SLLEEDYCQYALDMIKKAEEKGVKLLLPLDNVIADDFSNDAHSKVVGRGEIPDGWEGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  ++    E   ++I GGGD
Sbjct: 300 GPETAKLYADAVKSAKTVVWNGPMGCFEMPNFAAGTEAVAKALS----ETDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A + +
Sbjct: 356 SAAAVNQLGYGDKMTHISTGGGASLEFLEGKELPGVAAANDN 397


>gi|299134160|ref|ZP_07027353.1| Phosphoglycerate kinase [Afipia sp. 1NLS2]
 gi|298590907|gb|EFI51109.1| Phosphoglycerate kinase [Afipia sp. 1NLS2]
          Length = 399

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 198/396 (50%), Positives = 272/396 (68%), Gaps = 1/396 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+   R LLRVD NVP  +G+V+D TR+ERV  TI E+ EK  KV++ SH G
Sbjct: 5   FRTLDDV-DVHNKRVLLRVDLNVPMDNGRVSDATRLERVTKTITEIAEKGGKVILLSHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL  V      +L +++ FV+DCIG     +++ +  G II  EN RF+ 
Sbjct: 64  RPKGVVNPKESLKPVAITLAYMLRRHVEFVDDCIGKKAEDAVSWMKPGDIICLENTRFHK 123

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP FV  L++ GD +INDAFS +HRAHAS  GL H+LP+Y GR+MQ EL  L   
Sbjct: 124 GEEKNDPAFVAELAKLGDIWINDAFSCAHRAHASTEGLGHVLPAYAGRSMQAELDALTKA 183

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                 P+ A++GG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+++
Sbjct: 184 LEAPTHPVAAVIGGAKVSTKLDLLENLVTKVDALVIGGGMANTFLHAQGVNVGKSLCEKE 243

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C +I+P D V+ARE     P+Q     ++P D++ILDVG K+V+
Sbjct: 244 LAPTALRILEKAEAAKCAVILPVDAVIAREFVAHAPSQACGLDAIPADAMILDVGPKSVD 303

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            ++     A+TV+WNGPLG FE+ PFDR TV+ A + A LT+E ++IS+AGGGDT+ AL 
Sbjct: 304 RVRAAFDDAKTVVWNGPLGAFELSPFDRGTVQAARHAAGLTREGKLISVAGGGDTVAALN 363

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           HAG++ +FTYVSTAGGAFLEW+EGK LPG+  L   
Sbjct: 364 HAGVAPDFTYVSTAGGAFLEWMEGKPLPGVEVLRAK 399


>gi|329890472|ref|ZP_08268815.1| phosphoglycerate kinase [Brevundimonas diminuta ATCC 11568]
 gi|328845773|gb|EGF95337.1| phosphoglycerate kinase [Brevundimonas diminuta ATCC 11568]
          Length = 398

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 198/395 (50%), Positives = 276/395 (69%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              RT++D+ D+ G   L+RVD+NVP  DG V D TR++  +PTI  L E  AKVV+ +H
Sbjct: 1   MTFRTLDDVSDLSGKAALVRVDFNVPMEDGNVTDDTRLKAALPTIHRLREAGAKVVLLAH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
             RP+ +     SL  VV   E +LH  + F +DC+G     ++A L  GG++L ENVRF
Sbjct: 61  FDRPKGERVPSMSLKPVVEPLELLLHGPVRFADDCVGDEAKAAVADLDAGGVLLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE+NDP F R L+  GD Y+NDAFS +HRAHAS  GL+ LLP+Y G AM +EL  L+
Sbjct: 121 HKGEEKNDPAFARQLAELGDLYVNDAFSAAHRAHASTEGLARLLPAYAGCAMARELEALD 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +   + +KP++ IVGG+KVSTK+ LL NLV K+D L IGGGMAN+FL AQG+ VG SLC+
Sbjct: 181 AALGKPQKPVIGIVGGAKVSTKLDLLKNLVAKLDYLAIGGGMANTFLFAQGVDVGGSLCE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
           +D +D   +I  EA+R  CE+++P DVVVA+ +K GI + V +   +  D +ILD G +T
Sbjct: 241 KDLTDTAREIIEEARRQGCELLLPVDVVVAKGVKPGIESGVRALDRIAADDLILDAGPET 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  + + +  ++T++WNGPLGVFE+ PFD+ATVE A + A+L K  +++++AGGGDT+ A
Sbjct: 301 VARLNRAMDLSKTLIWNGPLGVFEVPPFDKATVEAAKHAAELAKAGKLVAVAGGGDTVAA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG +++ T+VSTAGGAFLEW+EGK LPG+ AL
Sbjct: 361 LNHAGTADDMTFVSTAGGAFLEWMEGKVLPGVEAL 395


>gi|203283982|ref|YP_002221722.1| phosphoglycerate kinase [Borrelia duttonii Ly]
 gi|226699795|sp|B5RKV5|PGK_BORDL RecName: Full=Phosphoglycerate kinase
 gi|201083425|gb|ACH93016.1| phosphoglycerate kinase [Borrelia duttonii Ly]
          Length = 392

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 163/396 (41%), Positives = 247/396 (62%), Gaps = 5/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             +RT+ D  D  G R L+R D+NVP  +G + D TRI+  +PTI  L  + A+VV+ SH
Sbjct: 1   MSIRTIKD-CDFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIEYLKSQGARVVLMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + +   SL  +      +L +N+  ++DCIG  +  +++ +  G ++L ENVRF
Sbjct: 60  LGRPKGEKNLRYSLMPIARRLSELLGQNVKMLSDCIGDEVVTAVSCMQNGDVVLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y EEE N   F   LS++GD ++NDAF  +HRAHAS +G++  LP+  G  M++E   L 
Sbjct: 120 YKEEEENSDAFAMQLSKSGDIFVNDAFGTAHRAHASTSGVASYLPAVGGFLMEREDEFLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 + P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL +
Sbjct: 180 KILKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGYSIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK  + E+I+P D VVA E +     + V + ++P   I +D+G KT
Sbjct: 240 NEYIDVASSFLKKAKELSVEVILPIDHVVASEFQEYSMPEYVDSVNIPDSKIGMDIGEKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I+ V++ A+TV+WNGPLGVFE + F + T +VA YVA        I++ GGGD++ A
Sbjct: 300 LKKIEGVLSSAKTVIWNGPLGVFEFDSFAKGTAKVAEYVANCPG----ITVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +    +S + T+VST GGA LE+LEGK LPGI  L 
Sbjct: 356 VNKFNLSGKITHVSTGGGASLEYLEGKVLPGIKVLE 391


>gi|203287525|ref|YP_002222540.1| phosphoglycerate kinase [Borrelia recurrentis A1]
 gi|226699797|sp|B5RQN5|PGK_BORRA RecName: Full=Phosphoglycerate kinase
 gi|201084745|gb|ACH94319.1| phosphoglycerate kinase [Borrelia recurrentis A1]
          Length = 392

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 162/396 (40%), Positives = 247/396 (62%), Gaps = 5/396 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             +RT+ D  D  G R L+R D+NVP  +G + D TRI+  +PTI  L  + A+VV+ SH
Sbjct: 1   MSIRTIKD-CDFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIEYLKSQGARVVLMSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + +   SL  +      +L +++  ++DCIG  +  +++ +  G ++L ENVRF
Sbjct: 60  LGRPKGEKNLRYSLMPIARRLSELLGQDVKMLSDCIGDEVVTAVSCMQNGDVVLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y EEE N   F   LS++GD ++NDAF  +HRAHAS +G++  LP+  G  M++E   L 
Sbjct: 120 YKEEEENSDAFAMQLSKSGDIFVNDAFGTAHRAHASTSGVASYLPAVGGFLMEREDEFLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 + P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL  +G  +G+SL +
Sbjct: 180 KILKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMAYTFLKVEGYSIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK  + E+I+P D VVA E +     + V + ++P   I +D+G KT
Sbjct: 240 NEYIDVASSFLKKAKELSVEVILPIDHVVASEFQEYSMPEYVDSVNIPDSKIGMDIGEKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I+ V++ A+TV+WNGPLGVFE + F + T +VA YVA        I++ GGGD++ A
Sbjct: 300 LKKIEGVLSSAKTVIWNGPLGVFEFDSFAKGTAKVAEYVANCPG----ITVVGGGDSVAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +    +S + T+VST GGA LE+LEGK LPGI  L 
Sbjct: 356 VNKFNLSGKITHVSTGGGASLEYLEGKVLPGIKVLE 391


>gi|56551074|ref|YP_161913.1| phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761353|ref|ZP_04759441.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753267|ref|YP_003226160.1| phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|129931|sp|P09404|PGK_ZYMMO RecName: Full=Phosphoglycerate kinase
 gi|155604|gb|AAA27699.1| phosphoglycerate kinase [Zymomonas mobilis]
 gi|56542648|gb|AAV88802.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374260|gb|EER63757.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552630|gb|ACV75576.1| Phosphoglycerate kinase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 397

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 194/396 (48%), Positives = 275/396 (69%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              RT++D+ D++G R L+R D NVP    +V D TR+   +PT+ EL EK AKV+I +H
Sbjct: 1   MAFRTLDDIGDVKGKRVLVREDLNVPMDGDRVTDDTRLRAAIPTVNELAEKGAKVLILAH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ + + + SL ++      +L + + F+ND  G   ++++ +L+ G + L EN RF
Sbjct: 61  FGRPKGQPNPEMSLARIKDALAGVLGRPVHFINDIKGEAAAKAVDALNPGAVALLENTRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+NDP     +++ GDFY+NDAFS +HRAH S  GL+H LP++ GRAMQKEL  LE
Sbjct: 121 YAGEEKNDPALAAEVAKLGDFYVNDAFSAAHRAHVSTEGLAHKLPAFAGRAMQKELEALE 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +   +   P+ A+VGG+KVSTK+ +L NLV KVD L+IGGGMAN+FL AQG+ VG+SLC+
Sbjct: 181 AALGKPTHPVAAVVGGAKVSTKLDVLTNLVSKVDHLIIGGGMANTFLAAQGVDVGKSLCE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +  D V  I   A+++ C+I +P DVVVA+E K   P + +    V  D +ILDVG K 
Sbjct: 241 HELKDTVKGIFAAAEKTGCKIHLPSDVVVAKEFKANPPIRTIPVSDVAADEMILDVGPKA 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V  + +V+  ++T++WNGPLG FEIEPFD+ATV +A   A LTK   +IS+AGGGDT+ A
Sbjct: 301 VAALTEVLKASKTLVWNGPLGAFEIEPFDKATVALAKEAAALTKAGSLISVAGGGDTVAA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           L HAG++ +F++VSTAGGAFLEW+EGK+LPG+ AL 
Sbjct: 361 LNHAGVAKDFSFVSTAGGAFLEWMEGKELPGVKALE 396


>gi|168020306|ref|XP_001762684.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162686092|gb|EDQ72483.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 476

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 241/397 (60%), Gaps = 5/397 (1%)

Query: 6   TMNDL--RDIRGLRCLLRVDWNVPFIDGKV-ADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ D+   + +G    +R D NVP  D ++  D TRI   +PTI  LV+  AKVV+ SHL
Sbjct: 80  SIKDVPESEFQGKVVFVRADLNVPLDDARIITDDTRIRASLPTIQHLVKAGAKVVVASHL 139

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +   SL  V     ++L + +    D +G  +   IA+L EG ++L ENVRFY
Sbjct: 140 GRPKKGPEDKFSLKPVAGRLSNLLGQTVELAPDSVGPEVESKIAALKEGQVLLLENVRFY 199

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSMLE 181
            EEE+ND +F + L++N D ++NDAF  +HRAH+S  G+   +  S  G  ++KEL+ L 
Sbjct: 200 KEEEKNDVEFSKKLAKNVDIFVNDAFGTAHRAHSSTAGIAEFVPKSVAGFLLEKELAYLS 259

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                  KP VAIVGGSKVS+KIT++ +L+   DK+++GGGM  +F  A G  +G SL +
Sbjct: 260 GAIKSPAKPFVAIVGGSKVSSKITVIESLMNVCDKVILGGGMIFTFFKADGKSIGSSLVE 319

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D       +   AK    E+I+P DV+VA +      TQ  S+  +P   + LD+G K 
Sbjct: 320 EDKIGLAKNLVALAKEKGVELILPVDVLVADKYAPDANTQECSSSHIPDGWMGLDIGPKA 379

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E  K+ +  ++TV+WNGP+GVFE + F + T  VA  +A LTKE   I+I GGGD++ A
Sbjct: 380 IEQFKEALKGSKTVLWNGPMGVFEFDAFAKGTYAVAESLAGLTKE-GAITIIGGGDSVAA 438

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +  AG++++ ++VST GGA LE LEGK LPG+ AL G
Sbjct: 439 VEKAGLADQMSHVSTGGGASLELLEGKVLPGVAALDG 475


>gi|310639657|ref|YP_003944415.1| phosphoglycerate kinase [Paenibacillus polymyxa SC2]
 gi|309244607|gb|ADO54174.1| Phosphoglycerate kinase [Paenibacillus polymyxa SC2]
          Length = 395

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 229/398 (57%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +++ D+ ++ G R  +RVD+NVP  DGK+ D  RI   +PTI  L+EK AKV++ SH
Sbjct: 3   MNKKSVRDI-ELNGKRVFVRVDFNVPVEDGKITDDKRIRETLPTINYLIEKGAKVILASH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ +  +   L         +L K ++ V++ +G  +   +A L  G ++L ENVRF
Sbjct: 62  FGRPKGQVVESMRLTAAGVRLSELLKKPVVKVDEAVGEAVKAKVAELQNGDVLLLENVRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  EE+NDP+  +  +   D ++NDAF  +HRAHAS  G++H LP+  G  M+KELS++ 
Sbjct: 122 YPGEEKNDPELAKQFAELADIFVNDAFGAAHRAHASTEGIAHFLPAVSGLLMEKELSVIG 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S   +P  AI+GGSKV  KI ++ NL+   D ++IGGG+  +F  AQG  VG+SL  
Sbjct: 182 KALSNPDRPFTAIIGGSKVKDKIDVIDNLLNIADNVIIGGGLTYTFFKAQGHEVGQSLLD 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D       +AK+      +P D+V++ +      T +V    +P D   +D+G KT
Sbjct: 242 ESKLDVALGFIEKAKKLGKNFYLPVDIVISDDFSATANTNIVDIDGIPADWEGVDIGPKT 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +    VI  ++ V+WNGP+GVFEIEPF   T EVA   A         +I GGGD+  A
Sbjct: 302 RKIYADVIKNSKLVVWNGPMGVFEIEPFAGGTREVAEACAT----TDAYTIIGGGDSAAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
                ++++  ++ST GGA LE++EGK LPG+VAL+  
Sbjct: 358 AEKFHLADKMDHISTGGGASLEFMEGKALPGVVALNDK 395


>gi|260435171|ref|ZP_05789141.1| phosphoglycerate kinase [Synechococcus sp. WH 8109]
 gi|260413045|gb|EEX06341.1| phosphoglycerate kinase [Synechococcus sp. WH 8109]
          Length = 401

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 244/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   D+ G R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MAK-RSLASLNAGDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIVKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V +    +L K +   + CIG      + +++ G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMANGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+N+  F   L+   + Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNEAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    ++++P DVV+A        +Q     ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVQLLLPADVVLADNFAPDANSQTADINAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSIKVFQDALADCQTVIWNGPMGVFEFDKFAAGTNAIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|148258134|ref|YP_001242719.1| phosphoglycerate kinase [Bradyrhizobium sp. BTAi1]
 gi|146410307|gb|ABQ38813.1| phosphoglycerate kinase [Bradyrhizobium sp. BTAi1]
          Length = 396

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 196/397 (49%), Positives = 270/397 (68%), Gaps = 2/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ RT++D+ D +G R LLRVD NVP  +G V D TR+ERV PTI E+  K  KV++ +
Sbjct: 1   MTKFRTLDDV-DPKGKRVLLRVDLNVPTENGHVTDTTRLERVAPTINEIATKGGKVILLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+   D   SL  V +   +++ + + F +DCIG   + +IA++ +G ++  EN R
Sbjct: 60  HFGRPKG-RDPKDSLKPVAAALSAVIKRPVAFADDCIGEPAATAIAAMKDGDVLCLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  L
Sbjct: 119 FHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       KP++AIVGG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL 
Sbjct: 179 EKALGSPVKPVIAIVGGAKVSTKIDLLENLVTKVDALVIGGGMANTFLHAQGVQIGKSLA 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +    +I  +A+ S C II+P D  V+       P+      ++P DS+ILDVG +
Sbjct: 239 EKDLAATALRIMEKAEASNCAIILPVDATVSYHFAANSPSFAYGLDAIPPDSMILDVGPQ 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +   I   I  A T++WNGPLG FE+ PFDR T+  A + A+ TK +++IS+AGGGDT+ 
Sbjct: 299 STARIHAAIDDAATLVWNGPLGAFELTPFDRGTMVAAKHAAERTKAKKLISVAGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL  AG++++F+YVSTAGGAFLEW+EGK LPG+  L 
Sbjct: 359 ALNQAGVASDFSYVSTAGGAFLEWMEGKPLPGVEVLK 395


>gi|224532260|ref|ZP_03672892.1| phosphoglycerate kinase [Borrelia valaisiana VS116]
 gi|224511725|gb|EEF82131.1| phosphoglycerate kinase [Borrelia valaisiana VS116]
          Length = 393

 Score =  366 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 163/397 (41%), Positives = 250/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI+  +PTI  L E+ AK+V+ SH
Sbjct: 1   MSIKTVKDFDSFAGKRALVRCDFNVPLKEGIISDDTRIKSALPTIEYLKERGAKIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K +   SL  V +    +L +++  ++DCIGS +  +   +  G ++L ENVRF
Sbjct: 61  LGRPEGKKNLKYSLKPVANRLSELLDQDVKMLSDCIGSEIVNNTLQMKNGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G+S  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K D +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GVLKNPERPFVSIIGGSKVSSKIAVLESLLSKSDVVVIGGGMAYTFLHSKGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++ D       +AK    ++I+P D +VA +       + + + ++P + I +DVG  T
Sbjct: 241 GEYIDVASSFLKKAKELGVKVILPLDHIVASDFDKNSTPEYIDSFNIPENKIGMDVGGNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I+ V+  A+T++WNGPLGVFE + F + T +VA  VA        +++ GGGD++ A
Sbjct: 301 LKEIENVVKIAKTIIWNGPLGVFEFDLFSKGTAKVAEMVASCAG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEGK LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK 393


>gi|225464999|ref|XP_002263950.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147843754|emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
          Length = 401

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 167/400 (41%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++ DL+  D++G R  +RVD NVP  +  K+ D TR+   VPTI  L+   AKV+
Sbjct: 1   MATKRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   NDCIG  +   +A + EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVKILVAKIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L+ KVD L++GGGM  +F  AQG GVG
Sbjct: 180 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLGKVDVLLLGGGMIFTFYKAQGYGVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASCIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE + F   T  +A  +A L+ E+ + +I GGG
Sbjct: 300 IGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAIAKKLADLS-EKGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLAL 398


>gi|15594402|ref|NP_212190.1| phosphoglycerate kinase [Borrelia burgdorferi B31]
 gi|195941795|ref|ZP_03087177.1| phosphoglycerate kinase [Borrelia burgdorferi 80a]
 gi|3915792|sp|Q59181|PGK_BORBU RecName: Full=Phosphoglycerate kinase
 gi|2687944|gb|AAC66451.1| phosphoglycerate kinase (pgk) [Borrelia burgdorferi B31]
 gi|312149223|gb|ADQ29294.1| phosphoglycerate kinase [Borrelia burgdorferi N40]
          Length = 393

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 248/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYIDSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I+ V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIENVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|1314258|gb|AAB53931.1| phosphoglycerate kinase [Borrelia burgdorferi]
          Length = 393

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 156/397 (39%), Positives = 248/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++   PS  G  M+KE + L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYSPSVGGFLMEKEDNSLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPSVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYIDSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I+ V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIENVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|291522309|emb|CBK80602.1| 3-phosphoglycerate kinase [Coprococcus catus GD/7]
          Length = 397

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 149/398 (37%), Positives = 238/398 (59%), Gaps = 8/398 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M    +++D+ +++G R L+R D+NVP  DGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKVSVDDI-NVKGQRVLVRCDFNVPLQDGKITDENRLVASLPTIKKLIADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L +++ F  D   +G     ++A++ +G ++L EN
Sbjct: 60  HLGKPKGEAKPELSLAPVAVRLSELLGQDVKFAADPEVVGPNAKAAVAAMKDGDVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
            R+  EE +N   F + L+   D Y++DAF  +HRAH S  G++     + +G  MQKE+
Sbjct: 120 TRYRIEETKNGEAFSKELASLCDVYVDDAFGTAHRAHCSNVGVTQYVKTAAVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +   +P VAI+GGSKVS+KI+++ NL+ KVD L+IGGGMA +F+ AQG  +G 
Sbjct: 180 DFLGNAVNNPARPFVAILGGSKVSSKISVINNLLDKVDTLIIGGGMAYTFMKAQGGKIGT 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+ D  + +  +A     ++++P D V A         +VV A  +    + LD+
Sbjct: 240 SLCEDDYLDYANDMIKKAADKGVKMLIPVDTVTADAFSNDANVKVVDAGQIDDGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E     +  A+TV+WNGP+GVFE+  F   TV VA  +A    +   ++I GGGD
Sbjct: 300 GPKTRELFANAVKDAKTVVWNGPMGVFEMPNFAAGTVAVAQALA----DTDAVTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVA 395
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A
Sbjct: 356 SAAAVNQLGFGDKMTHISTGGGASLEFLEGKELPGVAA 393


>gi|72383398|ref|YP_292753.1| phosphoglycerate kinase [Prochlorococcus marinus str. NATL2A]
 gi|123620469|sp|Q46HH8|PGK_PROMT RecName: Full=Phosphoglycerate kinase
 gi|72003248|gb|AAZ59050.1| phosphoglycerate kinase [Prochlorococcus marinus str. NATL2A]
          Length = 401

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ R+++ L   D+ G R L+RVD+NVP   +G + D TRI   +PTI +L++K A+V+
Sbjct: 1   MSK-RSLSSLGAEDLCGKRVLVRVDFNVPLGDEGLITDDTRIRAALPTINDLLDKSARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V      +L K ++    CIG+     + ++S G ++L E
Sbjct: 60  LSAHFGRPKGQVNETMRLTAVAQRLSELLGKTVVKTESCIGAEAKSKVDAMSNGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRF S EE+ND +F + L+   + Y+NDAF  +HRAHAS  G++  L   + G  M+KE
Sbjct: 120 NVRFISGEEKNDTEFAKELASLAEVYVNDAFGAAHRAHASTEGVTKFLSPCVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    + + PL AIVGGSKVS+KI +L +L+ K DK+++GGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDQPQSPLAAIVGGSKVSSKIGVLESLIDKCDKIIVGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +A+    E ++P DVV+A        +++    ++    + LD
Sbjct: 240 NSLVEEDKLELASALEKKAQEKGVEFLLPTDVVLADNFSPDANSKLSKVDAISEGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++VE  +  +   +TV+WNGP+GVFE E F   T  +A+ +A+L+ +    +I GGG
Sbjct: 300 IGSESVELFQNALKDCKTVIWNGPMGVFEFEKFANGTNAIANTLAELSAQGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAKKMSHISTGGGASLELLEGKVLPGVSAL 398


>gi|297243377|ref|ZP_06927310.1| 3-phosphoglycerate kinase [Gardnerella vaginalis AMD]
 gi|296888624|gb|EFH27363.1| 3-phosphoglycerate kinase [Gardnerella vaginalis AMD]
          Length = 401

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 147/402 (36%), Positives = 227/402 (56%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D+ G R L+R D+NVP  D  + D  RI   +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLSGKRVLVRADFNVPLKDTTITDDGRIRAALPTIKALREQGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      +L  N++   D  G      +A+++ G ++L ENVRF +
Sbjct: 61  RPKGQVVPELSLAPVAQRLGELLGTNVVLAADTYGEDAQAKVAAMNNGDVVLLENVRFNA 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D      + + ++  G+ +++D F V HRA  S   ++  LPS  G  ++KE+  
Sbjct: 121 EETSKDASERAAYAKKIASLGEVFVSDGFGVVHRAQGSNYDVAADLPSAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A G  VG SL
Sbjct: 181 LSRATENPERPLTVVLGGSKVSDKLGVIENLLSKADRLVIGGGMVFTFLKALGHEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D    V      AK++  E+++P D+VV          +  +VV A ++P D + LD
Sbjct: 241 LEEDQLGKVKGYIETAKKNGVELVLPTDIVVNAGFPAGDTPVAPEVVPADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   TK     +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPEFATGTRAVAQGLVDATK-NGTFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKTLPGLSVLE 401


>gi|223889216|ref|ZP_03623805.1| phosphoglycerate kinase [Borrelia burgdorferi 64b]
 gi|224533043|ref|ZP_03673649.1| phosphoglycerate kinase [Borrelia burgdorferi WI91-23]
 gi|223885465|gb|EEF56566.1| phosphoglycerate kinase [Borrelia burgdorferi 64b]
 gi|224512037|gb|EEF82432.1| phosphoglycerate kinase [Borrelia burgdorferi WI91-23]
          Length = 393

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 249/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYIDSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|224533955|ref|ZP_03674540.1| phosphoglycerate kinase [Borrelia burgdorferi CA-11.2a]
 gi|224512958|gb|EEF83324.1| phosphoglycerate kinase [Borrelia burgdorferi CA-11.2a]
          Length = 393

 Score =  365 bits (936), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 158/397 (39%), Positives = 249/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + V + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYVDSFNIPENKIGMDIGVNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|304439157|ref|ZP_07399075.1| phosphoglycerate kinase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372289|gb|EFM25877.1| phosphoglycerate kinase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 396

 Score =  365 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 162/395 (41%), Positives = 236/395 (59%), Gaps = 6/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G + L+RVD+NVP     + D TRIE  +PTI  L+E  A VV+ SHLGR
Sbjct: 3   KTLRDI-DVAGKKVLVRVDFNVPMDGDLITDTTRIEASLPTINYLLENGASVVLMSHLGR 61

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRFY 122
           P+ +  ++ SL  V      +L K++ FV     I   +   I  L  G + L EN RF 
Sbjct: 62  PKGEYKEEFSLAPVAKKLSELLKKDVKFVASKVVIDDEVKSEIKKLKTGEVALLENTRFV 121

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             EE+ D DF + L+   D Y+NDAF  SHRAHAS  G++  LPS +G  ++KE+  LE 
Sbjct: 122 KGEEKLDYDFAKDLASLADIYVNDAFGTSHRAHASNVGVAKYLPSAMGFLLEKEVEYLEG 181

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
                 +P VAI+GG KVS KI ++ NL++KVD L++ GGMA +F  + G+ +G S+ + 
Sbjct: 182 AVQNPDRPFVAILGGKKVSDKINVIDNLLEKVDTLIVVGGMAYTFFKSMGLEIGDSIVED 241

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D  D   ++  +A  +  + ++P DVV+A+E+K G+ T+ V    +    + LD+G KT+
Sbjct: 242 DKLDLARELMAKAVTNHVDFVLPDDVVMAKELKAGVETKTVDRDKMEEGYMGLDIGPKTI 301

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
             IK+ +  AR V+WNGP GVFEI  F   T EVA  +A L       +I GGGD++ A+
Sbjct: 302 ANIKEKLEPARCVVWNGPCGVFEIPEFANGTFEVAKTLANL---EGATTIIGGGDSVAAI 358

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             AG+ ++ T++ST GGA LE LEGK LPGI  + 
Sbjct: 359 EAAGLKDKMTHISTGGGASLELLEGKVLPGIDCIE 393


>gi|310287503|ref|YP_003938761.1| phosphoglycerate kinase [Bifidobacterium bifidum S17]
 gi|311064417|ref|YP_003971142.1| phosphoglycerate kinase [Bifidobacterium bifidum PRL2010]
 gi|309251439|gb|ADO53187.1| Phosphoglycerate kinase [Bifidobacterium bifidum S17]
 gi|310866736|gb|ADP36105.1| Pgk Phosphoglycerate kinase [Bifidobacterium bifidum PRL2010]
          Length = 401

 Score =  365 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 144/401 (35%), Positives = 230/401 (57%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLMRADFNVPLDGTTITDDGRIKAALPTITALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V      +L   +    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAKRLGELLGVEVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP     + + ++  G+ +++D F V HRA  S   ++  LP+  G+ ++KE+  
Sbjct: 121 EETSKDPAVRAPYAKKIAALGEVFVSDGFGVVHRAQGSDYDVAADLPAAAGKLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  D V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLDKVKGYIATAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|209886424|ref|YP_002290281.1| phosphoglycerate kinase [Oligotropha carboxidovorans OM5]
 gi|209874620|gb|ACI94416.1| phosphoglycerate kinase [Oligotropha carboxidovorans OM5]
          Length = 399

 Score =  365 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 194/393 (49%), Positives = 272/393 (69%), Gaps = 1/393 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
            RT++D+ D+   R LLRVD NVP  +G+V+D TR+ R+  TI E+ EK  KV++ SH G
Sbjct: 5   FRTLDDV-DVNDKRVLLRVDLNVPMDNGRVSDATRLTRITKTITEIAEKGGKVILLSHFG 63

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL  V      +L +++ FV+DC+G     +++ +  G II  EN RF+ 
Sbjct: 64  RPKGVVNPKESLKPVAITLAYMLRRHVEFVDDCVGKKAEDAVSWMKPGDIICLENTRFHK 123

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP FV  L++ GD +INDAFS +HRAHAS  GL H+LP+Y GR+MQ EL  L   
Sbjct: 124 GEEKNDPAFVAELAKLGDIWINDAFSTAHRAHASTEGLGHVLPAYAGRSMQAELDALTKA 183

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
                 P+ A++GG+KVSTK+ LL NLV KVD LVIGGGMAN+FL AQG+ VG+SLC+++
Sbjct: 184 LEAPTHPVAAVIGGAKVSTKLDLLENLVTKVDALVIGGGMANTFLHAQGVNVGKSLCEKE 243

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
            +    +I  +A+ + C +I+P D V+ARE     P++     ++P D++ILDVG K+V+
Sbjct: 244 LAPTALRILEKAEAAKCAVILPVDAVIAREFVAHAPSEACGLDAIPSDAMILDVGPKSVD 303

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            ++     A+TV+WNGPLG FE+ PFDR TV+ A + A LT+E ++IS+AGGGDT+ AL 
Sbjct: 304 RVRAAFDAAKTVVWNGPLGAFELSPFDRGTVQAARHAAGLTREGKLISVAGGGDTVAALN 363

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           HAG++++FTYVSTAGGAFLEW+EGK LPG+  L
Sbjct: 364 HAGVASDFTYVSTAGGAFLEWMEGKPLPGVEVL 396


>gi|312143198|ref|YP_003994644.1| Phosphoglycerate kinase [Halanaerobium sp. 'sapolanicus']
 gi|311903849|gb|ADQ14290.1| Phosphoglycerate kinase [Halanaerobium sp. 'sapolanicus']
          Length = 398

 Score =  365 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 166/395 (42%), Positives = 251/395 (63%), Gaps = 6/395 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D+ D +G + L+RVD+NVP  +G+V D TRI+  +PTI  L+ ++AKV++ SHL
Sbjct: 5   NKKTLKDM-DFKGKKVLVRVDFNVPLKEGEVTDSTRIKAALPTIEYLIREEAKVLLISHL 63

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP  + ++D  +  V     + L+K +   +DCIG  + ++  +L  G ++L EN RFY
Sbjct: 64  GRPGGEVNEDLRMDAVAKELANQLNKEVKKADDCIGKEVKKAANNLENGEVLLLENSRFY 123

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
             E+ NDP+F + L+   D Y+NDAF  +HRAHA+  G++  LPS  G  MQKEL+ L  
Sbjct: 124 PGEKANDPEFSKKLASLADLYVNDAFGAAHRAHATTVGVTEYLPSAAGFLMQKELNALGE 183

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             +  + P VAI+GG+KVS KI ++ NL+ KVD L++ GG+AN+FL+A+G  VG SL + 
Sbjct: 184 VMAAPESPFVAIMGGAKVSDKIDVIKNLINKVDILIVAGGIANTFLLAKGYEVGDSLVEA 243

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV-GFKT 301
           D  D   ++  EA+     I++P DVV+A E      TQVV    +P    +LD  G ++
Sbjct: 244 DKVDLARELMAEAEEKGVNIVLPIDVVIADEFSNDAETQVVKVDQIPAGWQVLDCGGPES 303

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E  K++I  A+TV+WNGPLGVFE+E F   TVE+A  +     +    S+ GGGD+  A
Sbjct: 304 LEQYKEIIKNAKTVIWNGPLGVFEMEKFAHGTVELAKAL----GQSDAHSVIGGGDSAAA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++++  ++ST GGA L + EGK+LPG+VAL
Sbjct: 360 INLAGVADQMDHISTGGGASLMFFEGKELPGVVAL 394


>gi|102140037|gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
          Length = 479

 Score =  365 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 244/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP   D  + D TRI   VPTI  L+   AKV+
Sbjct: 75  MAK-KSVGDLTAADLKGKKVFVRADLNVPLDEDRNITDDTRIRAAVPTIKHLISNGAKVI 133

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   +DCIG  + + + +L EGG++L E
Sbjct: 134 LSSHLGRPKG-VTPKFSLSPLVPRLSELLGIKVEKADDCIGPEVEKLVNALPEGGVLLLE 192

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 193 NVRFYKEEEKNEPEFAKKLAALADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 252

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG  VG
Sbjct: 253 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGFPVG 312

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      ++VV A  +P   + LD
Sbjct: 313 SSLVEDDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAQSKVVPASEIPDGWMGLD 372

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG  +V+     +   +T++WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 373 VGPDSVKTFNDALDTTKTIIWNGPMGVFEFDKFATGTEAIAKKLAELSG-KGVTTIIGGG 431

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 432 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 471


>gi|114386666|gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
          Length = 402

 Score =  365 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 169/400 (42%), Positives = 246/400 (61%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L   D+RG +  +R D NVP  D  K+ D TRI   VPT+  L+EK AKV+
Sbjct: 1   MATKRSVWTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L  +++  NDCIG  + +  A+L EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+ KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK     +++P DVVVA +      ++ V+A ++P   + LD
Sbjct: 240 KSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG   ++   + +    T++WNGP+GVFE E     T  +A  +A LT  +   +I GGG
Sbjct: 300 VGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKLAAGTDAIAKKLADLTTTKGATTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL 399


>gi|39934020|ref|NP_946296.1| phosphoglycerate kinase [Rhodopseudomonas palustris CGA009]
 gi|50402242|sp|P62419|PGK_RHOPA RecName: Full=Phosphoglycerate kinase
 gi|39647867|emb|CAE26387.1| phosphoglycerate kinase [Rhodopseudomonas palustris CGA009]
          Length = 398

 Score =  365 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 202/397 (50%), Positives = 279/397 (70%), Gaps = 3/397 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++  RT++D+ D++G R LLRVD NVP   GKV D TR+ERV+PTI EL  K AKV++ 
Sbjct: 1   MTKTFRTLDDV-DVKGKRVLLRVDLNVPMDAGKVTDTTRLERVMPTITELSGKGAKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+ + DK+ SL  V +    ++ K + F +DCIG   +++IA++++G I+  EN 
Sbjct: 60  AHFGRPKGRDDKN-SLKPVAAALADVIKKPVGFADDCIGEPAAKAIAAMADGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L+  GD ++NDAFS +HRAHA+  GL H LP+Y GR MQ EL  
Sbjct: 119 RFHPEEEKNDPAFVAKLAELGDIWVNDAFSAAHRAHATTEGLGHKLPAYAGRTMQAELVA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++AIVGG+KVSTKI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SL
Sbjct: 179 LNKALEAPVKPVIAIVGGAKVSTKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D +    +I  +A+ + C II+P D  VA   +   P+      ++P D++ILDVG 
Sbjct: 239 CEKDLAPTALRILDKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPDDAMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +++E I   I  A T++WNGP+G FE+ PFD+ TVE A + AK TK  +++S+AGGGDT+
Sbjct: 299 RSIERIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAAKRTKAGKLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AL HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 359 AALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|224283136|ref|ZP_03646458.1| phosphoglycerate kinase [Bifidobacterium bifidum NCIMB 41171]
 gi|313140285|ref|ZP_07802478.1| phosphoglycerate kinase [Bifidobacterium bifidum NCIMB 41171]
 gi|313132795|gb|EFR50412.1| phosphoglycerate kinase [Bifidobacterium bifidum NCIMB 41171]
          Length = 401

 Score =  365 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 144/401 (35%), Positives = 230/401 (57%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLMRADFNVPLDGTTITDDGRIKAALPTITALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V      +L   +    D  G      +A++++G ++L ENVRF  
Sbjct: 61  RPKGKVVPELSLAPVAKRLGELLGVEVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP 120

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP     + + ++  G+ +++D F V HRA  S   ++  LP+  G+ ++KE+  
Sbjct: 121 EETSKDPTVRAPYAKKVAALGEVFVSDGFGVVHRAQGSDYDVAADLPAAAGKLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  D V      A+++  E+++P DVVV          +  +VV+A ++P D + LD
Sbjct: 241 LEEDQLDKVKGYIATAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|315924176|ref|ZP_07920402.1| phosphoglycerate kinase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622578|gb|EFV02533.1| phosphoglycerate kinase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 395

 Score =  365 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 241/398 (60%), Gaps = 8/398 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +T+ D+  ++G + L+R D+NVP  D  ++ D TRI+  +PTI  ++++ A +++ SHLG
Sbjct: 3   KTVKDIA-LQGKKVLMRADFNVPINDALEITDDTRIQAALPTIQYILDQGAALILMSHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRF 121
           RP+++ D   SL  V      +L+++++F +D   +G     + A+L  G ++L +N RF
Sbjct: 62  RPKNEPDPKYSLAPVAKALAKVLNRDVIFNDDGEVVGQVTKDAAAALQSGQVLLLQNTRF 121

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EE++N+  F + L+  GD +++DAF   HRAHAS  G+++ LP+  G  +QKEL  + 
Sbjct: 122 RPEEKKNEAGFAKELASLGDVFVDDAFGSCHRAHASTAGVANYLPAVSGFLIQKELEFIG 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + K P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F  AQG  +G SL +
Sbjct: 182 GALDDPKHPFVAILGGAKVSDKIGVITNLLQKVDALIIGGGMAYTFYKAQGYEIGTSLLE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +    +  EAK    ++ +P D VVA E        VV + ++P D + +D+G KT
Sbjct: 242 ADKVELAAGLLKEAKAKGVKLYLPVDNVVAPEFDAKATPTVVPSNAIPKDQMGMDIGPKT 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            +    VI  A+TV+WNGP+GVFE + F   T  VA  +A    +    +I GGGD+  A
Sbjct: 302 RKLYADVIKSAKTVIWNGPMGVFEFDAFAEGTKAVAQAMA----DSDATTIIGGGDSAAA 357

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +   G +++ +++ST GGA LE++EGK LPGI  L   
Sbjct: 358 VKQMGYADKISHISTGGGASLEFMEGKVLPGIDVLEDK 395


>gi|216264590|ref|ZP_03436582.1| phosphoglycerate kinase [Borrelia burgdorferi 156a]
 gi|215981063|gb|EEC21870.1| phosphoglycerate kinase [Borrelia burgdorferi 156a]
          Length = 393

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 248/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIG  +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGIEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + V + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYVDSFNIPENKIGMDIGVNT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|299115459|emb|CBN75623.1| phosphoglycerate kinase [Ectocarpus siliculosus]
          Length = 444

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 165/398 (41%), Positives = 242/398 (60%), Gaps = 4/398 (1%)

Query: 3   RLRTMNDL--RDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           +  ++ DL   D++G + L+R D NVP  D  + D TRI   +PTI  L+ K A+V + S
Sbjct: 46  KKLSVGDLKDEDLKGKKVLVRCDLNVPLSDKVIGDDTRIRASIPTIEHLLSKGARVALSS 105

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +   SL  V      +L K+     DC+G  +++    L +G ++L ENVR
Sbjct: 106 HLGRPKDGPEDKFSLGPVAERLTKLLGKDCKMAPDCVGDEVAKIADGLGDGEVMLLENVR 165

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           FY  E +ND DF   L+   D ++NDAF  +HRAH S  G++    PS  G  +QKEL  
Sbjct: 166 FYPAETKNDKDFAEKLAAPFDLFVNDAFGTAHRAHCSTEGVTKFLSPSVAGFLLQKELDY 225

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E K+P  AIVGGSKVS+KI ++ +L+ K DKL+IGGGM  +FL A+G+GVG SL
Sbjct: 226 LAGAVQEPKRPFAAIVGGSKVSSKIGVIESLLAKCDKLIIGGGMVFTFLKARGLGVGSSL 285

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +AK +  EII+P DVVVA        TQVV A ++P   + LD G 
Sbjct: 286 VEEDKLELAKELEEKAKTAGVEIILPSDVVVADAFAADAKTQVVKADAIPDGWMGLDNGP 345

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +  + I+  + + +TV+WNGP+GVFE E F + T  +A  +A++T E    +I GGGD++
Sbjct: 346 EATKEIQAALKECKTVVWNGPMGVFEYEAFAKGTFAIADTLAEITSE-GCTTIVGGGDSV 404

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+  A ++++ +++ST GGA LE LEGK LPG+ AL+
Sbjct: 405 AAVEKANLADKMSHISTGGGASLELLEGKVLPGVAALN 442


>gi|315655282|ref|ZP_07908183.1| phosphoglycerate kinase [Mobiluncus curtisii ATCC 51333]
 gi|315490537|gb|EFU80161.1| phosphoglycerate kinase [Mobiluncus curtisii ATCC 51333]
          Length = 397

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 153/399 (38%), Positives = 226/399 (56%), Gaps = 9/399 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L+T++ L D+ G R L+R D+NVP  DGK+ D  RI   +PT+ +L++  AKV+  +HLG
Sbjct: 2   LKTIDSLGDLNGKRVLVRCDFNVPLKDGKITDDGRIRAALPTLQKLLDSGAKVITMAHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      ++   +    D  G+       +L+ G I++ ENVRF  
Sbjct: 62  RPKGQVMPEFSLAPVAQRLAELIGVKVTLAQDTTGADAKAKAETLATGEILMLENVRFDP 121

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E   D      F   ++   D Y++D F V HR   S+  ++ LLP+  G  + KE+  
Sbjct: 122 RETSKDDAERAAFAAEMAALADCYVSDGFGVVHRKQTSVYDVAKLLPAAAGFLVLKEIES 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K D L+IGGGM  +FL AQG  VG+SL
Sbjct: 182 LRKATDNPERPYTVVLGGSKVSDKLGVIANLLTKADSLLIGGGMTYTFLAAQGYAVGKSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D V     +AK++  E+++P DVVV  E K   PT VV+A ++P D + LD+G 
Sbjct: 242 LEADQIDTVKSYLDQAKQNGVELVLPVDVVVTPEFKPDGPTTVVAADAIPEDQMGLDIGP 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+ E     IA+++TV WNGP+GVFE   F   T  VA  +    ++    SI GGGD+ 
Sbjct: 302 KSRELFAAKIAESKTVAWNGPMGVFEFPAFAGGTKAVAKAM----QDGTAFSIVGGGDSA 357

Query: 360 TALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+   G   ++F+++ST GGA LE LEGK LPGI  L 
Sbjct: 358 AAVRQLGFDESKFSHISTGGGASLELLEGKVLPGIEVLE 396


>gi|297834088|ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297330766|gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 481

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 248/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L++  AKV+
Sbjct: 77  MAK-KSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   +   +DCIG  +   +ASL EGG++L E
Sbjct: 136 LSTHLGRPKG-VTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +   ++  +AK     +++P DVVVA +      +++V A  +    + LD
Sbjct: 315 SSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +TV+WNGP+GVFE+E F   T  VA+ +A+L+  + + +I GGG
Sbjct: 375 IGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++   +++ST GGA LE LEGK LPG++AL
Sbjct: 434 DSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|239626068|ref|ZP_04669099.1| phosphoglycerate kinase [Clostridiales bacterium 1_7_47_FAA]
 gi|239520298|gb|EEQ60164.1| phosphoglycerate kinase [Clostridiales bacterium 1_7_47FAA]
          Length = 404

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 144/409 (35%), Positives = 228/409 (55%), Gaps = 15/409 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL+D++G + L+R D+NVP  +G + +  RI+  +PTI +L+++ AKV++ S
Sbjct: 1   MLNKKTVDDLKDLQGKKVLVRCDFNVPLKEGVIQNYNRIDGAIPTIKKLLDQGAKVILCS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V       L   + FV+D    G    +  A L +G ++L +N
Sbjct: 61  HLGKPKGEPVPEMSLAPVAPALSERLGVEVKFVDDAKVTGPETQKVAAELKDGEVLLLQN 120

Query: 119 VRFYSEEERNDPDFVRMLSR-------NGDFYINDAFSVSHRAHASITG-LSHLLPSYIG 170
            R+  EE +         +            ++NDAF  +HRAH S  G   +   + +G
Sbjct: 121 TRYRIEETKFKDGDAATEAYAKELADLCDGIFVNDAFGTAHRAHCSNVGVTRYTKENVVG 180

Query: 171 RAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVA 230
             M+KE+  L        +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  A
Sbjct: 181 YLMEKEIKFLGQAVENPVRPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMAYTFAKA 240

Query: 231 QGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPL 290
           QG  +G SLC+ D  D   Q+  +A+    ++++P D V  +E       +VV    +  
Sbjct: 241 QGQEIGNSLCEADKLDYALQMVKKAEEKGVKLLLPVDHVEGKEFSNDTEHKVVDV--IDA 298

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
                D+G KT+   K  +  A+TV+WNGP+GVFE   F   T+E+   VA+LT      
Sbjct: 299 GWSGFDIGPKTIALYKDALKGAKTVVWNGPMGVFEFSNFAEGTLEICRAVAELT---DAT 355

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           ++ GGGD++ A+   G +++ T++ST GGA LE+LEGK+LPG+ A    
Sbjct: 356 TVIGGGDSVNAVKRLGFADKMTHISTGGGASLEFLEGKELPGVAAADNK 404


>gi|221217503|ref|ZP_03588974.1| phosphoglycerate kinase [Borrelia burgdorferi 72a]
 gi|221192781|gb|EEE18997.1| phosphoglycerate kinase [Borrelia burgdorferi 72a]
          Length = 393

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 250/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + +++ ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYINSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|225017058|ref|ZP_03706250.1| hypothetical protein CLOSTMETH_00983 [Clostridium methylpentosum
           DSM 5476]
 gi|224950225|gb|EEG31434.1| hypothetical protein CLOSTMETH_00983 [Clostridium methylpentosum
           DSM 5476]
          Length = 406

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 142/411 (34%), Positives = 234/411 (56%), Gaps = 17/411 (4%)

Query: 1   MSRL-----RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK 55
           M+++     +T++D+ ++ G R L+R D+NVP  +G++ D  RI   +PTI +L+    K
Sbjct: 1   MAKMTSLNKKTVDDI-NVSGKRVLVRCDFNVPLKNGEITDENRIVAALPTIKKLIADGGK 59

Query: 56  VVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGI 113
           V++ SHLG+P+ +   + SL  V       L K ++F  D   +G    +++A + +G +
Sbjct: 60  VILCSHLGKPKGEPKPELSLAPVAKRLSEHLGKEVVFAADDTVVGENAKKAVAEMKDGDV 119

Query: 114 ILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRA 172
           +L +N R+  EE +N  +F + L+   D Y+NDAF  +HRAH S  G++     + +G  
Sbjct: 120 VLLQNTRYRKEETKNGEEFSKELASLADVYVNDAFGTAHRAHCSTEGVTKFVDETAVGYL 179

Query: 173 MQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQG 232
           + KEL  L        +P V I+GG+KV+ K++++ NL+ K D L+IGGGMA +FL A+G
Sbjct: 180 IGKELKYLGDAVENPARPFVTILGGAKVADKLSVIENLLNKADTLIIGGGMAYTFLAAKG 239

Query: 233 MGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV----SAQSV 288
             VG SL      D   ++  +A+    ++++P D  +A      I  ++      A  +
Sbjct: 240 YNVGDSLLDETKIDYCKEMLKKAEEKGVKLLLPIDCTIATAFPNPIDAEIEVQNVDADKI 299

Query: 289 PLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERR 348
           P     LD+G K+ E     +  A+TV+WNGP+GVFE     + T+EVA  +A    E  
Sbjct: 300 PNGYQGLDIGSKSAELFANEVKSAKTVVWNGPMGVFENPVLAKGTIEVAKALA----ETD 355

Query: 349 IISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            I+I GGGD+  A+   G  ++ +++ST GGA LE+LEGKDLPG++A++  
Sbjct: 356 AITIIGGGDSAAAVNTLGFGDKMSHISTGGGASLEFLEGKDLPGVMAINDK 406


>gi|242090961|ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gi|241946598|gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
          Length = 483

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 242/400 (60%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D+ G R  +R D NVP  + + + D TRI   VPTI  L+ K AKV+
Sbjct: 79  MAK-KSVGDLTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIQYLISKGAKVI 137

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +    D IG  + + + +L  GG++L E
Sbjct: 138 LSSHLGRPKG-FTPKFSLGPIVGRLSELLGIQVQKAEDVIGPEVEKLVDALPIGGVLLLE 196

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 197 NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 256

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 257 LDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 316

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +Q+V A ++P   + LD
Sbjct: 317 ASLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAPDANSQIVPASAIPDGWMGLD 376

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   V      +   +TV+WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 377 IGPDAVTSFNAALDTCQTVIWNGPMGVFEFDKFAVGTEAVAKKLAELS-AKGVTTIIGGG 435

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL
Sbjct: 436 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVAL 475


>gi|285808460|gb|ADC35985.1| phosphoglycerate kinase [uncultured bacterium 148]
          Length = 406

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 164/396 (41%), Positives = 245/396 (61%), Gaps = 2/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M    T+ D  D+ G R  +RVD+NVP  DGKV D +RI   +PTI  L+++ A+VV+ S
Sbjct: 1   MMDKLTIRD-ADVAGKRVFVRVDFNVPLADGKVTDDSRIRAAIPTINALLQQGARVVLAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP  K      L  V      ++ +N+    D +G     ++  L  G +IL EN+R
Sbjct: 60  HLGRPDGKVSDSLRLRPVGLRLTELMRRNVPVTGDALGLGTEDAVKRLRAGEVILLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+ EEE+NDP+F   L+   D Y+NDAF  +HRAHAS  G++ LLP+Y G  M++EL  L
Sbjct: 120 FHVEEEQNDPEFAAKLAAYADVYVNDAFGTAHRAHASTVGIAKLLPAYAGLLMERELEAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P  AI+GG+KVS KI ++ +L+ KVD LV+GGGMAN+FL+AQG  +G+SL 
Sbjct: 180 SGLLESPARPFAAILGGAKVSDKIKVIDHLLTKVDILVLGGGMANTFLLAQGKAIGKSLA 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +   +I   A+++  ++++P DV+VA+E+  G   + + A+ +P    I+D+G  
Sbjct: 240 EPDRVEEARRILTNAEKNGVQVVLPVDVIVAKEVTRGTEYKTLPAEKIPASWHIVDLGKV 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + E I  ++A A+TV WNGPLGVFEI  F   T  VA  +A    E     + GGGD++ 
Sbjct: 300 SQEQILDILAGAKTVFWNGPLGVFEIPSFAHGTNAVARMLADA-AEHGATVVIGGGDSVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G++++ T++ST GGA LE+LEG++LPG+  L
Sbjct: 359 AITQQGLADKMTHISTGGGASLEFLEGRELPGVTVL 394


>gi|319789187|ref|YP_004150820.1| Phosphoglycerate kinase [Thermovibrio ammonificans HB-1]
 gi|317113689|gb|ADU96179.1| Phosphoglycerate kinase [Thermovibrio ammonificans HB-1]
          Length = 406

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 159/402 (39%), Positives = 240/402 (59%), Gaps = 7/402 (1%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M    T+ D+    ++G +  +RVD+NVP  DG + +  RI   +PTI  L++  AKVV+
Sbjct: 6   MFNKMTLRDVPPEKLKGRKVFVRVDFNVPIEDGVITNDKRIRAALPTINYLLDHGAKVVL 65

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHL RP+   D   SL  V      +L K + FV DCIG    +++ SL  G + L EN
Sbjct: 66  CSHLDRPKG-WDPKLSLKPVAERLSRLLEKEVKFVPDCIGEVAKEAVDSLEPGEVALLEN 124

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKEL 177
           VRFY  E +NDP+F R L+   + Y+NDAF  +HR HAS  G++  +   + G  ++KE+
Sbjct: 125 VRFYPGETKNDPEFARQLAELAEIYVNDAFGTAHRKHASTYGITQFVELAVAGFLLEKEI 184

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+      ++PLV I+GGSKVS K+ ++ NL+ KVDK+++GGGMA +FL A G  VG+
Sbjct: 185 KYLQKALENPERPLVLIIGGSKVSGKLEVIENLLTKVDKMLVGGGMAYTFLKAMGYQVGK 244

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D      +I  EA +   +  VP D   A +      T++ + + +P D + LD+
Sbjct: 245 SLVEDDLIPTAKRIMEEADQRGVKFYVPVDSNNADQFSETAHTKLTTYKEIPEDMMGLDI 304

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  TVE  K+ ++ A+T++WNGP+GVFE+E F   T+ +   VA+    +  + I GGGD
Sbjct: 305 GPATVELFKEALSDAKTILWNGPMGVFEMEKFRFGTMAIGKIVAE---HKEALRIVGGGD 361

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           ++ A+   G+ +E  +VST GGAFL++L GK+LP IVAL+  
Sbjct: 362 SVAAIEMLGLEHEIDHVSTGGGAFLQFLAGKELPAIVALTDK 403


>gi|332654004|ref|ZP_08419748.1| phosphoglycerate kinase [Ruminococcaceae bacterium D16]
 gi|332517090|gb|EGJ46695.1| phosphoglycerate kinase [Ruminococcaceae bacterium D16]
          Length = 398

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 146/400 (36%), Positives = 236/400 (59%), Gaps = 9/400 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPF-IDG--KVADVTRIERVVPTILELVEKKAKV 56
           M+   +T+ D+ ++ G + LLR D+NVP   DG   + D  RI   +PTI  L+++ A V
Sbjct: 1   MNYNKKTVKDI-EVAGKKVLLRCDFNVPMAKDGSGVITDDKRIRAALPTIQYLLDQNAAV 59

Query: 57  VIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILA 116
           +  SH+G+P+ +     SL  V      +L K ++  +D +G       A+L  G I+L 
Sbjct: 60  IACSHMGKPKGEVVPSLSLKPVAKRLSELLGKEVIMADDVVGPDAQAKAAALKPGQIMLL 119

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKE 176
           EN RF   E +NDP+  + ++   + Y++DAF   HRAHAS  G++  LP+  G  +QKE
Sbjct: 120 ENTRFEKGETKNDPELAKAMASMAEVYVSDAFGAVHRAHASTAGVADYLPAVSGFLIQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L ++    +  K+PLVAI+GGSKVS+KI ++ NL++  D ++IGGGM  +FL AQG  +G
Sbjct: 180 LEIIGGALANPKRPLVAILGGSKVSSKIGVINNLLEIADTIIIGGGMTYTFLKAQGGSIG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D+ D  + +  +A+    ++++P D + A+E        +V + ++P D + +D
Sbjct: 240 KSLLEEDWLDYCNDMMKKAQEKGVKLLLPEDTICAKEFSADAEPILVDSMNIPDDCLGMD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G K +E     +  A TV+WNGP+GVFE   F + T  VA  ++        I+I GGG
Sbjct: 300 IGPKAIEAYSNAVKDAGTVIWNGPMGVFEFPAFAKGTQAVAEALS----NSNAITIIGGG 355

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+  A+   G +++ T++ST GGA LE++EGK+LPG+  L
Sbjct: 356 DSAAAVQQLGYADKMTHISTGGGASLEFMEGKELPGVACL 395


>gi|86751566|ref|YP_488062.1| phosphoglycerate kinase [Rhodopseudomonas palustris HaA2]
 gi|86574594|gb|ABD09151.1| phosphoglycerate kinase [Rhodopseudomonas palustris HaA2]
          Length = 398

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 198/397 (49%), Positives = 274/397 (69%), Gaps = 3/397 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++  RT++D+ D++G R LLRVD NVP   GKV D TR++RV PTI E+  K  KV++ 
Sbjct: 1   MTKSFRTLDDV-DVKGQRVLLRVDLNVPMDSGKVTDTTRLDRVAPTITEIAGKGGKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+ + DK+ SL  V +    ++ K + F  DC+G   + +IA++ +G I+  EN 
Sbjct: 60  AHFGRPKGRDDKN-SLKPVAAALADVIKKPVGFAEDCVGEPAATAIAAMQDGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L+  GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  
Sbjct: 119 RFHPEEEKNDPTFVAKLAELGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELVA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG  VG+SL
Sbjct: 179 LNKALEAPTKPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGFKVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D ++   +I  +A+ ++C II+P D  VA   +   P+      ++P D++ILDVG 
Sbjct: 239 CEKDLAETALRIMNKAEAASCAIILPVDATVAYHFEANAPSFAYGLDAIPDDAMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +++E I   I  A T++WNGP+G FE+ PFD+ TVE A + A+ TK   +IS+AGGGDT+
Sbjct: 299 RSIERIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAARHAARRTKAGMLISVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AL HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 359 AALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|261337413|ref|ZP_05965297.1| phosphoglycerate kinase [Bifidobacterium gallicum DSM 20093]
 gi|270277798|gb|EFA23652.1| phosphoglycerate kinase [Bifidobacterium gallicum DSM 20093]
          Length = 401

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 147/401 (36%), Positives = 231/401 (57%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L +  AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIEALRDAGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +     SL  V +    +L   +   +D  G      +A++ +G ++L ENVRF  
Sbjct: 61  RPKGQVVPALSLAPVAARLSELLGCPVELASDTYGEDAQAKVAAMKDGDVVLLENVRFNP 120

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D     ++ + ++  GD +++D F V HRA  S   ++  LP+  G+ ++KE+  
Sbjct: 121 EETSKDEAERAEYAKKIAALGDVFVSDGFGVVHRAQGSNFDVAKDLPAAAGKLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L    ++  +PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A+G  VG SL
Sbjct: 181 LSRAVNDPARPLTVVLGGSKVSDKLGVISNLLDKADRLVIGGGMVFTFLKAEGYEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  D V      AK++  E+++P D+VV +        I  +VV A  +P D + LD
Sbjct: 241 LEEDQIDTVKGYIETAKKNGVELVLPVDIVVNKGFPAGDTPIDPKVVPADQIPSDMMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++ +     I  ++TV+WNGP+GVFEI  F   T  VA  +   T E    +I GGG
Sbjct: 301 IGPESCKLFHDKIVDSKTVVWNGPMGVFEIPQFAEGTRAVAQALVDAT-EHGAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKQLPGLTVL 400


>gi|297847996|ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297337721|gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 478

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 250/400 (62%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV+
Sbjct: 74  MAK-KSVGDLTSADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVI 132

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   ++  +DCIG  +   +ASL EGG++L E
Sbjct: 133 LSTHLGRPKG-VTPKFSLAPLVPRLSELLGIEVVKADDCIGPQVESLVASLPEGGVLLLE 191

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 192 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 251

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 252 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 311

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 312 SSLVEEDKLELATSLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLD 371

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+   + +   +TV+WNGP+GVFE E F + T  VA+ +A+L+K + + +I GGG
Sbjct: 372 IGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAQGTEAVANKLAELSK-KGVTTIIGGG 430

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++   +++ST GGA LE LEGK LPG+V L
Sbjct: 431 DSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVVL 470


>gi|332716470|ref|YP_004443936.1| phosphoglycerate kinase [Agrobacterium sp. H13-3]
 gi|325063155|gb|ADY66845.1| phosphoglycerate kinase [Agrobacterium sp. H13-3]
          Length = 400

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 219/397 (55%), Positives = 289/397 (72%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL EK AKV++ +
Sbjct: 1   MPAFKTIDDLNDIAGKRVLVRVDLNVPVADGKVTDSTRIERVAPTILELSEKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   D SL ++V   E +L   + F +DCIG+  + ++A +++G I+L EN R
Sbjct: 61  HFGRPKGEPVADMSLSQIVPAVEEVLDHAVFFASDCIGAPAADAVAKMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+ND  FV  L+ NGD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDTAFVEALAANGDIYVNDAFSAAHRAHASTEGLARHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVS+KI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGQPVRPVVAIVGGAKVSSKIDLLMNLVKKVDALVIGGGMANTFLAARGAQVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C I++P D VVARE K G   ++V   ++P D+++LDVG K
Sbjct: 241 EHDLAETAKQIMIEAATSGCAIVLPEDGVVAREFKAGAANEIVDINAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE IK  I++A T++WNGPLG FEIEPFD ATV  A + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SVESIKAWISRAETLVWNGPLGAFEIEPFDVATVAAAKHAAECTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+S++FTY+STAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVSDDFTYISTAGGAFLEWMEGKELPGVAILT 397


>gi|218133722|ref|ZP_03462526.1| hypothetical protein BACPEC_01591 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991097|gb|EEC57103.1| hypothetical protein BACPEC_01591 [Bacteroides pectinophilus ATCC
           43243]
          Length = 397

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 152/398 (38%), Positives = 246/398 (61%), Gaps = 8/398 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++  R L+R D+NVP IDGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKDKRVLVRCDFNVPLIDGKITDENRLVAALPTIKKLINDGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+   DK  SL  V      +L + + F  D   +G     ++A++++G +IL EN
Sbjct: 60  HLGKPKG-PDKAFSLAPVAKRLTELLGQEVKFAADDTVVGDNARAAVAAMNDGDVILLEN 118

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            RF  EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  M+KE+
Sbjct: 119 TRFRPEETKNGDEFSKDLASICDVFVNDAFGTAHRAHCSNVGVTKFVDTAVVGYLMEKEI 178

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +      +P VAI+GGSKVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  VG+
Sbjct: 179 DFLGNAVDNPVRPFVAILGGSKVSSKISVINNLLDKVDTLIIGGGMSYTFQKALGGNVGQ 238

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + ++ D   ++  +A+    +I++P D VV +E K   P  VV A     D + +D+
Sbjct: 239 SLVEDEYLDYAKEMIEKAEAKNVKILIPVDTVVTKEFKNDTPFHVVEAGQQEDDDMGMDI 298

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT    ++ +  A+TV+WNGP+GVFE + F + T+ VA  +A+L   +   +I GGGD
Sbjct: 299 GPKTCALYQEALKDAKTVVWNGPMGVFEFDNFAKGTIAVAQALAEL---KDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVA 395
           + +A+ + G  ++ T++ST GGA LE+LEGK+LPG+ A
Sbjct: 356 SASAVNNLGFGDKMTHISTGGGASLEFLEGKELPGVAA 393


>gi|15893998|ref|NP_347347.1| phosphoglycerate kinase [Clostridium acetobutylicum ATCC 824]
 gi|3914324|sp|O52632|PGK_CLOAB RecName: Full=Phosphoglycerate kinase
 gi|15023590|gb|AAK78687.1|AE007586_4 3-phosphoglycerate kinase [Clostridium acetobutylicum ATCC 824]
 gi|2829139|gb|AAC13161.1| phosphoglycerate kinase [Clostridium acetobutylicum ATCC 824]
 gi|325508124|gb|ADZ19760.1| phosphoglycerate kinase [Clostridium acetobutylicum EA 2018]
          Length = 397

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 233/400 (58%), Gaps = 9/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +T+ D+ D++G R L+R D+NVP  DG + D  R+   +PTI  L E   KV++ SHL
Sbjct: 4   NKKTIEDV-DVKGKRVLVRCDFNVPLKDGVITDENRLNGALPTIKYLSEHGGKVILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+ +   D   +L  V      +L + + F  D   +G    +++A L EG I+L EN R
Sbjct: 63  GKAKG-PDPSKTLAPVAKRLSELLGREVKFAADDTVVGENAKKAVAELKEGEIVLLENTR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSM 179
           F  EE +ND  F + L+   D Y+NDAF  +HRAH S  G++  + +   G  +QKEL  
Sbjct: 122 FRPEEGKNDDAFSKDLASLADVYVNDAFGTAHRAHCSTVGVTKFVDTAVCGYLIQKELKF 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L S      +P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  +G SL
Sbjct: 182 LGSAVENPVRPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTIGTSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+    ++++P D +V  E K           ++P   + LD+G 
Sbjct: 242 LEADKVDYAKEMIEKAEAKGVKLLLPIDNIVGAEFKADTKAVTTEDANIPEGYMGLDIGP 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT +     + +A+TV+WNGP+GVFE E F + T +VA  +A    E    ++ GGGD+ 
Sbjct: 302 KTQKLYADAVKEAKTVVWNGPMGVFEFENFAKGTKDVAKAMA----ESDATTVIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGIVAL+  
Sbjct: 358 AAVNQLGFGDKMTHISTGGGASLEFLEGKELPGIVALNDK 397


>gi|226320772|ref|ZP_03796328.1| phosphoglycerate kinase [Borrelia burgdorferi 29805]
 gi|226233827|gb|EEH32552.1| phosphoglycerate kinase [Borrelia burgdorferi 29805]
          Length = 393

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 249/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVNMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + +++ ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYINSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I+ V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIENVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|192289440|ref|YP_001990045.1| phosphoglycerate kinase [Rhodopseudomonas palustris TIE-1]
 gi|192283189|gb|ACE99569.1| Phosphoglycerate kinase [Rhodopseudomonas palustris TIE-1]
          Length = 398

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 201/397 (50%), Positives = 279/397 (70%), Gaps = 3/397 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++  RT++D+ D++G R LLRVD NVP   GKV D TR+ERV+PTI EL  K AKV++ 
Sbjct: 1   MTKTFRTLDDV-DVKGKRVLLRVDLNVPMDAGKVTDTTRLERVMPTITELSGKGAKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+ + DK+ SL  V +    ++ K + F +DCIG   +++IA++++G I+  EN 
Sbjct: 60  AHFGRPKGRDDKN-SLKPVAAALADVIKKPVGFADDCIGEPAAKAIAAMADGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L+  GD ++NDAFS +HRAHA+  GL H LP+Y GR MQ EL  
Sbjct: 119 RFHPEEEKNDPAFVAKLAELGDIWVNDAFSAAHRAHATTEGLGHKLPAYAGRTMQAELVA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++AIVGG+KVSTKI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SL
Sbjct: 179 LNKALEAPVKPVIAIVGGAKVSTKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D +    +I  +A+ + C II+P D  VA   +   P+      ++P D++ILDVG 
Sbjct: 239 CEKDLAPTALRILDKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPDDAMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +++E I   I  A T++WNGP+G FE+ PFD+ TVE A + AK T+  +++S+AGGGDT+
Sbjct: 299 RSIERIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAAKRTRAGKLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            AL HAG++++FTY+STAGGAFLEW+EGK LPG+  L
Sbjct: 359 AALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVEVL 395


>gi|82621108|gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
          Length = 402

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 239/400 (59%), Gaps = 5/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  +++  L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L++  A+V+
Sbjct: 1   MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQNGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+        L   V     +L   +   ND IG  +   +A L EGG++L E
Sbjct: 61  LASHLGRPKGLVHPKVQLKPFVPRLSELLGIEVKMANDSIGPEVENLVAELPEGGVVLLE 120

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+ND +F + L+   D Y+NDAF  +HRAHAS  G++ +L   + G  MQKE
Sbjct: 121 NVRFYKEEEKNDLEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKVLKPAVAGFLMQKE 180

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  +KP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 181 LDYLVGAVSNPQKPFAAIVGGSKVSSKIGVIESLLEKVDVLLLGGGMIFTFYKAQGYAVG 240

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A  +P   + LD
Sbjct: 241 SSLVKEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAANANSKIVPASEIPDGWMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
            G   ++     +   +T++WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 301 FGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSG-KGVTTIIGGG 359

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 360 DSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLAL 399


>gi|160940325|ref|ZP_02087670.1| hypothetical protein CLOBOL_05215 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436905|gb|EDP14672.1| hypothetical protein CLOBOL_05215 [Clostridium bolteae ATCC
           BAA-613]
          Length = 413

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 143/409 (34%), Positives = 227/409 (55%), Gaps = 15/409 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL+D++G + L+R D+NVP  +G + +  RI+  +PTI +L+++ AKV++ S
Sbjct: 9   MLNKKTVDDLKDLQGKKVLVRCDFNVPLKEGVIQNYNRIDGAIPTIKKLLDQGAKVILCS 68

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V       L   + FV+D    G    +  A L +G ++L +N
Sbjct: 69  HLGKPKGEPVPEMSLAPVAPALSERLGVEVKFVDDPKVTGPETQKVAAELKDGEVLLLQN 128

Query: 119 VRFYSEEERNDPDFVRMLSR-------NGDFYINDAFSVSHRAHASITG-LSHLLPSYIG 170
            R+  EE +         +            ++NDAF  +HRAH S  G       + +G
Sbjct: 129 TRYRVEETKFKDGDAASEAYAKELADLCDGIFVNDAFGTAHRAHCSNVGVTRFTKENVVG 188

Query: 171 RAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVA 230
             M+KE+  L        +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  A
Sbjct: 189 YLMEKEIRFLGQAVENPVRPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMAYTFAKA 248

Query: 231 QGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPL 290
           QG  +G SLC+ D  D   ++  +A+    ++++P D V  +E       +VV    +  
Sbjct: 249 QGQEIGNSLCEADKLDYALEMIKKAEEKGVKLLLPVDHVEGKEFSNDTEHKVVDV--IDA 306

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
                D+G KT+   K+ +  A+TV+WNGP+GVFE   F   T+EV   VA+L       
Sbjct: 307 GWSGFDIGPKTIALYKEALQGAKTVVWNGPMGVFEFSNFAEGTLEVCRAVAELA---DAT 363

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           ++ GGGD++ A+   G +++ T++ST GGA LE+LEGK+LPG+ A    
Sbjct: 364 TVIGGGDSVNAVKRLGFADKMTHISTGGGASLEFLEGKELPGVAAADNK 412


>gi|212715854|ref|ZP_03323982.1| hypothetical protein BIFCAT_00760 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661221|gb|EEB21796.1| hypothetical protein BIFCAT_00760 [Bifidobacterium catenulatum DSM
           16992]
          Length = 401

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 143/401 (35%), Positives = 233/401 (58%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   +    D  G      +A++++G ++L +NVR+  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGIEVPLAEDTYGEDAQAKVAAMNDGDVVLLQNVRYNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP+    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDPEERSAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A+G+ VG SL
Sbjct: 181 LSRATVEPERPLTVVLGGSKVSDKLGVIENLLDKADRLVIGGGMVYTFLKAKGLEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP---TQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P D+VV             +VV+A ++P D + LD
Sbjct: 241 LEEDQVETVKGYIERAEQNGVELVLPTDIVVNPVFPKSDEDIAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPAFAAGTEAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|317968173|ref|ZP_07969563.1| phosphoglycerate kinase [Synechococcus sp. CB0205]
          Length = 401

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 251/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   ++RG R L+RVD+NVP  D G + D TRI   +PTI +LV K AKV+
Sbjct: 1   MAK-RSLASLSADELRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L K ++  + CIG      +A++++G ++L E
Sbjct: 60  LSAHFGRPKGQVNEGMRLTPVAARLSELLGKGVVKTDSCIGPDAEAKVAAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+N+ DF + L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNEGDFAKKLANLADVYVNDAFGAAHRAHASTEGVTQYLSPSVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    + K+PL AIVGGSKVS+KI +L  L+ K DK+++GGGM  +F  A+GM VG
Sbjct: 180 LQYLQGAIDQPKRPLAAIVGGSKVSSKIGVLEALLDKCDKILVGGGMIFTFYKARGMAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +A     + ++P DVV+A        +QV    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAAAKGVQFLLPTDVVLADNFAPDANSQVAKVDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  +TV+WNGP+GVFE + F   T  +A  +A ++ +    +I GGG
Sbjct: 300 IGPDSVKVFQDALADCKTVIWNGPMGVFEFDAFAAGTNAIATTLADISGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|82623391|gb|ABB87110.1| unknown [Solanum tuberosum]
          Length = 401

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 242/400 (60%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M+  +++  L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L++  A+V+
Sbjct: 1   MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDIFNITDDTRIRAAVPTIKYLMQNGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   ND IG  +   +A L EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLAIEVKMANDSIGPEVENLVAELPEGGVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++ +L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKVLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  +KP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVSNPQKPFAAIVGGSKVSSKIGVIESLLEKVDVLLLGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   ++     +   + ++WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDAIKSFGSALDTTKNIIWNGPMGVFEFDKFAAGTEAIAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|317132500|ref|YP_004091814.1| Phosphoglycerate kinase [Ethanoligenens harbinense YUAN-3]
 gi|315470479|gb|ADU27083.1| Phosphoglycerate kinase [Ethanoligenens harbinense YUAN-3]
          Length = 397

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 162/399 (40%), Positives = 235/399 (58%), Gaps = 7/399 (1%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             +T+ D+ D+ G R   R+D+NVP   +G + D  RI   +PTI  L+   AKVV+ SH
Sbjct: 4   NKKTIEDV-DVAGKRVFARMDFNVPLDANGNITDDKRITASLPTIEYLLNHGAKVVLSSH 62

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + +   SL  V      +L K +    D IG       A+L +G  +L ENVRF
Sbjct: 63  LGRPKGEFNPKYSLAPVAKRLSELLGKEVKIAKDVIGDDAKALAANLKDGEAMLLENVRF 122

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSML 180
           + EEE+NDP+F + L+  G+ ++NDAF  +HRAHAS  G+SH +P S  G  + KELS++
Sbjct: 123 HKEEEKNDPEFAKALAGYGEIFVNDAFGTAHRAHASTEGVSHFIPVSVAGFLIGKELSVM 182

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                + K+P +AI+GG+KVS KI ++ NL++KVD L++GGGMA +F+ AQG  +G SLC
Sbjct: 183 GKALDDPKRPFIAILGGAKVSDKIAVIKNLIEKVDTLIVGGGMAYTFMKAQGHHIGNSLC 242

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  D  +++   AK    + ++P D  V  +       QVV +  +P   + LD+G  
Sbjct: 243 EEDKLDLANELMAAAKAKGIKFLLPVDNRVGDKYDPDCEKQVVDSDEIPNGWMGLDIGPA 302

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + +     IA A TV+WNGPLGV E + F   T  VA  +A        ISI GGGD+  
Sbjct: 303 SEKLFSNAIAGAGTVVWNGPLGVSEWDYFAAGTRAVATAIA----NSGAISIIGGGDSAA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G +++ T++ST GGA LE+LEGK LPGI  L+  
Sbjct: 359 AIEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLNDK 397


>gi|33239673|ref|NP_874615.1| phosphoglycerate kinase [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|46576741|sp|Q7VDZ4|PGK_PROMA RecName: Full=Phosphoglycerate kinase
 gi|33237198|gb|AAP99267.1| 3-phosphoglycerate kinase [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 402

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 160/400 (40%), Positives = 253/400 (63%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++++L   D+ G R L+RVD+NVP   +G + D TRI   +PTI  L+EK+A+V+
Sbjct: 1   MAK-RSLSNLSVEDLCGKRVLVRVDFNVPLNEEGSITDDTRIRAALPTIQHLIEKEARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ K ++D  L  V      +L K ++    CIG    + +  +S G ++L E
Sbjct: 60  LSAHFGRPKGKVNEDMRLTPVSQRLSELLGKTVVKTESCIGPDAEKKVHEMSNGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF  EEE+ND +F + L+   + Y+NDAF  +HRAHAS  G+++   PS  G  M+KE
Sbjct: 120 NVRFIGEEEKNDSEFAKKLASLAEVYVNDAFGAAHRAHASTEGVTNYLSPSVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      ++PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LKYLQGAIDSPQRPLAAIVGGSKVSSKIGVLESLIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D    +  +AK    ++++P DVV+A        +Q+V   S+P   + LD
Sbjct: 240 KSLVEDDKLDLARALEKKAKEKGVQLLLPSDVVLADNFSPDASSQMVQIDSIPEGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G ++V+  +  +A  +TV+WNGP+GVFE + F   T  ++  +A+L+ +    +I GGG
Sbjct: 300 IGKESVKLFQDALADCKTVIWNGPMGVFEFDKFANGTNSISTTLAELSAKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLASKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|223975935|gb|ACN32155.1| unknown [Zea mays]
          Length = 411

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 160/401 (39%), Positives = 246/401 (61%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ +L   D+ G R  +R D NVP  + + + D TRI   +PTI  ++ K AKV+
Sbjct: 4   MAK-KSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVI 62

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   +D IG  + + +A+L  GG++L E
Sbjct: 63  LSSHLGRPKG-FTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE 121

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 122 NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHASTEGVTKFLQPSVAGFLLQKE 181

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 182 LDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLPVG 241

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +Q+V A ++P   + LD
Sbjct: 242 ASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLD 301

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V      +   +TV+WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 302 IGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSG-KGVTTIIGGG 360

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL+
Sbjct: 361 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALN 401


>gi|226530482|ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gi|195612656|gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gi|195612966|gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
          Length = 480

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 160/401 (39%), Positives = 246/401 (61%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ +L   D+ G R  +R D NVP  + + + D TRI   +PTI  ++ K AKV+
Sbjct: 76  MAK-KSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVI 134

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   +D IG  + + +A+L  GG++L E
Sbjct: 135 LSSHLGRPKG-FTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE 193

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 194 NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHASTEGVTKFLQPSVAGFLLQKE 253

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 254 LDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLPVG 313

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +Q+V A ++P   + LD
Sbjct: 314 ASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLD 373

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V      +   +TV+WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 374 IGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSG-KGVTTIIGGG 432

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D++ A+   G+++  +++ST GGA LE LEGK+LPG+VAL+
Sbjct: 433 DSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALN 473


>gi|229816379|ref|ZP_04446684.1| hypothetical protein COLINT_03427 [Collinsella intestinalis DSM
           13280]
 gi|229808028|gb|EEP43825.1| hypothetical protein COLINT_03427 [Collinsella intestinalis DSM
           13280]
          Length = 424

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 154/394 (39%), Positives = 239/394 (60%), Gaps = 6/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G R L+RVD+NVP  DG V D TRI   +PTI  LV+  A+V++ SHLGR
Sbjct: 33  KTVRDI-DVDGKRVLVRVDFNVPIKDGVVGDTTRINAALPTIKYLVDHNARVILMSHLGR 91

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P       + SL  V +    +   ++ FV D  G   + ++ +L  G +++ ENVRF  
Sbjct: 92  PDGTGFQPEFSLEPVAAKLAELSGLDVTFVADTYGEKAAAAVEALEPGKVLVLENVRFDK 151

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  + L+  GD ++ DAF  +HR+  S+ G +  LP+  G  ++KE+  L   
Sbjct: 152 REKKNDPEIAKTLASYGDVFVLDAFGTAHRSQGSVVGPAEYLPAVAGFLLEKEVDTLTGI 211

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           F+  ++PLVAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +AQGM VG SL + D
Sbjct: 212 FANPERPLVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAQGMTVGNSLKEED 271

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+    +I++P D  VA         +VV++ ++P D   +D+G KT E
Sbjct: 272 WVERAGEMLKKAEEKGVKILLPIDNRVADHFGEDAVPEVVASDAIPDDREGMDIGPKTEE 331

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + I  A+TV WNGP+GVFE + F   T  +A  VA+        SI GGGD++ A+ 
Sbjct: 332 IYAEAIKGAKTVFWNGPMGVFEFDNFAHGTQAIAEAVAEA----DCTSIIGGGDSVAAVN 387

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              ++++ +++ST GGA +E +EGK LPG+ AL+
Sbjct: 388 KFNLADKMSWISTGGGASMELVEGKALPGVEALN 421


>gi|227875316|ref|ZP_03993458.1| phosphoglycerate kinase [Mobiluncus mulieris ATCC 35243]
 gi|306818578|ref|ZP_07452301.1| phosphoglycerate kinase [Mobiluncus mulieris ATCC 35239]
 gi|307701120|ref|ZP_07638145.1| phosphoglycerate kinase [Mobiluncus mulieris FB024-16]
 gi|227844221|gb|EEJ54388.1| phosphoglycerate kinase [Mobiluncus mulieris ATCC 35243]
 gi|304648751|gb|EFM46053.1| phosphoglycerate kinase [Mobiluncus mulieris ATCC 35239]
 gi|307614115|gb|EFN93359.1| phosphoglycerate kinase [Mobiluncus mulieris FB024-16]
          Length = 397

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 233/400 (58%), Gaps = 9/400 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L+T+  L D+ G R L+R D+NVP  DG + D  RI   +PT+ +L++  AKV++ +HLG
Sbjct: 2   LKTIESLGDLTGKRVLVRSDFNVPLKDGVITDDGRIRAALPTLKKLLDGGAKVIVMAHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + + + SL  V    E ++   +    D  G+      A+L  G I++ ENVRF  
Sbjct: 62  RPKGQVNPEFSLAPVAKRLEELIGAKVTLAADTTGADAQAKAAALPAGEILMLENVRFDP 121

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E   D     +F   +++  D +++D F V HR  AS+  ++ LLP+  G  + KE+  
Sbjct: 122 RETSKDDGERAEFAAEMAKLADLFVSDGFGVVHRKQASVYDIAKLLPAAAGLLVVKEIES 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K D L+IGGGMA +FL AQG  VG+SL
Sbjct: 182 LRKATDNPERPYTVVLGGSKVSDKLGVIANLLTKADSLIIGGGMAFTFLAAQGYRVGKSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D V     +AK++  ++++P DVVVA E K   P  VVSA ++P D + LD+G 
Sbjct: 242 LESDQIDTVKGYLEKAKQNGVDLVLPVDVVVAPEFKAEAPATVVSADAIPEDQMGLDIGP 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+ E     IAQ++TV WNGP+GVFE E F   T  VA  +    ++    S+ GGGD+ 
Sbjct: 302 KSRENFAAKIAQSKTVAWNGPMGVFEFEAFAAGTKAVAQAL----QDGDCFSVVGGGDSA 357

Query: 360 TALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
            A+   G   ++F+++ST GGA LE LEGK LPGI  L G
Sbjct: 358 AAVRLLGFDESKFSHISTGGGASLELLEGKVLPGIAVLEG 397


>gi|86609153|ref|YP_477915.1| phosphoglycerate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123502133|sp|Q2JKX6|PGK_SYNJB RecName: Full=Phosphoglycerate kinase
 gi|86557695|gb|ABD02652.1| phosphoglycerate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 412

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 165/412 (40%), Positives = 242/412 (58%), Gaps = 17/412 (4%)

Query: 1   MSRLRTMNDLR----DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAK 55
           M++ +T+  L     D+ G R L+R D+NVP    G + D TRI   +PT+  L +  AK
Sbjct: 1   MAK-QTLGSLLSSGFDLAGKRVLVRADFNVPLDAQGNITDDTRIRAALPTVQALTQAGAK 59

Query: 56  VVIFSHLGRPQSKSDKD---------CSLFKVVSIAESILHKNILFVNDCIGSTLSQSIA 106
           V++ SHLGRP  K  +           SL  V +    +L + + F  DCIG      + 
Sbjct: 60  VILTSHLGRPVKKDKETGAVKVAREGNSLAPVATRLSQLLGQPVAFAPDCIGPEAEAVVN 119

Query: 107 SLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP 166
            L  G + L ENVRFY EEE NDP+F R L+   D ++NDAF  +HRAHAS  G++  L 
Sbjct: 120 RLENGQVALLENVRFYPEEEDNDPEFARKLASLADLFVNDAFGSAHRAHASTAGVTAYLQ 179

Query: 167 SYI-GRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMAN 225
             + G  +++EL  L     + ++PL AI+GGSKVSTKI ++  L++KVDKL++GGGM  
Sbjct: 180 PAVAGYLVERELQFLSGAIEDPRRPLAAIIGGSKVSTKIGVIERLLEKVDKLLLGGGMIF 239

Query: 226 SFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA 285
           +F  AQG+  G+SL + D  D    +  +AK    E+++P DVVVA         Q VS 
Sbjct: 240 TFYQAQGIQTGKSLVETDKLDLARSLMEKAKERGVELLLPVDVVVADRFDKDAQAQTVSI 299

Query: 286 QSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTK 345
            ++P D + LD+G ++V+  +  +   +TV+WNGP+GVFE + F   T  +A  +A LT+
Sbjct: 300 HAIPEDWMGLDIGPESVKAFQSALQGCQTVVWNGPMGVFEFDRFALGTEAIARTLADLTQ 359

Query: 346 ERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
                +I GGGD++ A+   G++++ T++ST GGA LE LEGK LPGI AL+
Sbjct: 360 A-GATTIIGGGDSVAAVEKVGLADKMTHISTGGGASLELLEGKVLPGIAALT 410


>gi|159185882|ref|NP_356882.2| phosphoglycerate kinase [Agrobacterium tumefaciens str. C58]
 gi|24418593|sp|Q8U9I9|PGK_AGRT5 RecName: Full=Phosphoglycerate kinase
 gi|159141016|gb|AAK89667.2| phosphoglycerate kinase [Agrobacterium tumefaciens str. C58]
          Length = 400

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 218/397 (54%), Positives = 287/397 (72%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL  K AKV++ +
Sbjct: 1   MPAFKTIDDLNDIAGKRVLVRVDLNVPVADGKVTDATRIERVAPTILELSSKGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ +   + SL ++V   E +L   I F  DCIG+  + ++A +++G I+L EN R
Sbjct: 61  HFGRPKGEPVAEMSLSQIVPTVEDVLDHAISFATDCIGAPAADAVAKMNDGDILLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP FV  L+ NGD Y+NDAFS +HRAHAS  GL+  LP+Y GR MQ EL  L
Sbjct: 121 FHKGEEKNDPAFVEELAANGDIYVNDAFSAAHRAHASTEGLARHLPAYAGRTMQAELEAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E    +  +P+VAIVGG+KVS+KI LL+NLVKKVD LVIGGGMAN+FL A+G  VG+SLC
Sbjct: 181 EKGLGQPVRPVVAIVGGAKVSSKIDLLMNLVKKVDALVIGGGMANTFLAARGTNVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C I++P D VVARE   G   ++V   ++P D+++LDVG K
Sbjct: 241 EHDLAETAKQIMIEAATSGCAIVLPEDGVVAREFTAGAANEIVDINAIPADAMVLDVGPK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE IK  I++A T++WNGPLG FEIEPFD ATV  A + A+ TK  +++S+AGGGDT+ 
Sbjct: 301 SVESIKAWISRAETLVWNGPLGAFEIEPFDAATVAAAKHAAECTKAGKLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+S++FTY+STAGGAFLEW+EGK+LPG+  L+
Sbjct: 361 ALNHAGVSDDFTYISTAGGAFLEWMEGKELPGVAILT 397


>gi|148243328|ref|YP_001228485.1| phosphoglycerate kinase [Synechococcus sp. RCC307]
 gi|166987817|sp|A5GW73|PGK_SYNR3 RecName: Full=Phosphoglycerate kinase
 gi|147851638|emb|CAK29132.1| Phosphoglycerate kinase [Synechococcus sp. RCC307]
          Length = 402

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLRD--IRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R+++ L    +RG R L+RVD+NVP  D G + D TRI   +PTI +L  K AKV+
Sbjct: 1   MAK-RSLSALNSDALRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLTGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++D  L  V +    +L   +   + CIGS     +A++++G ++L E
Sbjct: 60  LSAHFGRPKGQVNEDMRLTPVAARLSELLGAPVAKTDSCIGSDAEAKVAAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+N+  F   L+   + Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNESGFAEKLAALAEVYVNDAFGAAHRAHASTEGVTKYLSPSVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    + K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDDPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +AK    ++++P DVV+A        +QV S  ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAKAKGVQLLLPTDVVLADNFAPDANSQVASIDAIPEGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++  +  +   +TV+WNGP+GVFE + F   T  +A  +A+L+ +    +I GGG
Sbjct: 300 IGPDSIKVFQDALGDCKTVIWNGPMGVFEFDKFAAGTNAIATTLAELSAKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLAAQMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|312148048|gb|ADQ30707.1| phosphoglycerate kinase [Borrelia burgdorferi JD1]
          Length = 393

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 156/397 (39%), Positives = 248/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D  RI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDARIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNPKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + + + ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYIDSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|331082281|ref|ZP_08331407.1| phosphoglycerate kinase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330400767|gb|EGG80368.1| phosphoglycerate kinase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 397

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 135/402 (33%), Positives = 236/402 (58%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  +GK+ D  R+   +PTI +L+    +V++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLQEGKITDENRLVAALPTIKKLIADGGRVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L + + F  D   +G     ++ ++ +G ++L EN
Sbjct: 60  HLGKPKGEAKPELSLAPVAKRLSELLGQEVKFAADAEVVGPNAKAAVEAMKDGEVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   + ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEEFSKELASLCEVFVNDAFGTAHRAHCSNVGVTKFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGMA +F  A G  +G 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMAYTFSKAAGGSIGV 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+ D   ++  +A     ++++P D  +          Q+V +  +P     +D+
Sbjct: 240 SLCEDDYLDYALEMKKKAAEKGVKLLLPVDHRIGDAFSNDCNIQIVGSGQIPEGWEGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    +    +I GGGD
Sbjct: 300 GPETEKIFADAVKDAKTVVWNGPMGCFEMSNFAHGTAAVAKALA----DTDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNILGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|254432738|ref|ZP_05046441.1| phosphoglycerate kinase [Cyanobium sp. PCC 7001]
 gi|197627191|gb|EDY39750.1| phosphoglycerate kinase [Cyanobium sp. PCC 7001]
          Length = 401

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 250/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   ++RG R L+RVD+NVP  + G + D TRI   +PTI +LV+K A+V+
Sbjct: 1   MAK-RSLASLSADELRGKRVLVRVDFNVPLDEAGAITDDTRIRAALPTINDLVDKGARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L K ++  + CIG      +A++++G ++L E
Sbjct: 60  LAAHFGRPKGQVNEGMRLTPVAARLGELLGKPVVKTDSCIGPDAEAKVAAMADGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+NDP F   L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNDPAFAAKLAALADVYVNDAFGAAHRAHASTEGVTKALSPSVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAVDEPKRPLAAIVGGSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  D   ++  +AK    E+++P DVV+A        T   S   +P   + LD
Sbjct: 240 KSLVEEDKLDLARELEAKAKAKGVELLLPTDVVLADNFAPDAKTLTTSVNVIPEGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  +TV+WNGP+GVFE + F   T  +AH +A L+ +    +I GGG
Sbjct: 300 IGPDSVKAFQAALADCQTVIWNGPMGVFEFDKFAAGTNGIAHTLADLSAKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|282897370|ref|ZP_06305372.1| Phosphoglycerate kinase [Raphidiopsis brookii D9]
 gi|281198022|gb|EFA72916.1| Phosphoglycerate kinase [Raphidiopsis brookii D9]
          Length = 400

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 252/400 (63%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +++  L   DI   R L+RVD+NVP  D G + D TRI   +PTI +L+ K AKV+
Sbjct: 1   MSK-KSLASLSAADISDKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLISKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SH GRP+   D+   L  V      +L + ++  NDCIG  ++  +A+L +G ++L E
Sbjct: 60  LASHFGRPKG-VDEKFRLTPVAKRLSELLGQEVIKTNDCIGDDVTARVAALEQGQVLLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+NDP+F R L+ N DFY+NDAF  +HRAHAS  G++    PS  G  ++KE
Sbjct: 119 NVRFHKEEEKNDPEFARQLAANADFYVNDAFGTAHRAHASTEGVTKYLSPSVAGYLVEKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L++     ++PL AI+GGSKVS+KI ++  L++K DKL+IGGGM  +F  A+G+ VG
Sbjct: 179 LQYLQAAIEFPQRPLAAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL ++D  +    +  +A      +++P D+V A +         VS +++P D + LD
Sbjct: 239 KSLVEQDKLELASSLEKKAAERGVTLLLPTDIVAADKFAPDADAVTVSIENIPDDRMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G K+V+  +  +A  +TV+WNGP+GVFE + F   T  +A  +A++ K     +I GGG
Sbjct: 299 IGPKSVKLFQDALADCKTVIWNGPMGVFEFDKFAVGTEAIAQTLAEIGK-TGATTIIGGG 357

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEG  LPGI AL
Sbjct: 358 DSVAAVEKVGLADQMSHISTGGGASLELLEGTVLPGIAAL 397


>gi|306822760|ref|ZP_07456138.1| phosphoglycerate kinase [Bifidobacterium dentium ATCC 27679]
 gi|309801020|ref|ZP_07695152.1| phosphoglycerate kinase [Bifidobacterium dentium JCVIHMP022]
 gi|304554305|gb|EFM42214.1| phosphoglycerate kinase [Bifidobacterium dentium ATCC 27679]
 gi|308222556|gb|EFO78836.1| phosphoglycerate kinase [Bifidobacterium dentium JCVIHMP022]
          Length = 401

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 143/401 (35%), Positives = 234/401 (58%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   +   +D  G      +A++++G ++L +NVRF  
Sbjct: 61  RPKGKVVPELSLAPVATRLGELLGVEVPLASDTYGEDAQAKVAAMNDGDVVLLQNVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP+    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDPEERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A+G+ VG SL
Sbjct: 181 LSRATVDPERPLTVVLGGSKVSDKLGVIENLLDKADRLVIGGGMVYTFLKAKGLEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP---TQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P D+VV             +VV+A ++P D + LD
Sbjct: 241 LEEDQVETVKGYIERAEKNGVELVLPTDIVVNPVFPKSDEDIAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPAFAAGTEAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|298252689|ref|ZP_06976483.1| 3-phosphoglycerate kinase [Gardnerella vaginalis 5-1]
 gi|297533053|gb|EFH71937.1| 3-phosphoglycerate kinase [Gardnerella vaginalis 5-1]
          Length = 401

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 145/402 (36%), Positives = 227/402 (56%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D+ G R L+R D+NVP     + D  RI   +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLSGKRVLVRADFNVPLKGTTITDDGRIRAALPTIKALREQGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      +L  N++   D  G      +A+++ G ++L ENVRF +
Sbjct: 61  RPKGQVVPELSLAPVAQRLGELLGTNVVLAADTYGEDAQAKVAAMNNGDVVLLENVRFNA 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D      + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDASERAAYAKKIASLGEVFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A G  VG SL
Sbjct: 181 LSRATENPERPLTVVLGGSKVSDKLGVIENLLSKADRLVIGGGMVFTFLKALGHEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      AK++  E+++P D+VV          +  +VV A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAKKNGVELVLPTDIVVNAGFPAGDTPVAPEVVPADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   TK     +I GGG
Sbjct: 301 IGSDSQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTRAVAQGLVDATK-NGTFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKTLPGLSVLE 401


>gi|218249895|ref|YP_002374587.1| phosphoglycerate kinase [Borrelia burgdorferi ZS7]
 gi|225549763|ref|ZP_03770728.1| phosphoglycerate kinase [Borrelia burgdorferi 118a]
 gi|226322032|ref|ZP_03797557.1| phosphoglycerate kinase [Borrelia burgdorferi Bol26]
 gi|226699794|sp|B7J0Z2|PGK_BORBZ RecName: Full=Phosphoglycerate kinase
 gi|218165083|gb|ACK75144.1| phosphoglycerate kinase [Borrelia burgdorferi ZS7]
 gi|225369723|gb|EEG99171.1| phosphoglycerate kinase [Borrelia burgdorferi 118a]
 gi|226232622|gb|EEH31376.1| phosphoglycerate kinase [Borrelia burgdorferi Bol26]
          Length = 393

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 157/397 (39%), Positives = 250/397 (62%), Gaps = 4/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
             ++T+ D     G R L+R D+NVP  +G ++D TRI   + TI  L E+ A++V+ SH
Sbjct: 1   MSIKTVKDFSSFAGKRALVRCDFNVPLKEGSISDDTRIRAALSTIEYLKERGARIVLVSH 60

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP  K +   SL  V +    +L +++  ++DCIGS +  S   + +G ++L ENVRF
Sbjct: 61  LGRPDGKKNSKYSLKPVANRLSELLGQDVKMLSDCIGSEVVNSTLQMKDGDVVLLENVRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+EEE+ND +F + LS NGD ++NDAF  +HRAHAS  G++  LPS  G  M+KE   L 
Sbjct: 121 YAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVADYLPSVGGFLMEKEDKFLG 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P V+I+GGSKVS+KI +L +L+ K + +VIGGGMA +FL ++G  +G+SL +
Sbjct: 181 GILKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGMAYTFLHSEGYSIGKSLLE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            ++         +AK    ++I+P D +VA +       + +++ ++P + I +D+G  T
Sbjct: 241 DEYIGIASSFLKKAKELGVKVILPLDHIVADDFNKNSIPEYINSFNIPENKIGMDIGANT 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ I++V+  A+T++WNGPLGVFE + F + T +VA  VA  +     +++ GGGD++ A
Sbjct: 301 LKEIEKVVKTAKTIIWNGPLGVFEFDSFSKGTAKVAEMVASCSG----LTVVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +    +S++ T+VST GGA LE+LEG+ LPGI  L  
Sbjct: 357 VNKFNLSDKITHVSTGGGASLEYLEGRILPGIKVLEN 393


>gi|170746608|ref|YP_001752868.1| phosphoglycerate kinase [Methylobacterium radiotolerans JCM 2831]
 gi|259530782|sp|B1M787|PGK_METRJ RecName: Full=Phosphoglycerate kinase
 gi|170653130|gb|ACB22185.1| Phosphoglycerate kinase [Methylobacterium radiotolerans JCM 2831]
          Length = 400

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 202/399 (50%), Positives = 274/399 (68%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS  RT++D   ++G R L+RVD NVP   G+V D TRIERV PTI E+ E+ AKV++ +
Sbjct: 1   MSAFRTLDDAGSLKGKRVLMRVDLNVPMESGRVTDATRIERVAPTIREVAEQGAKVILLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +   SL  VV    + L +++ F  DC+G   +Q++A+L +G ++L EN R
Sbjct: 61  HFGRPKGKREPKDSLEPVVPALGAALGRDVAFAADCVGDAAAQAVAALKDGDVLLLENTR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           +++ EE+ND  F   L+ NGD Y+N+AFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 121 YHAGEEKNDAAFADALAANGDVYVNEAFSAAHRAHASTEGLAHRLPAYAGREMQAELDAL 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P++A+VGG+KVS+KI LL NLV KVD LVIGGGMAN+FL AQG  VG+SLC
Sbjct: 181 TKGLESPQRPVIALVGGAKVSSKIDLLENLVAKVDMLVIGGGMANTFLHAQGKAVGKSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D ++   +I   A+++ C II+P D V A E K   P + V   +VP  S+ILD G +
Sbjct: 241 EKDLAETATRILAAAEKAGCRIILPVDAVAASEFKARAPHETVPVDAVPDASMILDAGPR 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +V  I   I  A+T++WNGPLG FE+ PFD ATV  A + A  TK+ +++S+AGGGDT+ 
Sbjct: 301 SVAEINAAIDGAKTLVWNGPLGAFELAPFDAATVATAKHAAARTKDGQLVSVAGGGDTVA 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           AL HAG+  +FTYVSTAGGAFLEWLEGK LPG+ AL   
Sbjct: 361 ALNHAGVGQDFTYVSTAGGAFLEWLEGKALPGVEALRAK 399


>gi|9230771|gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
          Length = 401

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 245/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G R  +RVD NVP  D   + D TRI   +PTI  L    AKV+
Sbjct: 1   MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAIPTIKYLTGYGAKVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +    D IG  + + +A + EGG++L E
Sbjct: 61  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGSEVTIAGDSIGEEVEKLVAQIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF+ EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  KKP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVSNPKKPFAAIVGGSKVSSKIGVIESLLEKVDILLLGGGMVFTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D       +  +AK     +++P DVV+A +       ++V A S+P   + LD
Sbjct: 240 TSLVEEDKLGLATSLIEKAKAKGVSLLLPTDVVIADKFSADANDKIVPASSIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + + +++TV+WNGP+GVFE + F   T  +A  +A+++  + + +I GGG
Sbjct: 300 IGPDSIKTFNEALDKSQTVIWNGPMGVFEFDKFAAGTEAIAKKLAEISG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|298346735|ref|YP_003719422.1| phosphoglycerate kinase [Mobiluncus curtisii ATCC 43063]
 gi|304389562|ref|ZP_07371524.1| phosphoglycerate kinase [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315656805|ref|ZP_07909692.1| phosphoglycerate kinase [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298236796|gb|ADI67928.1| phosphoglycerate kinase [Mobiluncus curtisii ATCC 43063]
 gi|304327115|gb|EFL94351.1| phosphoglycerate kinase [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315492760|gb|EFU82364.1| phosphoglycerate kinase [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 397

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 153/399 (38%), Positives = 227/399 (56%), Gaps = 9/399 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           L+T++ L D+ G R L+R D+NVP  +GK+ D  RI   +PT+ +L++  AKV+  +HLG
Sbjct: 2   LKTIDSLGDLNGKRVLVRCDFNVPLKEGKITDDGRIRAALPTLQKLLDSGAKVITMAHLG 61

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  VV     ++   +    D  G+       +L+ G I++ ENVRF  
Sbjct: 62  RPKGQVMPEFSLAPVVQRLAELIGVKVTLAQDTTGADAKAKAEALATGEILMLENVRFDP 121

Query: 124 EEERNDP----DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E   D      F   ++   D Y++D F V HR   S+  ++ LLP+  G  + KE+  
Sbjct: 122 RETSKDDAERAAFAAEMAALADCYVSDGFGVVHRKQTSVYDVAKLLPAAAGFLVLKEIES 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++P   ++GGSKVS K+ ++ NL+ K D L+IGGGM  +FL AQG  VG+SL
Sbjct: 182 LRKATDNPERPYTVVLGGSKVSDKLGVIANLLTKADSLLIGGGMTYTFLAAQGYAVGKSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D V     +AK++  E+++P DVVV  E K   PT VV+A ++P D + LD+G 
Sbjct: 242 LEADQIDTVKSYLDQAKQNGVELVLPVDVVVTPEFKPDGPTTVVAADAIPEDQMGLDIGP 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+ E     IA+++TV WNGP+GVFE   F   T  VA  +    ++    SI GGGD+ 
Sbjct: 302 KSRELFAAKIAESKTVAWNGPMGVFEFPAFAGGTKAVAKAM----QDGTAFSIVGGGDSA 357

Query: 360 TALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+   G   ++F+++ST GGA LE LEGK LPGI  L 
Sbjct: 358 AAVRQLGFDESKFSHISTGGGASLELLEGKVLPGIEVLE 396


>gi|260588154|ref|ZP_05854067.1| phosphoglycerate kinase [Blautia hansenii DSM 20583]
 gi|260541681|gb|EEX22250.1| phosphoglycerate kinase [Blautia hansenii DSM 20583]
          Length = 397

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 135/402 (33%), Positives = 236/402 (58%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  +GK+ D  R+   +PTI +L+    +V++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLQEGKITDENRLVAALPTIKKLIADGGRVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V      +L + + F  D   +G     ++ ++ +G ++L EN
Sbjct: 60  HLGKPKGEAKPELSLAPVARRLSELLGQEVKFAADAEVVGPNAKAAVEAMKDGEVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   + ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEEFSKELASLCEVFVNDAFGTAHRAHCSNVGVTKFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGMA +F  A G  +G 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMAYTFSKAAGGSIGV 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+ D   ++  +A     ++++P D  +          Q+V +  +P     +D+
Sbjct: 240 SLCEDDYLDYALEMKKKAAEKGVKLLLPVDHRIGDAFSNDCNIQIVGSGQIPEGWEGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    +    +I GGGD
Sbjct: 300 GPETEKIFADAVKDAKTVVWNGPMGCFEMSNFAHGTAAVAKALA----DTDATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNILGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|171742951|ref|ZP_02918758.1| hypothetical protein BIFDEN_02073 [Bifidobacterium dentium ATCC
           27678]
 gi|283456027|ref|YP_003360591.1| phosphoglycerate kinase [Bifidobacterium dentium Bd1]
 gi|171278565|gb|EDT46226.1| hypothetical protein BIFDEN_02073 [Bifidobacterium dentium ATCC
           27678]
 gi|283102661|gb|ADB09767.1| Phosphoglycerate kinase [Bifidobacterium dentium Bd1]
          Length = 401

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 143/401 (35%), Positives = 234/401 (58%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   +   +D  G      +A++++G ++L +NVRF  
Sbjct: 61  RPKGKIVPELSLAPVATRLGELLGVEVPLASDTYGEDAQAKVAAMNDGDVVLLQNVRFNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP+    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDPEERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A+G+ VG SL
Sbjct: 181 LSRATVDPERPLTVVLGGSKVSDKLGVIENLLDKADRLVIGGGMVYTFLKAKGLEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP---TQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P D+VV             +VV+A ++P D + LD
Sbjct: 241 LEEDQVETVKGYIERAEKNGVELVLPTDIVVNPVFPKSDEDIAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPAFAAGTEAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|282882178|ref|ZP_06290817.1| phosphoglycerate kinase [Peptoniphilus lacrimalis 315-B]
 gi|281297943|gb|EFA90400.1| phosphoglycerate kinase [Peptoniphilus lacrimalis 315-B]
          Length = 397

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 163/395 (41%), Positives = 243/395 (61%), Gaps = 7/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ + D  +  G   L+RVD+NVP  DGKV    RI++ +PTI  + E+  K+++ SHLG
Sbjct: 2   IKKLEDF-NFNGKTVLVRVDFNVPIKDGKVKGDDRIKKSLPTIKYIKEQGGKIILMSHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILF--VNDCIGSTLSQSIASLSEGGIILAENVRF 121
           RP+ K +KD SL  V      IL ++ILF    + +   +   + +L    I L EN+RF
Sbjct: 61  RPKGKYNKDLSLRPVAQRLSEILGEDILFIDEKEVVNKEVKDKVKNLKNAEIALLENLRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EEE+N+  F + L+   D Y+NDAF  +HRAHAS  G+S  LPS  G  ++KE+  L+
Sbjct: 121 RPEEEKNEESFSKDLASLADIYVNDAFGTAHRAHASNVGVSKFLPSAAGFLLEKEIKYLK 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 K+P VAI+GG+KVS KI L+ NL+ K+D +VI G MAN+F+ + G  VG+SL +
Sbjct: 181 ESLENPKRPFVAILGGAKVSDKINLIKNLLDKIDSIVIVGAMANTFIKSMGKEVGKSLVE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   QI  +A +    +I+P D + ARE+      QVV A S+  D ++LD+G  +
Sbjct: 241 DDKLDLARQIIDQASKKGVNLILPEDFIEAREISDDAKGQVVDASSIDKDKMVLDIGPNS 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ IK V+  ART++WNGP GVFE++ F + TV +A  +A    +   ++I GGGD++ A
Sbjct: 301 LKKIKMVLKDARTIVWNGPAGVFEVDEFSKGTVGIAKILA----DSDALTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG+ ++ +++ST GGA LE LEGK LP I AL
Sbjct: 357 VEKAGVEDKISHISTGGGASLELLEGKVLPAIKAL 391


>gi|318040689|ref|ZP_07972645.1| phosphoglycerate kinase [Synechococcus sp. CB0101]
          Length = 401

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 159/400 (39%), Positives = 251/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R++  L   ++RG R L+RVD+NVP  D G + D TRI   +PTI +L  K AKV+
Sbjct: 1   MAK-RSLASLSADELRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLTGKGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + ++   L  V +    +L K+++  + CIG      +A+++EG ++L E
Sbjct: 60  LSAHFGRPKGQVNEGMRLTPVAARLSELLGKSVVKTDSCIGPDAEAKVAAMAEGDVVLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF++EEE+N+ DF + L+   D Y+NDAF  +HRAHAS  G++    PS  G  M+KE
Sbjct: 120 NVRFFAEEEKNEGDFAKQLAALADVYVNDAFGAAHRAHASTEGVTQYLSPSVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+    E K+PL AIVGGSKVS+KI +L  L+ K DK+++GGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDEPKRPLAAIVGGSKVSSKIGVLEALLDKCDKILVGGGMIFTFYKARGLAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +   ++  +A     + ++P DVV+A        +Q+    ++P   + LD
Sbjct: 240 KSLVEEDKLELAKELEAKAAAKGVQFLLPTDVVLADNFAPDANSQIAKVDAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +A  +TV+WNGP+GVFE + F   T  +A  +A L+ +    +I GGG
Sbjct: 300 IGPDSVKVFQDALADCKTVIWNGPMGVFEFDAFAAGTNAIATTLADLSGKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 398


>gi|159902754|ref|YP_001550098.1| phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9211]
 gi|238687136|sp|A9BDF8|PGK_PROM4 RecName: Full=Phosphoglycerate kinase
 gi|159887930|gb|ABX08144.1| Phosphoglycerate kinase [Prochlorococcus marinus str. MIT 9211]
          Length = 402

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 245/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ R+++ L   ++ G R  +RVD+NVP   +G + D TRI   +PTI +L++K A+V+
Sbjct: 1   MAK-RSLSSLSAEELCGKRVFVRVDFNVPVNAEGDITDDTRIRAALPTIKDLIDKGARVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +H GRP+ + +    L  V      +L   ++  + CIGS       SL+ G ++L E
Sbjct: 60  LSAHFGRPKGQVNDAMRLTPVAQRLSELLGHTVIKTDSCIGSDAQAKAQSLNNGDVMLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRF   EE+NDPDF + LS   + Y+NDAF  +HRAHAS  G++    P+  G  M+KE
Sbjct: 120 NVRFIQGEEKNDPDFAKELSELAEVYVNDAFGAAHRAHASTEGVTKFLSPNVAGYLMEKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L+      K+PL AIVGGSKVS+KI +L +L+ K DK++IGGGM  +F  A+G+ VG
Sbjct: 180 LQYLQGAIDSPKRPLAAIVGGSKVSSKIGVLESLIDKCDKVLIGGGMIFTFYKARGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
           +SL + D  +    +  +AK    E+++P DVV+A        +Q+    S+P   + LD
Sbjct: 240 KSLVEDDKLELAKALEEKAKSKGVELLLPTDVVLADNFSPDANSQIAQINSIPEGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+  +  +   +TV+WNGP+GVFE + F   T  +A  ++ L+++    +I GGG
Sbjct: 300 IGPDSVKLFQDALEDCQTVIWNGPMGVFEFDKFANGTNSIATTLSVLSQKGCC-TIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 359 DSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVAAL 398


>gi|283783368|ref|YP_003374122.1| phosphoglycerate kinase [Gardnerella vaginalis 409-05]
 gi|283442179|gb|ADB14645.1| phosphoglycerate kinase [Gardnerella vaginalis 409-05]
          Length = 401

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 145/402 (36%), Positives = 227/402 (56%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D+ G R L+R D+NVP     + D  RI   +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLSGKRVLVRADFNVPLKGTTITDDGRIRAALPTIKALREQGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V      +L  N++   D  G      +A+++ G ++L ENVRF +
Sbjct: 61  RPKGQVVPELSLAPVAQRLGELLGTNVVLAADTYGEDAQAKVAAMNNGDVVLLENVRFNA 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   D      + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDASERAAYAKKIASLGEVFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A G  VG SL
Sbjct: 181 LSRATENPERPLTVVLGGSKVSDKLGVIENLLSKADRLVIGGGMVFTFLKALGHEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      AK++  E+++P D+VV          +  +VV A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAKKNGVELVLPTDIVVNAGFPAGDTPVVPEVVPADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   TK     +I GGG
Sbjct: 301 IGSDSQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTRAVAQGLVDATK-NGTFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKTLPGLSVLE 401


>gi|1730525|sp|P50314|PGK_XANFL RecName: Full=Phosphoglycerate kinase
 gi|475713|gb|AAA62185.1| phosphoglycerate kinase [Xanthobacter flavus]
          Length = 397

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 196/396 (49%), Positives = 266/396 (67%), Gaps = 1/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   RT++D  D+   R L+RVD NVP   G+V D TR++ ++PTI ++  K  K V+ +
Sbjct: 1   MIAFRTLDDAVDLADKRVLVRVDLNVPMESGRVTDATRLKAILPTIRDITGKGGKAVLLA 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   D+  SL  V    E  L + + F +DCIG     +++ L+ G +I+ EN R
Sbjct: 61  HLGRPKG-RDESQSLAPVAKALEGELGRKVAFASDCIGDEAKSAVSRLASGEVIVLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+N PDF+  L+  GD Y+NDAFS +HRAHAS  GL+  LP+Y GR+M+ E+  L
Sbjct: 120 FHAGEEKNAPDFIEALASLGDIYVNDAFSTAHRAHASTEGLARKLPAYAGRSMESEIEAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                  ++P++A+VGGSKVS+K+ LL NLVKKVD LVIGGGMAN+FL A G  VG+SLC
Sbjct: 180 TKALEAPQRPVLAVVGGSKVSSKLELLGNLVKKVDILVIGGGMANTFLAALGKKVGKSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++    I  +A+ + CEI++P D VVA E K     +V S   V  D ++LD G +
Sbjct: 240 EHDLANTARDILKKAEAAGCEIVLPVDAVVATEFKANAAHRVTSVDDVKDDEMMLDAGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  +KQ +  A+TV+WNGP G FE+ PFD ATV VA YV  LT + R++S+AGGGDT+ 
Sbjct: 300 TVGIVKQKLDGAKTVVWNGPFGAFEMTPFDAATVAVARYVGDLTHKGRLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG +  F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 360 ALNHAGTAERFSYVSTAGGAFLEWLEGKALPGVEAL 395


>gi|255544584|ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gi|223547261|gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
          Length = 479

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 252/400 (63%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D  K+ D TRI   +PT+  L++  AKV+
Sbjct: 75  MAK-KSVGDLTAADLKGKKVFVRADLNVPLDDNQKITDDTRIRAAIPTVKHLIQNGAKVI 133

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  +DCIG  + + +ASL EGG++L E
Sbjct: 134 LSSHLGRPKG-VTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLE 192

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 193 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 252

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 253 LDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 312

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++VV+A ++P   + LD
Sbjct: 313 SSLVEEDKLDLATSLLAKAKLKGVSLLLPTDVVIADKFAPDANSKVVAASAIPDGWMGLD 372

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           VG ++V+   + +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 373 VGPESVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSG-KGVTTIIGGG 431

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++   +++ST GGA LE LEGK+LPG++AL
Sbjct: 432 DSVAAVEKVGVAEVMSHISTGGGASLELLEGKELPGVLAL 471


>gi|225352085|ref|ZP_03743108.1| hypothetical protein BIFPSEUDO_03695 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157332|gb|EEG70671.1| hypothetical protein BIFPSEUDO_03695 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 401

 Score =  362 bits (928), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 142/401 (35%), Positives = 232/401 (57%), Gaps = 9/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D++G R L+R D+NVP     + D  RI+  +PTI  L E+ AKV++ +HLG
Sbjct: 1   MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKALREEGAKVILMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ K   + SL  V +    +L   +    D  G      +A++ +G ++L +NVR+  
Sbjct: 61  RPKGKVVPELSLAPVAARLGELLGIEVPLAEDTYGEDAQAKVAAMGDGDVVLLQNVRYNP 120

Query: 124 EEERNDPD----FVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE   DP+    + + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDPEERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E ++PL  ++GGSKVS K+ ++ NL+ K ++LVIGGGM  +FL A+G+ VG SL
Sbjct: 181 LSRATVEPERPLTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVYTFLKAKGLEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP---TQVVSAQSVPLDSIILD 296
            + D  + V      A+++  E+++P D+VV             +VV+A ++P D + LD
Sbjct: 241 LEEDQVETVKGYIERAEQNGVELVLPTDIVVNPVFPKSDEDIAPEVVAADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   T      +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVPAFAAGTEAVAQGLVDATAA-GAFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D+ +A+ + G   + F+++ST GGA LE+LEGK+LPG+  L
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVL 400


>gi|300813408|ref|ZP_07093759.1| phosphoglycerate kinase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512551|gb|EFK39700.1| phosphoglycerate kinase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 397

 Score =  362 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 162/395 (41%), Positives = 243/395 (61%), Gaps = 7/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ + D  +  G   L+RVD+NVP  DGKV    RI++ +PTI  + E+  K+++ SHLG
Sbjct: 2   IKKLEDF-NFNGKTVLVRVDFNVPIKDGKVKGDDRIKKSLPTIKYIKEQGGKIILMSHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILF--VNDCIGSTLSQSIASLSEGGIILAENVRF 121
           RP+ K +KD SL  V      IL ++ILF    + +   +   + +L    I L EN+RF
Sbjct: 61  RPKGKYNKDLSLRPVAQRLSEILGEDILFIDEKEVVNKEVKDKVKNLKNAEIALLENLRF 120

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
             EEE+N+  F + L+   D Y+NDAF  +HRAHAS  G+S  LPS  G  ++KE+  L+
Sbjct: 121 RPEEEKNEESFSKDLASLADIYVNDAFGTAHRAHASNVGVSKFLPSAAGFLLEKEIKYLK 180

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 K+P VAI+GG+KVS KI L+ NL+ K+D +VI G MAN+F+ + G  VG+SL +
Sbjct: 181 ESLENPKRPFVAILGGAKVSDKINLIKNLLDKIDSIVIVGAMANTFIKSMGKEVGKSLVE 240

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   QI  +A +    +I+P D + ARE+      QVV A S+  D ++LD+G  +
Sbjct: 241 DDKLDLARQIIDQASKKGVNLILPEDFIEAREISDDAKGQVVDASSIDKDKMVLDIGPNS 300

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++ IK V+  A+T++WNGP GVFE++ F + TV +A  +A    +   ++I GGGD++ A
Sbjct: 301 LKKIKMVLKDAKTIVWNGPAGVFEVDEFSKGTVGIAKILA----DSDALTIVGGGDSVAA 356

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG+ ++ +++ST GGA LE LEGK LP I AL
Sbjct: 357 VEKAGVEDKISHISTGGGASLELLEGKVLPAIKAL 391


>gi|295108303|emb|CBL22256.1| 3-phosphoglycerate kinase [Ruminococcus obeum A2-162]
          Length = 397

 Score =  362 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 139/402 (34%), Positives = 236/402 (58%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  DGK+ D  R+   +PTI +LV    K+++ S
Sbjct: 1   MLNKKSVDDI-NVKGQKVLVRCDFNVPLQDGKITDENRLVAALPTIKKLVADGGKIILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + FV     +  T+  ++A + +G IIL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAKRLTELLGQEVKFVPSPVVVDDTVKAAVADMKDGEIILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGDEFSKELASLCDVFVNDAFGTAHRAHCSNVGVTKYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  +G+
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMSYTFSKALGGHIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+      +  +A+    ++++P D  +  +       Q+V    +P     +D+
Sbjct: 240 SLCEDDYLQYALDMLKKAEEKGVKLLLPVDNRIGDDFSNDCNIQIVKRGCIPDGWEGMDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    +    +I GGGD
Sbjct: 300 GTETEKIFCDAVKDAKTVVWNGPMGCFEMPNFAHGTEAVAKALA----DTEATTIIGGGD 355

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 SAAAVNILGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 397


>gi|126658259|ref|ZP_01729409.1| phosphoglycerate kinase [Cyanothece sp. CCY0110]
 gi|126620408|gb|EAZ91127.1| phosphoglycerate kinase [Cyanothece sp. CCY0110]
          Length = 400

 Score =  362 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 164/399 (41%), Positives = 254/399 (63%), Gaps = 5/399 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           MS+ +T+ +L   D+ G R L+RVD+NVP  +G ++D TRI   +PTI EL+   AKVV+
Sbjct: 1   MSK-KTVANLSQGDLAGKRVLVRVDFNVPLDNGTISDDTRIRAALPTIKELITNGAKVVL 59

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SH+GRP+ K  +  SL  V +    +L +++   +DC+G +++ ++A L  G + L EN
Sbjct: 60  CSHMGRPKGKVVESMSLKPVATRLSELLGQDVTMCDDCVGDSVAAAVAKLENGQVALLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKEL 177
           +RF++EEE NDP+F + L+ N D Y+NDAF  +HRAHAS  G++H   PS  G  ++KEL
Sbjct: 120 LRFHAEEEANDPEFAKQLAANADLYVNDAFGTAHRAHASTEGVTHHLSPSVAGYLIEKEL 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L++     ++PL AI+GGSKVS+KI ++  L+ K DKL+IGGGM  +F  A+G+ VG+
Sbjct: 180 QYLQAAIENPQRPLAAIIGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKARGLNVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  +    +  +AK    E+++P DVV+A +       +  S +++    + LD+
Sbjct: 240 SLVEEDKLELAKSLEAKAKEKGVELLLPTDVVLADDFNKDANAKTASIENIEDGWMGLDI 299

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +VE  K+ +A  + V+WNGP+GVFE E F + T  +A+ +A+LT       I  GGD
Sbjct: 300 GPDSVEVFKKALADCKAVIWNGPMGVFEFEKFAKGTEAIANTLAELTGTGTTTIIG-GGD 358

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+   G++ + +++ST GGA LE LEGK LPGI AL
Sbjct: 359 SVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGIAAL 397


>gi|220906394|ref|YP_002481705.1| phosphoglycerate kinase [Cyanothece sp. PCC 7425]
 gi|254782201|sp|B8HXQ5|PGK_CYAP4 RecName: Full=Phosphoglycerate kinase
 gi|219863005|gb|ACL43344.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7425]
          Length = 406

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 168/405 (41%), Positives = 249/405 (61%), Gaps = 11/405 (2%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVV 57
           MS+ +T+ +L   D+ G R L+RVD+NVP  D GK+ D TRI   +PTI +L  K AKV+
Sbjct: 1   MSK-KTVANLSAADLAGKRVLVRVDFNVPLDDQGKITDDTRIRAALPTIQDLTSKGAKVI 59

Query: 58  IFSHLGRPQSK-----SDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGG 112
           + SH GRP+ +           L  V +    +L K +   NDCIG  +   +A++  G 
Sbjct: 60  LSSHFGRPKGETFAERVKDKFRLTPVAARLSELLGKPVPKPNDCIGEEVKAQVAAMQNGD 119

Query: 113 IILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGR 171
           ++L ENVRF+  EE N P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G 
Sbjct: 120 VLLLENVRFHPGEEANTPEFAQELASVADLYVNDAFGTAHRAHASTEGVTRYLRPSVAGY 179

Query: 172 AMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQ 231
            ++KEL  L+S     ++PL AIVGGSKVS+KI ++  L++KVDKL++GGGM  +F  A+
Sbjct: 180 LIEKELQYLQSAIENPQRPLAAIVGGSKVSSKIGVIETLLEKVDKLLLGGGMIFTFYKAR 239

Query: 232 GMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLD 291
           G+ VG+SL + D  +    +  +AK     +++P DVVVA         Q VS +S+P  
Sbjct: 240 GLNVGKSLVEEDKLELARTLEAKAKERGVALLLPTDVVVADAFAADANAQTVSVESIPDG 299

Query: 292 SIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIIS 351
            + LD+G   V+  ++ ++  +TV+WNGP+GVFE + F   T  +AH +A LT  +   +
Sbjct: 300 WMGLDIGPDAVKTFQEALSDCKTVIWNGPMGVFEFDKFAVGTEAIAHSLAGLTG-KGAST 358

Query: 352 IAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           I GGGD++ A+   G++ + +++ST GGA LE LEGK+LPGIVAL
Sbjct: 359 IIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKELPGIVAL 403


>gi|153810447|ref|ZP_01963115.1| hypothetical protein RUMOBE_00828 [Ruminococcus obeum ATCC 29174]
 gi|149833626|gb|EDM88707.1| hypothetical protein RUMOBE_00828 [Ruminococcus obeum ATCC 29174]
          Length = 398

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 137/400 (34%), Positives = 234/400 (58%), Gaps = 8/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             ++++D+ +++G R L+R D+NVP  DGK+ D  R+   +PTI +L+    K+++ SHL
Sbjct: 4   NKKSVDDI-NVKGQRVLVRCDFNVPLQDGKITDENRLVAALPTIKKLIADGGKIILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+P+ +   + SL  V      +L + + FV     +  T+  ++A + +G +IL EN R
Sbjct: 63  GKPKGEPKPELSLAPVAKRLTELLGQEVKFVPSPVVVDDTVKAAVADMKDGEVILLENTR 122

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSM 179
           + +EE +N  +F + L+   D ++NDAF  +HRAH S  G++  + +  +G  M+KE++ 
Sbjct: 123 YRAEETKNGDEFSKELASLCDVFVNDAFGTAHRAHCSNVGVTKYVDTAVVGYLMEKEIAF 182

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +     ++P VAI+GG+KVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  +G SL
Sbjct: 183 LGNAVENPERPFVAILGGAKVSSKISVINNLLDKVDTLIIGGGMSYTFSKALGGHIGNSL 242

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C+ D+      +  +A+    ++++P D  +  +       QVV    +P     +D+G 
Sbjct: 243 CEDDYLQYALDMLKKAEEKGVKLLLPVDNRIGDDFSNDCNIQVVKRGCIPDGWEGMDIGP 302

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T +     +  A+TV+WNGP+G FE+  F   T  VA  +A    +    +I GGGD+ 
Sbjct: 303 ETEKIFCDAVKDAKTVVWNGPMGCFEMPNFAHGTEAVAKALA----DTEATTIIGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 359 AAVNILGYGDKMTHISTGGGASLEFLEGKELPGVAAANDK 398


>gi|163758825|ref|ZP_02165912.1| phosphoglycerate kinase [Hoeflea phototrophica DFL-43]
 gi|162284115|gb|EDQ34399.1| phosphoglycerate kinase [Hoeflea phototrophica DFL-43]
          Length = 404

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 205/397 (51%), Positives = 280/397 (70%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  +T++DL D+ G R LLRVD NVP  DGKV D TRIERV PTI+EL  K A+V++ +
Sbjct: 7   MTAFKTLDDLTDLPGKRVLLRVDLNVPVKDGKVTDTTRIERVAPTIMELSTKGARVILLA 66

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ ++    SL  +  + E +L   + F  DCIG   ++++ ++ +G ++L EN R
Sbjct: 67  HFGRPKGEAVPSMSLAPIAGVVEDVLDHRVHFAADCIGEVSAKAVNAMVDGDVLLLENTR 126

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+S EE+NDP FV  L++NGD ++NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 127 FHSGEEKNDPGFVIELAKNGDIFVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELLAL 186

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL NLV +VD LVIGGGMAN+F+ A+G+ VG+SLC
Sbjct: 187 EKGLGNPARPVVAIVGGAKVSTKIDLLKNLVNQVDALVIGGGMANTFIAARGIDVGKSLC 246

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +    +I   A  S C I++P D VVARE K     + V+  ++P D+++LDVG K
Sbjct: 247 EHDLAATAKEIEAAAAASGCAIVLPVDGVVAREFKAEADNETVAIDAIPADAMMLDVGPK 306

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++ +   I +A T++WNGPLG FEI PFD ATV  A + A  T+E  ++S+AGGGDT++
Sbjct: 307 SIDAVNAWITKADTLVWNGPLGAFEIPPFDAATVSAAKHAAARTREGLLVSVAGGGDTVS 366

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG+++EFTYVSTAGGAFLEW+EGK LPG+  L 
Sbjct: 367 ALNHAGVTDEFTYVSTAGGAFLEWMEGKPLPGVDVLK 403


>gi|206889638|ref|YP_002248096.1| phosphoglycerate kinase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741576|gb|ACI20633.1| phosphoglycerate kinase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 404

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 162/396 (40%), Positives = 242/396 (61%), Gaps = 7/396 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ DL  I+  R  +R D+NVP   +  + D  RI   +PTI   +++ AK+++ SHLGR
Sbjct: 12  TIEDLP-IKSKRVFIRADFNVPLDANLVITDDRRIRSTLPTINYAIDEGAKIILASHLGR 70

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K D   SL  V    + +L+K ++F  DCIG  + Q ++ + EG +IL EN+RF+ E
Sbjct: 71  PKGKVDPKFSLSPVARRLQRLLNKEVIFAPDCIGPQVEQLVSKMKEGDVILLENLRFHME 130

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+ND  F + L+   DFY+NDAF  SHRAHASI G+   +PS  G  ++KE+  L+   
Sbjct: 131 EEKNDEKFAKALASLADFYVNDAFGASHRAHASIVGIPKFIPSAAGFLLKKEIEYLKGAV 190

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
               +P V I+GG+KV  KI +L NL  K DK+++GGGMA +F+ A G  VG SL + D 
Sbjct: 191 ESPIRPFVVILGGAKVGGKIGVLENLADKADKVIVGGGMAFTFIKAMGYEVGNSLVESDM 250

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            D   +I  + + +  +  +P DVV+A+ + TG  T++V  Q +P     LD+G  +V+ 
Sbjct: 251 IDFAIKIMEKLRANRVKFYLPVDVVIAQSIDTGAETKIVPVQEIPQGWRGLDIGPASVKL 310

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
             + +  A+T++WNGP+GVFEI+ F R T  +AH VA    +    +I GGGDT  A+  
Sbjct: 311 FTEALHDAKTILWNGPMGVFEIDAFSRGTFAIAHAVA----DSYAFTIVGGGDTDYAVHK 366

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL-SGH 399
           AG+S+  +++ST GGA L+ LEGK+LPG+  L S  
Sbjct: 367 AGVSDSISFISTGGGAALQLLEGKELPGLAVLPSKK 402


>gi|313903098|ref|ZP_07836492.1| phosphoglycerate kinase [Thermaerobacter subterraneus DSM 13965]
 gi|313466600|gb|EFR62120.1| phosphoglycerate kinase [Thermaerobacter subterraneus DSM 13965]
          Length = 424

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 153/395 (38%), Positives = 240/395 (60%), Gaps = 8/395 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
            R R++ DL D+RG R L+R D+NVP   G++ D TRI   +PTI  L+E+ A V++ SH
Sbjct: 1   MRKRSVRDL-DVRGRRVLVRADFNVPLEGGRITDDTRIRAALPTIRYLLEQGAAVILCSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ K  ++  L  V    E +L + +  + + +G  + + +A L  G ++L EN+RF
Sbjct: 60  LGRPKGKVVEELRLAPVARRLEELLGRPVRALPEVVGPQVEREVAGLQPGEVVLLENLRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  E  NDP+F   L+R    Y+NDAF  +HRAHAS+ G++  LP+  G  +++EL +L 
Sbjct: 120 HPGETANDPEFAAALARLAHVYVNDAFGAAHRAHASVVGVAERLPAAAGFLLERELEVLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P  A++GG+KVS KI ++  L++  D L IGG MAN+ L A+G  VGRSL +
Sbjct: 180 GLLERPRRPFWAVLGGAKVSDKIGVIQRLLEVCDGLAIGGAMANTLLAARGFDVGRSLYE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +  +   +    A      +++P DVVV  +++ G P++VV    +P  ++ +DVG  T
Sbjct: 240 PEQVEPARRWLETAGD---RLLLPADVVVTEKLEPGAPSRVVPVDRIPTGAMAVDVGPAT 296

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +   ++ +  A TV WNGPLGVFE+EPF R T  +A ++A L      +++ GGGD++ A
Sbjct: 297 LAAWQERLRGAGTVFWNGPLGVFEVEPFHRGTFALAEFLAGL----EAVTVVGGGDSVAA 352

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G++    ++ST GGA LE LEGK+LPG+  L
Sbjct: 353 VQRTGVAGRIDHISTGGGASLELLEGKELPGVAVL 387


>gi|86359090|ref|YP_470982.1| phosphoglycerate kinase [Rhizobium etli CFN 42]
 gi|86283192|gb|ABC92255.1| phosphoglycerate kinase protein [Rhizobium etli CFN 42]
          Length = 418

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 218/397 (54%), Positives = 282/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL +K AKV++ +
Sbjct: 19  MPSFKTLDDLSDISGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSDKGAKVILLA 78

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  +    E +L   +L  +DCIG   + ++A ++ G I+L EN R
Sbjct: 79  HFGRPKDGPSPDLSLSLIAPSVEEVLDHAVLTASDCIGEAATAAVAGMNNGDILLLENTR 138

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 139 FHKGEEKNDPDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 198

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 199 EKGLGAPARPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 258

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  S C II+P D VVARE + G   + V   ++P D+++LDVG K
Sbjct: 259 EHDLAETAKQIMIEAATSGCAIILPEDGVVAREFRAGAANETVDINAIPADAMVLDVGPK 318

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE I   I +A T++WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++
Sbjct: 319 SVEAINAWIERAATLVWNGPLGAFEIEPFDTATVAAAKYAAERTAAGKLTSVAGGGDTVS 378

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 379 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 415


>gi|145347850|ref|XP_001418373.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578602|gb|ABO96666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 435

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 152/399 (38%), Positives = 244/399 (61%), Gaps = 8/399 (2%)

Query: 2   SRLRTMNDL--RDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVI 58
           ++ +++ DL   D++G    +R D NVP   D  + D TRI   +PT+  L +  AKV++
Sbjct: 38  AKKKSVGDLAESDLKGQTVFVRCDLNVPMDADLNITDDTRIRAAIPTLEYLAKNGAKVLV 97

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
            SHLGRP++  +    L  V +     L   +  V+DC+G  +++++AS+  G + L EN
Sbjct: 98  TSHLGRPKNGPEDKFRLTPVGARLSEKLSCPVTKVDDCVGDEVAKAVASMPNGSVCLLEN 157

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITG-LSHLLPSYIGRAMQKEL 177
            RFY EEE+ND DF + L+ +   ++NDAF  +HRAHAS  G   +   +  G  +QKEL
Sbjct: 158 TRFYKEEEKNDSDFAKKLAGSATIFVNDAFGTAHRAHASTEGVTKYCKTNVAGFLLQKEL 217

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L+   S  ++P  AIVGGSKVS+KI ++ +L++K DK+++GGGM  +F  A G  VG 
Sbjct: 218 DYLDGAVSNPERPFCAIVGGSKVSSKIGVIESLLQKTDKIILGGGMIFTFYKALGKSVGA 277

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D  D   ++  +A+    +I++P DVVVA +      TQ+VS  ++P   + LD+
Sbjct: 278 SLVEDDKIDLAKELMAKAEAKGVKILLPTDVVVADKFAEDAKTQIVSVDNIPEGWMGLDI 337

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G  +++  +  + + ++V+WNGP+GVFE++ F + T  +A  +A L      I+I GGGD
Sbjct: 338 GPDSLKAFQGELNECKSVIWNGPMGVFEMDAFAKGTFGIADTLANL----NGITIIGGGD 393

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           ++ A+  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 394 SVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 432


>gi|283798498|ref|ZP_06347651.1| phosphoglycerate kinase [Clostridium sp. M62/1]
 gi|291073757|gb|EFE11121.1| phosphoglycerate kinase [Clostridium sp. M62/1]
 gi|295092093|emb|CBK78200.1| 3-phosphoglycerate kinase [Clostridium cf. saccharolyticum K10]
 gi|295115556|emb|CBL36403.1| 3-phosphoglycerate kinase [butyrate-producing bacterium SM4/1]
          Length = 401

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 145/406 (35%), Positives = 236/406 (58%), Gaps = 12/406 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G R L+R D+NVP  DGK+ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKRVLVRCDFNVPLKDGKITDENRLVAALPTIKKLISDGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     +  ++ +G +IL EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADPEVVGPNAKAAAEAMKDGDVILLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   D Y+NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKELASLCDVYVNDAFGTAHRAHCSNVGVTQYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +      +P VAI+GG+KV+ K+ ++ NL++K D L+IGGGMA +FL A+G  +G 
Sbjct: 180 DFLGNAVDNPVRPFVAILGGAKVADKLNVISNLLEKCDTLIIGGGMAFTFLKAEGKEIGS 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV----SAQSVPLDSI 293
           SL      D   ++  +A++   +I++P D  VA      I  Q+     SA ++P D +
Sbjct: 240 SLVDDTKLDYCREMLAKAEKLGKKILLPVDAAVAASFPNPIDAQIEVKNVSADAIPADMM 299

Query: 294 ILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIA 353
            LD+G ++ +     +  A+TV+WNGP+GVFE     + T+EVA  +A    E    +I 
Sbjct: 300 GLDIGTESAKLFADAVKSAKTVVWNGPMGVFENPVLAKGTIEVAKALA----ETDATTII 355

Query: 354 GGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGGD+  A+   G  ++ T++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 GGGDSAAAVNQLGFGDKMTHISTGGGASLEFLEGKELPGVAAANDK 401


>gi|168050247|ref|XP_001777571.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|168050255|ref|XP_001777575.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671056|gb|EDQ57614.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671060|gb|EDQ57618.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 402

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 162/395 (41%), Positives = 242/395 (61%), Gaps = 5/395 (1%)

Query: 6   TMNDL--RDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++ D+  ++ +G    +R D NVP  D  ++ D TRI   +PTI  L +  AKVV+ SHL
Sbjct: 2   SIKDIDSKEYKGKTVFVRADLNVPLNDQLEITDDTRIRASLPTIQYLTKAGAKVVLASHL 61

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   ++  SL  V      +L + +    DCIG  +   IA L EG ++L ENVRFY
Sbjct: 62  GRPKKGPEERFSLKPVAGRLTELLGQTVELAPDCIGDEVKSKIAGLKEGDVLLLENVRFY 121

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSMLE 181
            EEE+ND +F + LS N DF++ DAF  +HRAHAS  G+  ++     G  ++KEL  L 
Sbjct: 122 KEEEKNDIEFSKKLSENIDFFVLDAFGTAHRAHASTAGIADYVTSRLAGLLLEKELEYLS 181

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               +  KP VAIVGGSK+S+KIT++ +L+   DK+++GGGM  +F  A+G  VG SL +
Sbjct: 182 GVVQKPTKPFVAIVGGSKISSKITVIESLMNVCDKVILGGGMIFTFFRAEGKSVGSSLVE 241

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +    +A  AK+   E+I+P DV+ A +       Q  SA S+P   + LD+G   
Sbjct: 242 EDKIELAKNLAELAKKKGVELILPVDVIAADKFAPDANVQTCSASSIPDGWMGLDIGPDA 301

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++  ++ ++ A+TV+WNGP+GVFE E F + T  VA  +A+LT  +  I++ GGGD++ A
Sbjct: 302 IKQFQEALSDAKTVLWNGPMGVFEFEQFAKGTFAVAETMAELT-SKGAITVVGGGDSVAA 360

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++++ ++VST GGA LE LEGK LPG+ AL
Sbjct: 361 VEKAGLADKMSHVSTGGGASLELLEGKVLPGVAAL 395


>gi|254501167|ref|ZP_05113318.1| phosphoglycerate kinase [Labrenzia alexandrii DFL-11]
 gi|222437238|gb|EEE43917.1| phosphoglycerate kinase [Labrenzia alexandrii DFL-11]
          Length = 400

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 205/396 (51%), Positives = 279/396 (70%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              +T++D+ D+ G R L+RVD NVP  + KV D TRIERV+PTI EL EK AKV++ +H
Sbjct: 4   MTFKTIDDITDLAGKRVLVRVDLNVPMDNYKVTDTTRIERVLPTIKELSEKGAKVILLAH 63

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ +  K+ SL  V      +L K + F  DC+G + + ++A +  G ++L EN RF
Sbjct: 64  FGRPKGEKVKEMSLAAVARAVSDLLGKTVGFAEDCMGPSAAGAVAVMQSGQVLLMENTRF 123

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE+NDP+F + L+ NGD Y+NDAFS +HRAH S  G++ LLP+Y GR MQ EL  L 
Sbjct: 124 HKGEEKNDPEFAKALAANGDVYVNDAFSAAHRAHGSTEGIAQLLPAYAGRTMQAELEALG 183

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           S   E  +P++A+VGG+KVS+KI LL NLV KV+ LVIGGGMAN+FL A+G+ VG+SLC+
Sbjct: 184 SALGEPVRPVLAVVGGAKVSSKIDLLENLVAKVNMLVIGGGMANTFLAAKGVNVGKSLCE 243

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D +D   +I   A+ + CEI++P D VVA+E K G   + VS  ++P D +ILDVG  +
Sbjct: 244 HDLADTAKKIMAAAETAGCEIVLPVDAVVAKEFKAGADNETVSVDAIPEDGMILDVGAAS 303

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE +K  I  A+T++WNGPLG FEI PFD ATV  A + A+ TK  ++ S+AGGGDT+ A
Sbjct: 304 VEVVKSKIDAAKTLVWNGPLGAFEIAPFDIATVAAAKHAAENTKSGKLNSVAGGGDTVAA 363

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           L HAG +++F+YVSTAGGAFLEWLEGK+LPG+ AL 
Sbjct: 364 LNHAGAASDFSYVSTAGGAFLEWLEGKELPGVKALE 399


>gi|172039132|ref|YP_001805633.1| phosphoglycerate kinase [Cyanothece sp. ATCC 51142]
 gi|171700586|gb|ACB53567.1| phosphoglycerate kinase [Cyanothece sp. ATCC 51142]
          Length = 409

 Score =  361 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 162/395 (41%), Positives = 254/395 (64%), Gaps = 4/395 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +T+ +L   D+ G R L+RVD+NVP  +G + D TRI   +PTI EL+   AKV++ SH+
Sbjct: 13  KTVANLSEGDLAGKRVLVRVDFNVPLDNGTITDDTRIRAALPTIKELITNGAKVILCSHM 72

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ +  +  SL  V +    +L ++++  +DC+G +++ +IA+L  G + L EN+RF+
Sbjct: 73  GRPKGQVVESMSLSPVATRLSELLGQDVIMCDDCVGDSVTAAIANLENGQVALLENLRFH 132

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLE 181
           +EEE NDP+F + L+ N D Y+NDAF  +HRAHAS  G++H   PS  G  ++KEL  L+
Sbjct: 133 AEEEANDPEFAKQLAANADLYVNDAFGTAHRAHASTEGVTHHLSPSVAGYLIEKELQYLQ 192

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +     ++PL AI+GGSKVS+KI ++  L+ K DKL+IGGGM  +F  A+G+ VG+SL +
Sbjct: 193 AAIENPQRPLAAIIGGSKVSSKIGVIETLLDKCDKLLIGGGMIFTFYKARGLNVGKSLVE 252

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +    +  +AK    E+++P DVV+A        +++ S +S+    + LD+G  +
Sbjct: 253 EDKLELAKSLEAKAKEKGVELLLPTDVVLADNFAKDANSKISSVESIEDGWMGLDIGPDS 312

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE  K+ +A  + V+WNGP+GVFE E F + T  +A+ +A+LT       I  GGD++ A
Sbjct: 313 VEVFKKALADCKAVIWNGPMGVFEFEKFAKGTEAIANTLAELTGTGTTTIIG-GGDSVAA 371

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G++++ +++ST GGA LE LEGK LPGI AL
Sbjct: 372 VEKVGVADKMSHISTGGGASLELLEGKTLPGIAAL 406


>gi|316932483|ref|YP_004107465.1| phosphoglycerate kinase [Rhodopseudomonas palustris DX-1]
 gi|315600197|gb|ADU42732.1| Phosphoglycerate kinase [Rhodopseudomonas palustris DX-1]
          Length = 398

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 199/400 (49%), Positives = 277/400 (69%), Gaps = 3/400 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++  RT++D+ D++G R LLRVD NVP   GKV D TR++RV PTI E+  K  KV++ 
Sbjct: 1   MTKSFRTLDDV-DVKGQRVLLRVDLNVPMDSGKVTDTTRLQRVAPTITEIAGKGGKVILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+ + DK+ SL  V +    ++ K + F  DC+G   +++IA++++G I+  EN 
Sbjct: 60  AHFGRPKGRDDKN-SLRPVAAALADVIKKPVGFAEDCVGEPAAKAIAAMADGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L+  GD ++NDAFS +HRAHAS  GL H LP+Y GR MQ EL  
Sbjct: 119 RFHPEEEKNDPAFVEKLAELGDIWVNDAFSAAHRAHASTEGLGHKLPAYAGRTMQAELDA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++AIVGG+KVS+KI LL NLV KV  LVIGGGMAN+FL AQG+ VG+SL
Sbjct: 179 LNKALEAPAKPVIAIVGGAKVSSKIDLLENLVTKVQALVIGGGMANTFLHAQGVKVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
           C++D ++   +I  +A+ + C II+P D  VA   +   P+      ++P DS+ILDVG 
Sbjct: 239 CEKDLAETALRIMNKAEAANCAIILPVDATVAYHFEANAPSFAYGLDAIPPDSMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +++E I   I  A T++WNGP+G FE+ PFD+ TVE A + AK TK  +++S+AGGGDT+
Sbjct: 299 RSIERIHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAKHAAKRTKAGKLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            AL HAG++++FTY+STAGGAFLEW+EGK LPG+  L   
Sbjct: 359 AALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVEVLRAK 398


>gi|229826499|ref|ZP_04452568.1| hypothetical protein GCWU000182_01874 [Abiotrophia defectiva ATCC
           49176]
 gi|229789369|gb|EEP25483.1| hypothetical protein GCWU000182_01874 [Abiotrophia defectiva ATCC
           49176]
          Length = 411

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 138/408 (33%), Positives = 235/408 (57%), Gaps = 14/408 (3%)

Query: 1   MS--RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI 58
           M+    ++++D+ +++G R L+R D+NVP  +GK+ D  R+   +PTI +L+    KV++
Sbjct: 9   MAGLNKKSVDDI-NVKGKRVLVRCDFNVPLKEGKITDENRLVAALPTIKKLIADGGKVIL 67

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILA 116
            SHLG+P+ +   + SL  V      +L + + F  D   +G+    ++ ++ +G ++L 
Sbjct: 68  CSHLGKPKGEPKPELSLAPVAVRLAELLGQPVKFAADDEVVGANAKAAVEAMKDGEVVLL 127

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQK 175
           +N R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  M K
Sbjct: 128 QNTRYRAEETKNGEAFSKELASLADVFVNDAFGTAHRAHCSNVGVTQYIDTCVVGYLMNK 187

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           E+  L +     K+P VAI+GG+KV+ K+ ++ NL++K D L+IGGGMA +FL AQG  +
Sbjct: 188 EIEFLGNAVENPKRPFVAILGGAKVADKLNVINNLLEKCDTLIIGGGMAYTFLKAQGKEI 247

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQV----VSAQSVPLD 291
           G SL   +  D   ++  +A++   ++++P D V  ++    I   V      + S+P D
Sbjct: 248 GLSLVDNEKIDYCKEMLAKAEKLGKKLLLPVDSVTIKDFPNPIDAPVEVETYDSDSLPAD 307

Query: 292 SIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIIS 351
               D+G K+ E     +  A+TV+WNGP+GVFE       T+ VA  +A    E    +
Sbjct: 308 REGCDIGPKSAELFANEVKSAKTVVWNGPMGVFENPTLAAGTLAVAKALA----ETDATT 363

Query: 352 IAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           I GGGD+  A+   G  ++ +++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 364 IIGGGDSAAAVNQMGFGDKMSHISTGGGASLEFLEGKELPGVAAANDK 411


>gi|3328122|gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
          Length = 482

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 246/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV+
Sbjct: 77  MAK-KSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRAAIPTIKHLIANGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  +DCIG  + + + SL EGG++L E
Sbjct: 136 LSSHLGRPKG-VTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVDSLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D ++NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSTPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 315 SSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGG
Sbjct: 375 IGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKKLADLSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK LPG++AL
Sbjct: 434 DSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|1022805|gb|AAB60303.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 399

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 159/388 (40%), Positives = 241/388 (62%), Gaps = 4/388 (1%)

Query: 11  RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKS 69
            D++G +  +R D NVP  D + + D TRI   +PTI  L+E  AKV++ +HLGRP+   
Sbjct: 6   ADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKG-V 64

Query: 70  DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERND 129
               SL  +V     +L   +   +DCIG  +   +ASL EGG++L ENVRFY EEE+ND
Sbjct: 65  TPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKND 124

Query: 130 PDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLESCFSESK 188
           P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKEL  L    S  K
Sbjct: 125 PEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVSNPK 184

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL + D  +  
Sbjct: 185 RPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELA 244

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
            ++  +AK     +++P DVVVA +      +++V A  +    + LD+G  +++   + 
Sbjct: 245 TELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEA 304

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           +   +TV+WNGP+GVFE+E F   T  +A+ +A+L+ E+ + +I GGGD++ A+   G++
Sbjct: 305 LDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELS-EKGVTTIIGGGDSVAAVEKVGVA 363

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              +++ST GGA LE LEGK LPG++AL
Sbjct: 364 GVMSHISTGGGASLELLEGKVLPGVIAL 391


>gi|75676920|ref|YP_319341.1| phosphoglycerate kinase [Nitrobacter winogradskyi Nb-255]
 gi|74421790|gb|ABA05989.1| phosphoglycerate kinase [Nitrobacter winogradskyi Nb-255]
          Length = 398

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 196/400 (49%), Positives = 266/400 (66%), Gaps = 3/400 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   RT++D+ D+RG R LLRVD NVP   G+V D TR+ERV PTI E+ +K  K ++ 
Sbjct: 1   MTNSFRTLDDV-DVRGKRVLLRVDLNVPMEQGRVTDATRLERVAPTITEIADKGGKAILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+  +D   SL  V      +L K + F +DC+G    Q++A++ +G I+  EN 
Sbjct: 60  AHFGRPKG-ADPKNSLRPVAEELAKVLGKPVAFADDCVGEPAQQAVAAMKDGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L+R GD ++NDAFS +HRAHAS  GL H LP Y GR MQ EL  
Sbjct: 119 RFHPEEEKNDPAFVAELARLGDIWVNDAFSAAHRAHASTEGLGHKLPGYAGRTMQAELEA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++A++GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ +G+SL
Sbjct: 179 LNKALEAPTKPVIAVIGGAKVSTKIDLLENLVSKVDALVIGGGMANTFLHAQGVSIGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D +    +I  +A+ + C II+P D  VA       P+      ++P D +ILDVG 
Sbjct: 239 AEKDLAATALRIMEKAEAANCAIILPVDATVAFHFAANTPSHAYGLDAIPADGMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++VE ++  I  A T++WNGPLG FE+ PFDR TV  A + A+ TK  +++S+AGGGDT+
Sbjct: 299 QSVERVRSAIDDAATLVWNGPLGAFELTPFDRGTVAAAKHAAERTKAGKLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            AL  A ++ +FTYVSTAGGAFLEW+EGK LPG+  L   
Sbjct: 359 AALNQADVAGDFTYVSTAGGAFLEWMEGKPLPGVEVLRAK 398


>gi|320106577|ref|YP_004182167.1| phosphoglycerate kinase [Terriglobus saanensis SP1PR4]
 gi|319925098|gb|ADV82173.1| Phosphoglycerate kinase [Terriglobus saanensis SP1PR4]
          Length = 406

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 169/409 (41%), Positives = 251/409 (61%), Gaps = 15/409 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDG-KVADVTRIERVVPTILELVEKKAKVVI 58
           M++L ++ DL D+   R L+RVD+NVP   DG ++ D TRI   +PTI   + ++AKV++
Sbjct: 1   MAKL-SIRDL-DLNNKRVLIRVDFNVPLSKDGTEILDDTRIRETLPTIEYAIRRRAKVIL 58

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNIL------FVNDCIGSTLSQSIASLSEGG 112
            +HLGRP+ K   + SL  VV    +++   +       F  DC+G   ++ +  L  G 
Sbjct: 59  AAHLGRPKGKPVAEMSLRPVVDRLRNLIDHEMGESFNVGFAPDCVGEIATELVRQLESGQ 118

Query: 113 IILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGR 171
           ++L EN+RF+ EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G++H +  S  G 
Sbjct: 119 VLLLENLRFHPEEEKNDPGFAKKLAALCDIYVNDAFGAAHRAHASTEGITHFVAQSAAGL 178

Query: 172 AMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQ 231
            M+KEL+ L        KP VAI+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL AQ
Sbjct: 179 LMEKELNYLGKALQSPDKPFVAIIGGAKVSDKIGVIDNLLNKVDAIIIGGGMAYTFLNAQ 238

Query: 232 GMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQ-SVPL 290
           G   G+SL + D  D       +A+    + ++P D ++A +      TQV     + P 
Sbjct: 239 GQKTGKSLLEADKIDIAKAALKKAEEKGVKFLLPVDHILADKFAADARTQVFEGTSNFPE 298

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
           D + LD+G K++E     IA+ART++WNGP+GVFE+  F + T+ +AH VA  T     I
Sbjct: 299 DWMALDIGPKSIELFNAEIAEARTIVWNGPMGVFELPAFAKGTMAIAHAVADNT---DAI 355

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           SI GGGD+++A+  A +++  T++ST GGA LE+LEGK LPG+ ALS  
Sbjct: 356 SIVGGGDSVSAVHAAEVTDRITHISTGGGASLEFLEGKTLPGVAALSPK 404


>gi|240851241|ref|YP_002972644.1| phosphoglycerate kinase [Bartonella grahamii as4aup]
 gi|240268364|gb|ACS51952.1| phosphoglycerate kinase [Bartonella grahamii as4aup]
          Length = 397

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 201/395 (50%), Positives = 285/395 (72%), Gaps = 1/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              RT++D+ D+ G R L+RVD+NVP   GKV D TR+ER   T++EL ++ AK+++ SH
Sbjct: 1   MGFRTLDDV-DVTGKRVLVRVDFNVPMAQGKVCDTTRLERHKETLVELQKRGAKLILLSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ K + + SL  VV + E I++K + F  DCIGS +  ++ SL  GG++L ENVRF
Sbjct: 60  CGRPKGKVEPEFSLRPVVQVLEKIINKPVSFAPDCIGSVVQVAVESLQNGGVLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y+ EE+ND  F   L+ NGD Y+NDAFSVSHRAHAS+ G++HLLPSY GR++Q E+  LE
Sbjct: 120 YAGEEKNDCSFAEALAHNGDLYVNDAFSVSHRAHASVEGITHLLPSYAGRSLQGEMQALE 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                   P+VAIVGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ VG+SLC+
Sbjct: 180 KGLGNPTHPVVAIVGGAKVSSKLFVLNHLVEKVDHLVIGGGMANSFLAAQGVSVGKSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               D + +I  +A+   C +++P+D VV    +   P ++   + +P D +ILD+G ++
Sbjct: 240 HALMDTIKKIIKKAQECQCTLLLPQDAVVGFRFEKDAPHRLYDIEDIPQDGMILDIGTRS 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           + +I  VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+ +   +++SIAGGGDT+ A
Sbjct: 300 IAHINTVIDKAATLVWNGPLGVFEMSPFDKGTIAVARHAAERSLTGKLVSIAGGGDTVFA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG++N+FTY+STAGGAFLEW+EGK LPGI+AL
Sbjct: 360 LNHAGVANDFTYLSTAGGAFLEWMEGKVLPGILAL 394


>gi|256832489|ref|YP_003161216.1| Phosphoglycerate kinase [Jonesia denitrificans DSM 20603]
 gi|256686020|gb|ACV08913.1| Phosphoglycerate kinase [Jonesia denitrificans DSM 20603]
          Length = 399

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 144/398 (36%), Positives = 233/398 (58%), Gaps = 6/398 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D+RG R L+R D+NVP     + D  RI   +PT+ +LV+  A+V+I +HLG
Sbjct: 1   MKTIADLGDLRGKRVLVRSDFNVPLDGSTITDDGRIRAALPTLKKLVDAGARVIITAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + D   +L  V +  E +L  ++    D +G +   ++A L++G ++L EN+RF +
Sbjct: 61  RPKGEPDPKYTLAPVATRLEELLGASVTLAGDVVGDSAKDAVAQLTDGNVVLLENIRFDA 120

Query: 124 EEERNDPDFVRMLS----RNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E          L+       DF+++D F V HR  AS+  ++ ++P+ +G  +QKE+  
Sbjct: 121 RETSKVDSEREELARELGAFADFFVSDGFGVVHRKQASVYDVARVVPAAVGDLVQKEVES 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L    +  ++P   ++GGSKVS K+ ++ NL+ K D+L+IGGGM  +FL A+G  VG SL
Sbjct: 181 LSKATTNPERPYAVVLGGSKVSDKLGVIGNLLNKADRLLIGGGMLFTFLAAKGYSVGNSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  + V      A+++  EI++P D++VA E K   P  VV+A ++P   + LD+G 
Sbjct: 241 LEEDQIETVKGYLDTAEKNGVEIVLPVDIIVAPEFKADAPATVVAADAIPDGQMGLDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ +     ++ A+T++WNGP GVFE + F   T  VA  +   T      S+ GGGD+ 
Sbjct: 301 ESQKLFAAKLSDAKTIVWNGPAGVFEFDAFAGGTRAVAQGIIDATAA-GAFSVVGGGDSA 359

Query: 360 TALAHAGISNE-FTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G     F+++ST GGA LE+LEGK+LPGI  L
Sbjct: 360 AAVRILGFDEAGFSHISTGGGASLEFLEGKELPGIAVL 397


>gi|262039009|ref|ZP_06012343.1| phosphoglycerate kinase [Leptotrichia goodfellowii F0264]
 gi|261746919|gb|EEY34424.1| phosphoglycerate kinase [Leptotrichia goodfellowii F0264]
          Length = 407

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 155/405 (38%), Positives = 242/405 (59%), Gaps = 11/405 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T+ DL D++G + L+RVD+NVP  DG + D  RI   +PT+  ++E   KV+ FS
Sbjct: 1   MAK-KTLKDL-DVKGKKVLVRVDFNVPIKDGVITDDNRIIAALPTLKYILENGGKVIAFS 58

Query: 61  HLGRPQSKSDK-DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLG+ +++ DK   +L  V    E +L K + F+ +  G+ L  +I  L +G I++ EN 
Sbjct: 59  HLGKVKAEEDKVSKTLAPVAKRLEEVLGKPVKFIPETRGAKLEAAINELKDGEILMFENT 118

Query: 120 RFY----SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQ 174
           RF      +E +NDP+  +  +  GD ++NDAF  +HRAHAS  G++     S +G  ++
Sbjct: 119 RFEDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVGIASNLKESAVGFLVE 178

Query: 175 KELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMG 234
           KE+  +        +PLVAI+GG+KVS KI ++ NL+ K DK++IGGGM  +FL AQG  
Sbjct: 179 KEIDFIGGAVDNPVRPLVAILGGAKVSDKIGVIENLLDKADKVIIGGGMMFTFLKAQGKN 238

Query: 235 VGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSII 294
            G SL + D  +    +  +AK    E+++P D VVA+E K     + VS   +    + 
Sbjct: 239 TGASLLEEDKVELAKSLIEKAKTKGVELVLPIDTVVAKEFKNDTEFKTVSVDDIEDGWMG 298

Query: 295 LDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAG 354
           LD+G K++   K+ +  A+TV+WNGP+GVFE+  F + T+ V   +A L       +I G
Sbjct: 299 LDIGEKSIALFKEKLNGAKTVVWNGPMGVFEMPNFAKGTIGVCEAIANL---SDAKTIIG 355

Query: 355 GGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGD+  A    G + +F+++ST GGA LE+LEGK+LPG+ A+S  
Sbjct: 356 GGDSAAAAIQLGYAEKFSHISTGGGASLEYLEGKELPGVAAISEK 400


>gi|325294326|ref|YP_004280840.1| phosphoglycerate kinase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325064774|gb|ADY72781.1| Phosphoglycerate kinase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 404

 Score =  360 bits (923), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 154/401 (38%), Positives = 246/401 (61%), Gaps = 8/401 (1%)

Query: 2   SRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           +++ ++ D+    ++G +  +RVD+NVP  +G + +  RI   +PTI  L++ KAKV++ 
Sbjct: 8   NKM-SLRDISPEKLKGKKVFVRVDFNVPLENGVIQNDKRIRAALPTINYLIDHKAKVILC 66

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHL RP+   D   SL  V      +L K + F+ DC+G  +   + +L EG + L ENV
Sbjct: 67  SHLDRPEG-WDPKLSLKPVADRLSRLLEKEVKFIPDCVGEEVEWEVNNLKEGEVALLENV 125

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELS 178
           RFY EE +NDP+F + L++  D Y+NDAF  +HR HAS  G+  ++  +  G  ++KE+ 
Sbjct: 126 RFYKEETKNDPEFAKKLAKLADIYVNDAFGTAHRKHASTYGIAQYVEIAVAGFLLEKEIK 185

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L+      ++PLV I+GGSKVS K+ ++ NL+K VDK++IGGGMA +FL A G  VG+S
Sbjct: 186 YLQKALDNPERPLVLIIGGSKVSGKLEVIENLLKVVDKMLIGGGMAYTFLKAAGYNVGKS 245

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + +  D   +I  +A+++  +  +P D   A E       ++ + + +P D + LD+G
Sbjct: 246 LVEEELLDTAKEIMEKAEKNGIKFYLPVDSNNADEFSPTAHAKLTTYKEIPDDMMGLDIG 305

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
             TVE  K+ ++ A+T++WNGP+GVFE E F   T+E+   VA        + I GGGD+
Sbjct: 306 PATVELFKEALSDAKTILWNGPMGVFEFEKFGYGTMEIGRIVA---SHAEALRIVGGGDS 362

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           + A+   G+ ++  +VST GGAFLE+L GK+LPG++AL+  
Sbjct: 363 VAAVEALGLEHQIDHVSTGGGAFLEFLAGKELPGVMALTDK 403


>gi|210635487|ref|ZP_03298568.1| hypothetical protein COLSTE_02507 [Collinsella stercoris DSM 13279]
 gi|210158342|gb|EEA89313.1| hypothetical protein COLSTE_02507 [Collinsella stercoris DSM 13279]
          Length = 401

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 152/395 (38%), Positives = 240/395 (60%), Gaps = 4/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G R L+RVD+NVP  DG V D TRI+  +PTI  LVE  A+V++ SHLGR
Sbjct: 6   KTVRDI-DVDGKRVLVRVDFNVPIKDGVVGDTTRIKAALPTINYLVEHNARVILMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P       + SL  V +    +   ++ FV+D  G   + ++ +L  G +++ ENVRF  
Sbjct: 65  PDGTGFQAEFSLEPVAAKLAELSGLDVTFVDDTYGEKAAAAVEALEPGKVLVLENVRFDK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  + L+  GD ++ DAF  +HR+  S+ G +  LP+  G  ++KE+  L   
Sbjct: 125 REKKNDPEIAKTLASYGDVFVLDAFGTAHRSQGSVVGPAAYLPAVAGFLLEKEVDTLTGI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL-CQR 242
           F+  ++P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G     +   + 
Sbjct: 185 FAAPERPFVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAKGYKTVGTSLKEE 244

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           D+ +   ++  +A+    +I++P D VVA         +VV++ S+P D + +D+G KT 
Sbjct: 245 DWVERAAEMLKKAEDKGVQILLPIDNVVADHFGEDATGEVVASDSIPEDRMGMDIGPKTE 304

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
               + I  A+TV WNGP+GVFE + F   T  VA  VA+L K+    SI GGGD++ A+
Sbjct: 305 ALYAEAIKGAKTVFWNGPMGVFEFDNFAHGTQAVAEAVAEL-KDNGGTSIIGGGDSVAAV 363

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
               ++++ +++ST GGA +E +EGK LPG+ AL+
Sbjct: 364 NKFDLADKMSWISTGGGASMELVEGKALPGVEALN 398


>gi|332982052|ref|YP_004463493.1| phosphoglycerate kinase [Mahella australiensis 50-1 BON]
 gi|332699730|gb|AEE96671.1| phosphoglycerate kinase [Mahella australiensis 50-1 BON]
          Length = 395

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 151/400 (37%), Positives = 245/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIE-RVVPTILELVEKKAKVVIF 59
           M   +T+ D+ D+ G + L+RVD+NVP  + +     R     +PTI  L++  A V++ 
Sbjct: 1   MLNKKTIEDI-DVSGKKVLVRVDFNVPLDENRRITDDRRIREALPTIKYLIDHNAMVILV 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+ K D+  S+  V    + +L K ++   D IG +    +A++  G ++L ENV
Sbjct: 60  SHLGRPKGKFDEKYSMAPVAERLQELLDKPVVLAKDVIGDSAKACVAAMKPGDVVLLENV 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF++EEE+ND +F + L+   + Y+NDAF  +HRAHAS  G++  LP+  G  ++KEL +
Sbjct: 120 RFHAEEEKNDTEFAKALASLAEIYVNDAFGTAHRAHASTAGVAAYLPAVAGYLIKKELDI 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           +       ++P VA++GG KVS KI ++ NL+ KVD L+IGG MA +F  A+G   G S+
Sbjct: 180 MGKALDNPERPFVAVLGGVKVSDKIGVINNLIDKVDTLIIGGAMAYTFFRAKGYSTGSSV 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   ++  +A+    E+++P D VVA+E K     +VV ++++P     +D+G 
Sbjct: 240 VEEDKIDLAKELMAKAQAKGVELLLPVDNVVAKEFKADAEHKVVPSEAMPDGWQGVDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT+E   +VI  A+TV+WNGP+GVFE+  F   T  +A  +++     + ++I GGGD+ 
Sbjct: 300 KTIEMFSKVIENAKTVVWNGPMGVFEMPAFANGTRAIAEAMSRC----KGVTIIGGGDSA 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G +++ T++ST GGA LE+LEGK+LPG+  L+  
Sbjct: 356 AAVEQLGYADKMTHISTGGGASLEFLEGKELPGVAVLNDK 395


>gi|302873622|ref|YP_003842255.1| Phosphoglycerate kinase [Clostridium cellulovorans 743B]
 gi|307688197|ref|ZP_07630643.1| phosphoglycerate kinase [Clostridium cellulovorans 743B]
 gi|302576479|gb|ADL50491.1| Phosphoglycerate kinase [Clostridium cellulovorans 743B]
          Length = 397

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 151/400 (37%), Positives = 237/400 (59%), Gaps = 9/400 (2%)

Query: 3   RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
             +++ D++ ++G R L+R D+NVP  DG++ D+ R+   +PTI  LV+  AKV++ SHL
Sbjct: 4   NKKSIEDIQ-VKGKRVLVRCDFNVPLKDGEITDINRLVGAMPTIKYLVDNGAKVILCSHL 62

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVR 120
           G+ +   D   +L  V      +L K ++F  D   +G     ++A++ EG ++L EN R
Sbjct: 63  GKAKG-PDPSKTLAPVAEKLSEMLDKEVVFAADDTVVGENAKAAVAAMKEGDVVLLENTR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKELSM 179
           F  EE +N+  F + L+   D Y+NDAF  +HRAH S  G+++ + +   G  +QKEL  
Sbjct: 122 FRPEEGKNEESFSKDLASIADVYVNDAFGTAHRAHCSTVGVTNFVDTAACGYLIQKELKF 181

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L +     ++P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +FL AQG  +G SL
Sbjct: 182 LGNAVENPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTIGTSL 241

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++  +A     ++++P D VV  +            Q++P   + LD+G 
Sbjct: 242 LEADKVEYSKEMLEKAAAKGVKLLLPIDNVVGDKFSADATPVTTEDQNIPEGHMGLDIGP 301

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+       +  A+TV+WNGP+GVFE E F + TVEVA  +A    +    +I GGGD+ 
Sbjct: 302 KSAALFADAVKGAKTVIWNGPMGVFEFENFAKGTVEVAKAMA----DSSATTIIGGGDSA 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G  ++ T++ST GGA LE+LEGK+LPGI AL+  
Sbjct: 358 AAVNILGFGDKMTHISTGGGASLEFLEGKELPGIAALNDK 397


>gi|154508830|ref|ZP_02044472.1| hypothetical protein ACTODO_01340 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798464|gb|EDN80884.1| hypothetical protein ACTODO_01340 [Actinomyces odontolyticus ATCC
           17982]
          Length = 396

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 154/399 (38%), Positives = 227/399 (56%), Gaps = 9/399 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT++ L D+RG R L+R D+NVP  DG + D  RI   +PT+  L +  AKVVI +HLG
Sbjct: 1   MRTISTLGDLRGKRVLVRSDFNVPLKDGVITDDGRIRAALPTLKTLTDAGAKVVIMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + D   SL  V +    +    +   +D +G + ++++A+L EG I L ENVR+ +
Sbjct: 61  RPKGQVDPAFSLAPVATRLAELSGVKVTLASDVVGPSATETVAALGEGEIALLENVRYDA 120

Query: 124 EEERNDPDFVRMLSRNG----DFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E     +    L+R      D +++D F V HR  AS+  ++ LLPS  G  + KE+  
Sbjct: 121 RETSKVDEEREELAREYAKLGDAFVSDGFGVVHRKQASVYDIAKLLPSAAGLLVLKEIES 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++P   ++GGSKVS K+ ++ NL+KK D L IGGGM  +FL AQG  VG+SL
Sbjct: 181 LSKVTGDPERPYGVVLGGSKVSDKLGVIANLLKKADMLFIGGGMVFTFLAAQGYSVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D V     EA     ++++P DV+VA E     P  VV   ++P D + LD+G 
Sbjct: 241 LEEDQIDTVKGYIAEAAERGVDLVLPIDVIVAPEFAADAPATVVKVDAIPDDQMGLDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ +     +A A+TV WNGP+GVFE + F   T  VA  ++K      + S+ GGGD+ 
Sbjct: 301 ESAKLFADKLATAKTVAWNGPMGVFEFDAFAGGTRAVAEALSK----GSMFSVIGGGDSA 356

Query: 360 TALAHAGISNE-FTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+   G     F+++ST GGA LE LEGK LPGI  L 
Sbjct: 357 AAVRLLGFDENTFSHISTGGGASLELLEGKVLPGIAVLE 395


>gi|118580115|ref|YP_901365.1| phosphoglycerate kinase [Pelobacter propionicus DSM 2379]
 gi|166219335|sp|A1APN7|PGK_PELPD RecName: Full=Phosphoglycerate kinase
 gi|118502825|gb|ABK99307.1| phosphoglycerate kinase [Pelobacter propionicus DSM 2379]
          Length = 399

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 149/397 (37%), Positives = 237/397 (59%), Gaps = 6/397 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
             +R ++ L D++  +  +RVD+NVP    G + + TRI   +PTI   +E+ A+V++ S
Sbjct: 1   MPIRYIDQLADLKDKKVFIRVDFNVPQDSKGNITEDTRITGALPTIRYAIEQGARVILAS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + ++  S+         +L + +   +DC G  +++ I ++  G +++ ENVR
Sbjct: 61  HLGRPKGEKNEKYSMVPAAKRLSELLGRKVKQASDCFGEEVTREIDAMKSGEVLMLENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSM 179
           FY  EE+NDP F + L+     Y+NDAF+VSHRAHAS+  ++ ++P+ + G  M+ E++ 
Sbjct: 121 FYPGEEKNDPKFAQQLANGCQVYVNDAFAVSHRAHASVEAITRVIPTVVAGFLMRNEMTF 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
            +       +PLVAI+GG+KVS K+ +L  L+ KVDK+VIGGGMA +FL + G  VG S 
Sbjct: 181 FDKAMQNPVRPLVAILGGAKVSGKLEVLEKLMNKVDKVVIGGGMAFTFLKSMGYSVGASK 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + +      +I  +A++      +P D VVA   +      + + Q +P   + LD+G 
Sbjct: 241 VEDELLPTAKKIMDKARKKGIMFYLPVDCVVANAFEASATNFITTVQEIPEGWLALDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +     + +  A+TV+WNGP+GVFE++ F R T  VA  VA         +I GGGDT 
Sbjct: 301 ASATLFTETLRDAKTVIWNGPMGVFEMDAFARGTFAVAEAVASAF----ATTIIGGGDTD 356

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +A+  AG+ ++ +Y+ST GGAFLE LEGK LPG+ AL
Sbjct: 357 SAVRKAGVESKVSYISTGGGAFLELLEGKVLPGVKAL 393


>gi|167628777|ref|YP_001679276.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
 gi|167591517|gb|ABZ83265.1| phosphoglycerate kinase [Heliobacterium modesticaldum Ice1]
          Length = 395

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 179/399 (44%), Positives = 264/399 (66%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
              +T+ D+ D+RG   L+RVD+NVP  + G + D TRI   +PTI  L+++ AKV++ S
Sbjct: 1   MNKQTVRDI-DVRGKGVLVRVDFNVPVNEAGVITDDTRIRAALPTIQYLIQEGAKVILAS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K +    L  V      +L + +  ++DCIG     ++ ++  G ++L ENVR
Sbjct: 60  HFGRPKGKVNDKYRLTAVGIRLAELLGRPVKKLDDCIGPETEAAVRAMEAGDVVLLENVR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY EEE+NDP F R L+   D Y+NDAF  +HRAHAS  G++  LP+  G  M KE+S++
Sbjct: 120 FYLEEEQNDPAFARKLAALADVYVNDAFGTAHRAHASTAGVAAYLPAVAGFLMDKEISIM 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
               +  ++P VAI+GG+KV+ KI ++ NL+ KVD L+IGGGMAN+F  A G  VGRSLC
Sbjct: 180 GKALASPERPFVAIMGGAKVADKIAVIDNLLTKVDTLIIGGGMANTFFYALGREVGRSLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +D   Q+  +AK S    ++P DVVVA  +  G+PT VV A ++P D   LD+G +
Sbjct: 240 EKDKADTARQLLNKAKASGVRFLLPVDVVVAETLAAGVPTAVVPADAIPADKAALDIGPE 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           ++   +Q +A+ARTV+WNGP+G FEI PFDR T+ VA  +AK+    + +SI GGGD++ 
Sbjct: 300 SIALFEQALAKARTVLWNGPMGAFEIAPFDRGTLGVAKAMAKV----QGLSIIGGGDSVA 355

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+  AG++++ T+VST GGA LE+LEG++LPG+ ALS  
Sbjct: 356 AVEKAGLADQMTHVSTGGGASLEFLEGRELPGVAALSDK 394


>gi|49476164|ref|YP_034205.1| phosphoglycerate kinase [Bartonella henselae str. Houston-1]
 gi|46576829|sp|Q8L1Z8|PGK_BARHE RecName: Full=Phosphoglycerate kinase
 gi|20465201|gb|AAL74285.1| phosphoglycerate kinase [Bartonella henselae str. Houston-1]
 gi|49238972|emb|CAF28270.1| Phosphoglycerate kinase [Bartonella henselae str. Houston-1]
          Length = 397

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 196/396 (49%), Positives = 286/396 (72%), Gaps = 1/396 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              RT++D+ D+ G R L+RVD+NVP   GKV D TR++R   T+LEL ++ AK+++ SH
Sbjct: 1   MGFRTLDDV-DVTGKRVLVRVDFNVPMAQGKVCDDTRLKRHKETLLELQKRGAKLILLSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ + + + SL  VV + E I+++ + F +DCIG  +  ++ +L  GGI+L ENVRF
Sbjct: 60  CGRPKGQVEPEFSLHPVVQVLEKIINQPVNFASDCIGVAVQTAVEALQNGGILLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +S EE+N   F   L+ NGD Y+NDAFSVSHRAHAS+ G++H LPSY GR++Q EL  LE
Sbjct: 120 HSGEEKNAGSFAEALAHNGDLYVNDAFSVSHRAHASVEGITHFLPSYAGRSLQCELQALE 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               + ++P++AIVGG+KVS+K+ +L +LVKKVD LVIGGGMANSFL AQG+ VG+SLC+
Sbjct: 180 KGLGKPERPVIAIVGGAKVSSKLFVLNHLVKKVDYLVIGGGMANSFLAAQGVCVGKSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
               + V ++  +A+   C +++P D +V    +   P ++     +P D +ILDVG ++
Sbjct: 240 HALIETVKKVIEKARECQCTLLLPVDAIVGFRFEKDAPHRLYDIGDIPEDGMILDVGTRS 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           + +I  VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+L+   +++SIAGGGDT+ A
Sbjct: 300 IAHINAVIDKAATLVWNGPLGVFEMSPFDQGTIAVARHAAELSLTGKLVSIAGGGDTVFA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           L HAG++++FTY+STAGGAFLEW+EGK LPGI+AL+
Sbjct: 360 LNHAGVADDFTYLSTAGGAFLEWMEGKMLPGILALT 395


>gi|255994713|ref|ZP_05427848.1| phosphoglycerate kinase [Eubacterium saphenum ATCC 49989]
 gi|255993426|gb|EEU03515.1| phosphoglycerate kinase [Eubacterium saphenum ATCC 49989]
          Length = 398

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 157/395 (39%), Positives = 241/395 (61%), Gaps = 7/395 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G   + R D+NV   +G++ D +RI + +PTI  +++K AKV++ SHLGR
Sbjct: 7   KTVRDI-DLTGKSVVTRCDFNVGISNGEIEDDSRIVKAIPTIEYMLDKGAKVILLSHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRFY 122
           P+ + DK+ SL  V      +L + + F +    +   + + ++ L EG + L ENVRF 
Sbjct: 66  PKGEPDKEFSLRPVAKRLGELLKREVHFFSSQRVVDEDVKRKVSELHEGEVCLLENVRFR 125

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLES 182
            EE  ND  F + L+  GD Y++DAF  SHRAHAS  G++  LP+  G  ++KE+  L  
Sbjct: 126 KEETDNDDAFSKELASLGDVYVDDAFGTSHRAHASTAGVAKYLPAVSGFLIEKEIKHLSI 185

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
              + +KP V IVGG+K+  KI +L NL+ KVD ++IGGGM+ +FL A+G  +G+SL   
Sbjct: 186 ALKKPEKPFVLIVGGAKIPDKIGILSNLLDKVDAIIIGGGMSYTFLKAKGYEIGQSLLDE 245

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
              +  + I   A     E+ +P DVVVA ++   + T  V    +P D + LD+G KT+
Sbjct: 246 KNIELANNIMNAAGEKNVEVHLPVDVVVAEKIADDVETFEVDITDIPPDKMGLDIGIKTI 305

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
           +   +VI  A+T +WNGP+GVFE++PF+  T ++A  +A+      + SI GGGD+  A+
Sbjct: 306 KNFTEVIKNAKTAVWNGPMGVFELKPFENGTRKLAEAIAEA----DVCSIIGGGDSAAAV 361

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              G+S++ T+VST GGA LE+LEGK LPGI  L 
Sbjct: 362 NKFGLSDKITHVSTGGGASLEFLEGKVLPGIDVLE 396


>gi|1172455|sp|P41758|PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|642454|gb|AAA70082.1| phosphoglycerate kinase precursor [Chlamydomonas reinhardtii]
 gi|33339114|gb|AAQ14241.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
          Length = 461

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 5   RTMNDL--RDIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKVVIFS 60
           +++ DL   D+ G R  +R D NVP       + D TRI   VPT+  L++  AKV++ S
Sbjct: 63  KSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVLLTS 122

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+   +    L  VV+    +L K +  V+DCIG  + +++ ++  G ++L EN R
Sbjct: 123 HLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLENCR 182

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           FY EEE+N+P+F + L+ N D Y+NDAF  +HRAHAS  G++    PS  G  +QKEL  
Sbjct: 183 FYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDY 242

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+   S  K+P VAIVGGSKVS+KIT++  L++K DK++IGGGM  +F  A+ + VG SL
Sbjct: 243 LDGAVSNPKRPFVAIVGGSKVSSKITVIEALMEKCDKIIIGGGMIFTFYKARALKVGSSL 302

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +   ++   AK    ++++P DVVVA +      TQ V   ++P   + LD+G 
Sbjct: 303 VEDDKIELAKKLEEMAKAKGVQLLLPTDVVVADKFDANANTQTVPITAIPDGWMGLDIGP 362

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +V+     +A A+TV+WNGP+GVFE     + TV +A+ +A LT  +  I+I GGGD++
Sbjct: 363 DSVKTFNDALADAKTVVWNGPMGVFEFPQVRQRTVSIANTLAGLTP-KGCITIIGGGDSV 421

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+  AG++ + +++ST GGA LE LEGK LPG+ AL   
Sbjct: 422 AAVEQAGVAEKMSHISTGGGASLELLEGKVLPGVAALDEK 461


>gi|289522890|ref|ZP_06439744.1| phosphoglycerate kinase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503914|gb|EFD25078.1| phosphoglycerate kinase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 397

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 159/396 (40%), Positives = 251/396 (63%), Gaps = 3/396 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
            +LR + D +D+ G + L+RVD+NVP  DG V D TRI+  + T+  L    A++ + SH
Sbjct: 1   MKLR-IPDSKDVSGKKVLVRVDFNVPMKDGVVTDDTRIKAHLDTLTFLRNSGARLALVSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+   D   SL  V    +++    + F+ DCIG  +++++AS  +  +++ ENVRF
Sbjct: 60  LGRPKEGRDSQFSLKPVAEHLKALTGWKVTFIQDCIGEEVTRAVASQQQEEVLVLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  E +NDPDF + L++  + ++ DAFS +HRAHAS  G+   L S+ G  +++E+  L 
Sbjct: 120 YKGETKNDPDFAKELAKPFEVFVMDAFSAAHRAHASTRGVVDYLTSFAGFLIKREIDSLG 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                   P + I+GG+KVS KI ++ NL+ KVD ++IGGGMA +FL A+G G+G+SLC+
Sbjct: 180 LVRDNPAHPYILILGGAKVSDKIGVIENLISKVDHIIIGGGMAYTFLKARGYGIGKSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGFK 300
            +  +   ++   ++    EI +P D VVA ++K  +P  V+  ++ +P D + LD+G K
Sbjct: 240 EEKLEYAKEMLELSRSRGVEIHLPVDSVVAPDVKADVPASVIDLETSIPEDMMALDIGPK 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +++   ++I +A+TV WNGP+GVFE+EPF   T +VA  VA++TK     ++ GGGDT  
Sbjct: 300 SIDNFSKIIGKAKTVFWNGPMGVFELEPFRAGTEKVALAVAQVTKNGG-HTVIGGGDTAA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           A+   G S++ ++VST GGA LE++EGK LPGI  L
Sbjct: 359 AVNMLGFSDQMSHVSTGGGASLEFMEGKMLPGIEPL 394


>gi|2499497|sp|Q42961|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags:
           Precursor
 gi|1161600|emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
          Length = 481

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 247/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   +++G +  +R D NVP  D + + D TRI   VPTI  L+   AKV+
Sbjct: 76  MAK-KSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVI 134

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++ V DCIG  + + +ASL EGG++L E
Sbjct: 135 LSSHLGRPKG-VTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLE 193

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 194 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 253

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 254 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 313

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 314 SSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLD 373

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGG
Sbjct: 374 IGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSG-KGVTTIIGGG 432

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK LPG++AL
Sbjct: 433 DSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIAL 472


>gi|160932292|ref|ZP_02079683.1| hypothetical protein CLOLEP_01127 [Clostridium leptum DSM 753]
 gi|156868894|gb|EDO62266.1| hypothetical protein CLOLEP_01127 [Clostridium leptum DSM 753]
          Length = 405

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 153/399 (38%), Positives = 235/399 (58%), Gaps = 6/399 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           S+ +T+ D+ D+ G + L+R D+NVP   +G + D  RI+  + TI  LV   AKV++ S
Sbjct: 11  SKKKTVEDI-DVAGKKVLVRCDFNVPLDENGNITDTKRIDEAMKTINYLVSHNAKVILCS 69

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ + +   SL  V +     L  ++   +D +G +     A L +G + L ENVR
Sbjct: 70  HLGRPKGEVNMKYSLKPVAAYLSKKLGFDVKMASDVVGDSAKAIAADLKDGEVELLENVR 129

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F   E +NDP+  + ++   + Y+NDAF  +HRAHAS  G++  LP+  G  +QKE+S++
Sbjct: 130 FEKGETKNDPELAKAMASLAEIYVNDAFGTAHRAHASTAGVADYLPAVCGYLIQKEISVM 189

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
            +  S  K+P VAI+GG+KVS KI ++ NL++KVD L+IGGGMA +F+ A G  +G S+C
Sbjct: 190 GTALSNPKRPFVAILGGAKVSDKIGVINNLLEKVDTLIIGGGMAYTFMNALGYSIGTSIC 249

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D  +    +  +AK    + ++P D  V  +       ++V++ ++P   + LD+G K
Sbjct: 250 EADKVELAKDMMAKAKDKGVKFLIPVDNRVGDKYAPDCNHKLVNSDNIPDGWMGLDIGPK 309

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T       I  A TV+WNGP+GV E + F   T+ VA  VA    E   ISI GGGD+  
Sbjct: 310 TEALFADAIKGAGTVVWNGPMGVSEWDNFASGTIAVAKAVA----ESGAISIIGGGDSAA 365

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           A+   G +++ T++ST GGA LE+LEG  LPGI  L+  
Sbjct: 366 AVEKLGFADKMTHISTGGGASLEFLEGLVLPGIACLNDK 404


>gi|284038007|ref|YP_003387937.1| phosphoglycerate kinase [Spirosoma linguale DSM 74]
 gi|283817300|gb|ADB39138.1| Phosphoglycerate kinase [Spirosoma linguale DSM 74]
          Length = 395

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 150/396 (37%), Positives = 235/396 (59%), Gaps = 3/396 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+ D  +  G + L+RVD+NVP      + D TRI+  +PT+L++V      ++ SHL
Sbjct: 1   MKTV-DTYNFAGKKALVRVDFNVPLDKEYNITDDTRIKATIPTVLKIVNDGGSAILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   ++  SL  ++   +    +++ F +DCIG + +   ASL  G I+L EN+RFY
Sbjct: 60  GRPKGGPEEKYSLKHILPALKEAFGRDVKFADDCIGQSATDLAASLQPGEILLLENLRFY 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSMLE 181
            EEE+ D  F   L++ G+ ++NDAF  +HRAHAS   +         G  M  EL+  +
Sbjct: 120 KEEEKGDVAFAEKLAKLGNVWVNDAFGTAHRAHASTAVMGQFFEDRVAGYVMNAELANAK 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               E+++P  AI+GG+K+S KI ++  L+  VD L+IGGGM  +F  AQG  +G+SL +
Sbjct: 180 KILEEAERPFTAIMGGAKISDKILIIEKLLDTVDNLIIGGGMTYTFTKAQGGNIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  +   ++  +A+    +I +P D + A +      +QVV    +P     LD+G KT
Sbjct: 240 ADKQELALELLKKAEAKGVKIYMPVDNLCADDFSNDANSQVVPTGQIPDGWEGLDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E  K+V+ Q++T++WNGP+GVFE E F + T  +A  V K T+E    S+ GGGD+ +A
Sbjct: 300 IELFKEVVLQSKTILWNGPMGVFEFENFAKGTNAIAEAVVKATEENGAFSLIGGGDSASA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +  AG  +  +YVST GGA LE++EGK LPG+ AL 
Sbjct: 360 VNQAGYGDRVSYVSTGGGALLEYMEGKVLPGVAALE 395


>gi|82621134|gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
          Length = 482

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 245/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV+
Sbjct: 77  MAK-KSVGDLSSADLKGKKVFVRADLNVPLDDAQNITDDTRIRAAIPTIKHLIANGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L    +  +DCIG  + + + SL EGG++L E
Sbjct: 136 LSTHLGRPKG-VTPKYSLAPLVPRLSELLGIQGVKADDCIGPEVEKLVDSLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSTPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 315 SSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGG
Sbjct: 375 IGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKKLADLSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK LPG++AL
Sbjct: 434 DSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|2499498|sp|Q42962|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic
 gi|1161602|emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
          Length = 401

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 158/400 (39%), Positives = 242/400 (60%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  +++  L+  D++G R  +RVD NVP  +   + D TRI   VPTI  L++  + V+
Sbjct: 1   MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDENFNITDDTRIRAAVPTIKYLMQHGSHVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   +   ND IG  + + +A + EGG++L E
Sbjct: 61  LASHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKIANDSIGPEVEKLVAEIPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++  L   + G  MQKE
Sbjct: 120 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  +KP  AIVGGSKVS+KI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPQKPFAAIVGGSKVSSKIGVIESLLEKVDVLLLGGGMIFTFYKAQGYAVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++VV A  +P   + LD
Sbjct: 240 SSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASEIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G   ++     +   +TV+WNGP+GVFE + F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++ + +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|139439809|ref|ZP_01773186.1| Hypothetical protein COLAER_02217 [Collinsella aerofaciens ATCC
           25986]
 gi|133774824|gb|EBA38644.1| Hypothetical protein COLAER_02217 [Collinsella aerofaciens ATCC
           25986]
          Length = 396

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 154/393 (39%), Positives = 242/393 (61%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G R L+RVD+NVP  DG V D TRI+  +PTI  LVE  A+V++ SHLGR
Sbjct: 6   KTVRDI-DVDGKRVLVRVDFNVPIKDGVVGDTTRIKAALPTINYLVEHNARVILMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+      + SL  V      +   ++ FV D  G   ++++A++  G +++ ENVRF  
Sbjct: 65  PEGTGFQPELSLEPVAKKLAELSGLDVAFVADTYGEKAAEAVAAVEPGKVLVLENVRFDK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  + L+  GD ++ DAF  +HRA  S+ G +  LP+  G  ++KE+  L   
Sbjct: 125 REKKNDPEIAKKLASYGDVFVLDAFGTAHRAQGSVVGPAAYLPAVAGFLLEKEVDTLTGI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           F+E ++P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +AQG+ VG+SL + D
Sbjct: 185 FAEPERPFVAIVGGSKVSSKIGVLDHLIDSADTLIIGGGMAYTFFLAQGLSVGQSLKEED 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+    +I++P D  VA         +VV++ ++P D   +D+G KT E
Sbjct: 245 WVERAGEMLKKAEEKGVKILLPIDNRVADHFGEDAVPEVVASDAIPDDREGMDIGPKTEE 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +  A+TV WNGP+GVFE + F   T  +A  VA+        SI GGGD++ A+ 
Sbjct: 305 LYAEAVKGAKTVFWNGPMGVFEFDNFAHGTQAIAEAVAEA----DCTSIIGGGDSVAAVN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
              ++++ +++ST GGA +E +EGK LPG+ AL
Sbjct: 361 KFNLADKMSWISTGGGASMELVEGKALPGVEAL 393


>gi|297842743|ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297335094|gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 401

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 164/400 (41%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   ++VV
Sbjct: 1   MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  ND IG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY+EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+  VD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLSTVDILLLGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 240 SSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|307111253|gb|EFN59488.1| hypothetical protein CHLNCDRAFT_29609 [Chlorella variabilis]
          Length = 402

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 157/401 (39%), Positives = 237/401 (59%), Gaps = 7/401 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK--VADVTRIERVVPTILELVEKKAKV 56
           M + + + DL   ++ G    +R D NVP       + D TRI   +PTI  L +  A+V
Sbjct: 1   MVK-KNVADLKTEELAGKVVFVRSDLNVPQNKETLAITDDTRIRASLPTIQSLTKAGARV 59

Query: 57  VIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILA 116
           V+ SHLGRP+  +DK  SL  V      +L + +    DC+G  + +  A+L +G ++L 
Sbjct: 60  VLTSHLGRPKG-ADKKTSLAPVAKRLSELLGQEVQLAPDCVGDEVQKMKAALQDGQVLLL 118

Query: 117 ENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQK 175
           ENVR++ EEE+ND  F + L+   D Y+NDAF  +HRAHAS  G++    P   G  M+K
Sbjct: 119 ENVRWHPEEEKNDAAFAKQLAEGCDIYVNDAFGTAHRAHASTAGVAAYLSPKVSGFLMKK 178

Query: 176 ELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGV 235
           EL  L    +  KKP  AIVGGSKVS+KI ++  L+ + DKLV+GGGM  +F  AQG+ V
Sbjct: 179 ELDYLVGAVTSPKKPFAAIVGGSKVSSKIGVIEALLGQCDKLVLGGGMIFTFYKAQGLSV 238

Query: 236 GRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIIL 295
           G SL + D  +   ++  +AK    E ++P DVVVA +      ++VV   ++P   + L
Sbjct: 239 GGSLVEEDKLELAKELMEKAKAKGVEFVLPVDVVVADKFAADAESKVVPVSAIPDGWMGL 298

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           DVG ++   I + ++  +TV+WNGP+GVFE   F   T  ++  +A+LT  +   +I GG
Sbjct: 299 DVGPESNALINKALSDCKTVLWNGPMGVFEFPKFAAGTNAISTLLAELTTSKGATTIIGG 358

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           GD++ A+  AG++++ +++ST GGA LE LEGK LPG+  L
Sbjct: 359 GDSVAAVEQAGLADKMSHISTGGGASLELLEGKVLPGVACL 399


>gi|308235743|ref|ZP_07666480.1| phosphoglycerate kinase [Gardnerella vaginalis ATCC 14018]
 gi|311114651|ref|YP_003985872.1| phosphoglycerate kinase [Gardnerella vaginalis ATCC 14019]
 gi|310946145|gb|ADP38849.1| phosphoglycerate kinase [Gardnerella vaginalis ATCC 14019]
          Length = 401

 Score =  359 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 145/402 (36%), Positives = 229/402 (56%), Gaps = 9/402 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++T+ DL D+ G R L+R D+NVP     + D  RI+  +PTI  L E+ AKVV+ +HLG
Sbjct: 1   MKTLKDLGDLSGKRVLVRADFNVPLKGTTITDDGRIKAALPTIKALREQGAKVVLMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ +   + SL  V +    +L  N++   D  G      +A+++ G ++L ENVRF +
Sbjct: 61  RPKGQVVPELSLAPVAARLGELLGVNVVLAADTYGEDAQAKVAAMNNGDVVLLENVRFNA 120

Query: 124 EEE----RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           EE         ++ + ++  G+ +++D F V HRA  S   ++  LP+  G  ++KE+  
Sbjct: 121 EETSKDASERAEYAKKIAALGEVFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L       ++PL  ++GGSKVS K+ ++ NL+ K D+LVIGGGM  +FL A G  VG SL
Sbjct: 181 LSRATENPERPLTVVLGGSKVSDKLGVIENLLSKADRLVIGGGMVFTFLKALGHEVGTSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT---GIPTQVVSAQSVPLDSIILD 296
            + D  + V      AK++  E+++P D+VV          +  +VV A ++P D + LD
Sbjct: 241 LEEDQLEKVKGYIETAKKNGVELVLPTDIVVNAGFPAGDTPVAPEVVPADAIPADKMGLD 300

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  + +     I  ++TV+WNGP+GVFE+  F   T  VA  +   TK     +I GGG
Sbjct: 301 IGPDSQKLFHDKIVDSKTVVWNGPMGVFEVAEFAAGTRAVAQGLVDATK-NGTFTIVGGG 359

Query: 357 DTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           D+ +A+ + G   + F+++ST GGA LE+LEGK LPG+  L 
Sbjct: 360 DSASAVRNLGFPEDGFSHISTGGGASLEFLEGKTLPGLSVLE 401


>gi|15219412|ref|NP_178073.1| PGK (PHOSPHOGLYCERATE KINASE); phosphoglycerate kinase [Arabidopsis
           thaliana]
 gi|30699430|ref|NP_849907.1| PGK (PHOSPHOGLYCERATE KINASE); phosphoglycerate kinase [Arabidopsis
           thaliana]
 gi|4835754|gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs
           gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140,
           gb|T46295, gb|H37082, gb|T46076, gb|N37132, gb|AA597649,
           gb|AI100648 and gb|Z48462 come from this gene
           [Arabidopsis thaliana]
 gi|7839393|gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gi|13194782|gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gi|17065574|gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gi|30725646|gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gi|332198141|gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gi|332198142|gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
          Length = 401

 Score =  359 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 163/400 (40%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   ++VV
Sbjct: 1   MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  ND IG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY+EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHASTEGVAKFLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+  VD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 240 SSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398


>gi|298505740|gb|ADI84463.1| phosphoglycerate kinase [Geobacter sulfurreducens KN400]
          Length = 398

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 238/400 (59%), Gaps = 6/400 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFS 60
             +R ++++ +++  +  +RVD+NVP  + + + + TRI  V+PTI   ++  AKVV+ S
Sbjct: 1   MAIRYIDEISELKDKKVFIRVDFNVPLDEHQNITEDTRIRAVLPTINFALDAGAKVVLAS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +     S+         +L K +L   DCIGS + Q I ++  G II+ ENVR
Sbjct: 61  HLGRPKGERKPKYSMAPAAKRLSRLLGKEVLLAPDCIGSEVRQMIDAMKSGDIIMLENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSM 179
           FY  EE+ND +F R L+   + Y+NDAF+VSHRAHAS+  ++   P    G  M+ E++ 
Sbjct: 121 FYEGEEKNDENFARELANGCEIYVNDAFAVSHRAHASVEAITKFFPVVAAGFLMKNEMNY 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
            E    +  +PLVAI+GG+KVS K+ +L +L+ KVDK++IGGGMA +FL A G  VG+SL
Sbjct: 181 FEKAMQKPIRPLVAILGGAKVSGKLEVLESLLNKVDKIIIGGGMAFTFLKALGYNVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +       +A+    +  +P D V A        T+V + Q +P + + LD+G 
Sbjct: 241 VEEDLIETARSTYAKAREKGIKFYLPVDCVAADRFNPEAETKVTTIQEIPEEWMALDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            TV    + +  A+T++WNGP+GVFE++ F R T  +   VA        ++I GGGDT 
Sbjct: 301 ATVALFTEALQSAKTIIWNGPMGVFEMDAFSRGTFAMVTAVA----NSYALTIVGGGDTD 356

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +A+  AG   + +Y+ST GGAFLE LEGK LPGI  L  +
Sbjct: 357 SAVHRAGEYAKISYISTGGGAFLELLEGKKLPGIKVLEEN 396


>gi|189501440|ref|YP_001960910.1| phosphoglycerate kinase [Chlorobium phaeobacteroides BS1]
 gi|238692299|sp|B3EQD1|PGK_CHLPB RecName: Full=Phosphoglycerate kinase
 gi|189496881|gb|ACE05429.1| Phosphoglycerate kinase [Chlorobium phaeobacteroides BS1]
          Length = 397

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 160/398 (40%), Positives = 245/398 (61%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFS 60
              +++ D+   +G R L+RVD+NVP  +   + +  RI   +P+I +++E   ++++ S
Sbjct: 1   MEKKSLYDIS-CKGSRVLMRVDFNVPLDEHAHITNDKRIIEALPSIHKIIEDGGRLILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K   + SL  V      +L  +++   DCIG+   Q   +L +G I+L EN+R
Sbjct: 60  HLGRPKGKVVPELSLEPVAKRLSELLDTSVVMAGDCIGTEAMQQALALQDGEIMLLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITG-LSHLLPSYIGRAMQKELSM 179
           F+ EEE+NDP+F R L+  G+ Y+NDAF  +HRAHAS  G   ++ PS  G  ++KEL  
Sbjct: 120 FHPEEEKNDPEFARELASMGEIYVNDAFGTAHRAHASTEGICHYVQPSVAGFLIEKELKY 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L    +  ++P VAI+GG+K+S KI +L NL  KVD ++IGG M  +F  AQG+ VG+SL
Sbjct: 180 LGQALNNPERPFVAILGGAKISGKIDVLENLFNKVDTVLIGGAMIFTFFKAQGLSVGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  +    +   AK     +++P DV+ A E      T  V    +P + + LD+G 
Sbjct: 240 VEDDKVELARHLLQTAKERKINMLLPEDVIAASEFSGDAETMAVPVGGIPENMMGLDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT++   + I  A+TV+WNGP+GVFEIEPF + T+ +A  +A  T  +  ISI GGGD+ 
Sbjct: 300 KTIDTFSREILAAKTVVWNGPMGVFEIEPFAKGTIAIAQALADAT-AKGTISIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+  AG+++  T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 359 AAVMKAGLASGITHISTGGGASLEFLEGKELPGITALN 396


>gi|225848311|ref|YP_002728474.1| phosphoglycerate kinase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643736|gb|ACN98786.1| phosphoglycerate kinase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 399

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 158/396 (39%), Positives = 241/396 (60%), Gaps = 7/396 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D+ D+ G R  +RVD+NVP  + G + D  RI   +PTI  L+++ AK+++ SHLGR
Sbjct: 7   TLKDV-DVSGKRVFVRVDYNVPLDEYGNIVDDVRIRETIPTINYLLDRNAKIILASHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K D   SL+ V    E +L K + F+ DCIG  + + + ++ EG IIL EN+RF+ E
Sbjct: 66  PKGKPDPKYSLYPVAKRLERLLGKEVKFLPDCIGKEVEEVVFNMKEGDIILLENLRFHKE 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKELSMLESC 183
           EE NDPDF + L+   + Y+ DAF   HR H+S+ G+   +    +G  +++EL      
Sbjct: 126 EETNDPDFAKKLASLAEIYVIDAFGTCHRKHSSVYGIKDFIQPVVMGFLLERELEYFRKA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA +GGSKVS+K+ ++  L+ KVDK+ IGG MA +F+ A G  VG SL + D
Sbjct: 186 LLNPQRPVVAFLGGSKVSSKLGVIEFLIDKVDKIFIGGAMAFTFIKAMGYNVGSSLVEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             +   +I  +AK+   +  +P D V  + +    P   V  Q +P   + LD+G  ++ 
Sbjct: 246 MLEKALEIIEKAKQKDVKFYLPVDFVCGQAVSDQTPVIEVPWQEIPKGWLGLDIGHASIV 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            IK+++   +T++WNGP+GVFEIE F   T E+AH +A    E   +SIAGGGDT  A+ 
Sbjct: 306 LIKEILKDVQTIVWNGPMGVFEIEKFKMGTFELAHAIA----ESPALSIAGGGDTDYAIH 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            AG+ ++ +Y+ST GGAFLE LEGK LP + A++  
Sbjct: 362 KAGVVDKISYLSTGGGAFLELLEGKQLPCLQAITKK 397


>gi|328955837|ref|YP_004373170.1| phosphoglycerate kinase [Coriobacterium glomerans PW2]
 gi|328456161|gb|AEB07355.1| phosphoglycerate kinase [Coriobacterium glomerans PW2]
          Length = 398

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 158/394 (40%), Positives = 239/394 (60%), Gaps = 5/394 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+ G R L+RVD+NVP  DG V D TR+   +PTI  LVE  A++V+ SHLGR
Sbjct: 6   KTVRDI-DVDGKRVLMRVDFNVPLKDGVVTDDTRVRAAIPTIEYLVEHHARIVLMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P+    +   SL         +   ++ FV+D  G+    ++ +L  G I++ ENVRF  
Sbjct: 65  PKGDGPEPALSLRPAADKLRELTGFDVAFVDDTYGTKAKAAVDALEPGKILVLENVRFDK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E+ NDP+  ++LS  GD ++ DAF  +HRA  S+ G +  LP+  G  ++KE+  L S 
Sbjct: 125 REKSNDPEIAKILSSYGDVFVLDAFGTAHRAQGSVVGPAAYLPAVAGFLLEKEVDTLTSI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           F+E  +P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G  VG SL + D
Sbjct: 185 FAEPARPFVAIVGGSKVSSKIGVLDHLIDAADTLIIGGGMAYTFFMAKGCTVGTSLKEED 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++   A+    +I++P D VVA         +VV +  +P D + +D+G +T +
Sbjct: 245 WVERAAEMLKRAESKGVKILLPLDNVVADHFGEDATGEVVDSDKIPDDRMGMDIGPETEK 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + IA A+TV WNGP+GVFE++ F   T  VA  VA  T      SI GGGD++ A+ 
Sbjct: 305 LYARAIAAAKTVFWNGPMGVFEMDQFAHGTEAVAEAVASNTA---CTSIIGGGDSVAAVN 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
             G++++ +++ST GGA +E +EGK LPG+ AL 
Sbjct: 362 KFGLADKMSWISTGGGASMELVEGKALPGVEALE 395


>gi|225573528|ref|ZP_03782283.1| hypothetical protein RUMHYD_01721 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039104|gb|EEG49350.1| hypothetical protein RUMHYD_01721 [Blautia hydrogenotrophica DSM
           10507]
          Length = 401

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 141/406 (34%), Positives = 235/406 (57%), Gaps = 12/406 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  DGK+ D  R+   +PTI +LV    KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLKDGKITDENRLVAALPTIKKLVADGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G+    ++  + +G ++L EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADPEVVGANAKAAVEGMKDGDVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   + ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKELASLCEVFVNDAFGTAHRAHCSNVGVTEYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +      +P VAI+GG+KV+ K+ ++ NL++K D L+IGGGMA +FL AQG  +G+
Sbjct: 180 DFLGNAVENPTRPFVAILGGAKVADKLNVISNLLEKCDTLIIGGGMAYTFLKAQGKEIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKT----GIPTQVVSAQSVPLDSI 293
           SL      D   ++  +AK+   ++++P D  VA +        I   VVS  ++P D  
Sbjct: 240 SLVDDSKIDYCKEMMEKAKKLGKKLLLPVDTTVAADFPNPIDAPIEVSVVSVDAIPADME 299

Query: 294 ILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIA 353
            +D+G +T +     +  A+TV+WNGP+GVFE       T+ VA  +A    E    +I 
Sbjct: 300 GMDIGTETAKLYADAVKSAKTVVWNGPMGVFENPILAAGTIAVAKALA----ETDATTII 355

Query: 354 GGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGGD+  A+   G  ++ +++ST GGA LE+LEGK+LPG+ A +  
Sbjct: 356 GGGDSAAAVNQLGFGDKMSHISTGGGASLEFLEGKELPGVAAANDK 401


>gi|157363860|ref|YP_001470627.1| phosphoglycerate kinase [Thermotoga lettingae TMO]
 gi|166987818|sp|A8F5X9|PGK_THELT RecName: Full=Phosphoglycerate kinase
 gi|157314464|gb|ABV33563.1| Phosphoglycerate kinase [Thermotoga lettingae TMO]
          Length = 397

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 162/401 (40%), Positives = 250/401 (62%), Gaps = 8/401 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M +L T+ D+ D+     ++RVD+NVP   DGKV+D TRI   +PTI   VEKKAKV++ 
Sbjct: 1   MKKL-TIKDI-DLSNKAVIMRVDFNVPIGKDGKVSDDTRITAALPTIKYAVEKKAKVILL 58

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+   D   SL  +    ++I   N++FV   +G  + +++ ++  G ++L EN 
Sbjct: 59  SHLGRPKGSFDPKYSLKPIAEHLKNISGLNVIFVPHVVGEEVKEAVKNMKVGDVLLLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+  EE+ND +  +  +   D ++NDAF  +HRAHAS  G+++ +PS  G  M+KE+  
Sbjct: 119 RFHPGEEKNDQELAKAWAELADIHVNDAFGTAHRAHASNVGIANFIPSVAGFLMEKEIDF 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     E   P V ++GG+KVS KI ++ NL+ K DKL+IGG M  +FL AQG+ VG SL
Sbjct: 179 LNKVTYEPDHPYVVVLGGAKVSDKIGVITNLLNKADKLLIGGAMMFTFLKAQGLKVGSSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVG 298
            + D  D   QI  +AK    EI++P D +VA++++ G+  +    +  +    + LD+G
Sbjct: 239 VENDKLDLAKQILEQAKEKKVEIVLPVDAIVAQKIEAGVEKKTADLKDGIDDGWMGLDIG 298

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT++  ++ +  A+TV+WNGP+GVFEIE F   T  VA  +AK+    +  ++ GGGD+
Sbjct: 299 PKTIKVFEEALKNAKTVVWNGPMGVFEIEDFAGGTKAVAEMIAKI----KGTTVIGGGDS 354

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             A+A  G+ + +++VST GGA LE+LEGKDLPGI +++  
Sbjct: 355 AAAVAKFGLESAYSHVSTGGGASLEFLEGKDLPGIRSIADK 395


>gi|82400156|gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
          Length = 482

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 246/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   D++G +  +R D NVP  D + + D TRI   +PTI  L+   AKV+
Sbjct: 77  MAK-KSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRAAIPTIKHLIANGAKVI 135

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   ++  +DCIG  + + + SL EGG++L E
Sbjct: 136 LSTHLGRPKG-VTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVDSLPEGGVLLLE 194

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 195 NVRFYKEEEKNEPEFXKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 254

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 255 LDYLVGAVSTPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 314

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 315 SSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLD 374

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGG
Sbjct: 375 IGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLADLSG-KGVTTIIGGG 433

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK LPG++AL
Sbjct: 434 DSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIAL 473


>gi|167767885|ref|ZP_02439938.1| hypothetical protein CLOSS21_02426 [Clostridium sp. SS2/1]
 gi|317498455|ref|ZP_07956750.1| phosphoglycerate kinase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710214|gb|EDS20793.1| hypothetical protein CLOSS21_02426 [Clostridium sp. SS2/1]
 gi|291560937|emb|CBL39737.1| 3-phosphoglycerate kinase [butyrate-producing bacterium SSC/2]
 gi|316894349|gb|EFV16536.1| phosphoglycerate kinase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 401

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 144/406 (35%), Positives = 241/406 (59%), Gaps = 12/406 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ ++ G + L+R D+NVP  DG++ D  R+   +PTI +L+    KV++ S
Sbjct: 1   MLNKKSVDDI-NVAGKKVLVRCDFNVPLKDGQITDENRLVAALPTIKKLISDGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++A++ +G ++L +N
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADDNVVGDNAKAAVAAMKDGEVVLLQN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKDLASLCDVFVNDAFGTAHRAHCSNVGVTEYVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P+VAI+GG+KV+ K+ ++ NL++K D L+IGGGMA +FL AQG+ VG+
Sbjct: 180 DFLGNAVNNPERPMVAILGGAKVADKLKVIDNLLEKCDTLIIGGGMAYTFLKAQGLEVGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTG----IPTQVVSAQSVPLDSI 293
           SL   +  D   ++  +A++    + +P D  VA          I   VV+A ++P D  
Sbjct: 240 SLVDDEKIDYCKEMMAKAEKLGKNLYLPIDTTVADGFPNPIDAEIEVSVVAADAIPADKE 299

Query: 294 ILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIA 353
            LD+G  T E   + +  A+TV+WNGP+GVFE     + T+ VA  +A    +    +I 
Sbjct: 300 GLDIGPATCEKFAEAVKTAKTVVWNGPMGVFENPILAKGTIAVAQALA----DTDATTII 355

Query: 354 GGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGGD+  A+   G +++ T++ST GGA LE+LEGKDLPG+VA +  
Sbjct: 356 GGGDSAAAVNQLGFADKMTHISTGGGASLEFLEGKDLPGVVAANDK 401


>gi|295398241|ref|ZP_06808286.1| phosphoglycerate kinase [Aerococcus viridans ATCC 11563]
 gi|294973500|gb|EFG49282.1| phosphoglycerate kinase [Aerococcus viridans ATCC 11563]
          Length = 397

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 162/405 (40%), Positives = 242/405 (59%), Gaps = 14/405 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M++ +T+ D+ D++G   L R D+NVP   D K+ D  RI + +PTI  ++E+  ++V+F
Sbjct: 1   MAK-KTVKDI-DLKGKVVLERADFNVPMDKDLKITDDNRIVQALPTIEYILEQGGRLVLF 58

Query: 60  SHLGRPQSKSDK-DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAEN 118
           SHLG+ +++ DK   SL  V       L K + FV    G  L  +IA+L +G +++ EN
Sbjct: 59  SHLGKVKTEEDKASKSLRPVAERLSEKLGKEVTFVAQTRGQELEDAIANLKDGEVLMFEN 118

Query: 119 VRFY----SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQ 174
            RF      +E +NDP+  +  +  GD ++NDAF  +HR HAS  G+S  + +  G  M+
Sbjct: 119 TRFEDVDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISKNIEAVAGFLME 178

Query: 175 KELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMG 234
           KE+  L    +E K+P VAI+GG+KVS KI+++ +L+ K DK++IGGGMA +F+ AQG  
Sbjct: 179 KEIQFLGDAVNEPKRPFVAILGGAKVSDKISVIESLLNKADKVLIGGGMAYTFMKAQGYE 238

Query: 235 VGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSII 294
           VG SL + D       +   A      +++P D VVA        T VV    +P D   
Sbjct: 239 VGGSLLEEDKIPLAKDLMERAGD---RLVLPVDFVVADAFDNDANTDVVDVDGIPADWQS 295

Query: 295 LDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAG 354
           LDVG KTVEY  + +A A+TV+WNGP+GVFE+  F + T  V   +A LT      +I G
Sbjct: 296 LDVGPKTVEYYAEQVADAKTVVWNGPMGVFEMPSFAKGTNGVGEAIANLT---DATTIIG 352

Query: 355 GGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGD+  A    G++++FT++ST GGA LE+LEGK+LPGI A++  
Sbjct: 353 GGDSAAAAYQLGLADKFTHISTGGGASLEFLEGKELPGIAAIANK 397


>gi|288959351|ref|YP_003449692.1| phosphoglycerate kinase [Azospirillum sp. B510]
 gi|288911659|dbj|BAI73148.1| phosphoglycerate kinase [Azospirillum sp. B510]
          Length = 397

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 198/398 (49%), Positives = 276/398 (69%), Gaps = 1/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+   T++DL ++ G   L+R D NVP  DGKV+D TRI+R+ PT+ EL  K AKVV+ S
Sbjct: 1   MTDFNTIDDL-EVSGKTVLVRADLNVPMQDGKVSDTTRIDRLAPTLKELSAKGAKVVVLS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP++  D   SL  V+    + + + + F  DC+G    ++IA + EG I+L EN R
Sbjct: 60  HFGRPKNGPDAKNSLRNVLDALSAAVGQKVAFAEDCVGEKAREAIAKVHEGAIVLLENTR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++EEE+NDP F + ++  GD Y+NDAFS +HRAHAS  G++ LLP+  GR M+ EL  L
Sbjct: 120 FHAEEEKNDPAFAKEMAALGDLYVNDAFSAAHRAHASTEGVARLLPNAAGRLMEAELKAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                + ++P+ A+VGG+K+STK+ LL N+V+KVD LV+GGGMAN+FL AQG+ VG SLC
Sbjct: 180 TLALEKPERPVAAVVGGAKISTKLELLGNMVRKVDLLVLGGGMANTFLFAQGIDVGASLC 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           ++D +D    I   AK + CEI++P+D VVA+E K G   +VV+  ++  D + LDVG  
Sbjct: 240 EKDMADQARAIMATAKEANCEILLPKDFVVAKEFKAGAANRVVAFDAIGSDEMALDVGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TVE++   +  A+T++WNGPLG FEI+PFD  T  VA  VA  T+   ++S+AGGGDT+ 
Sbjct: 300 TVEFLGVKLQGAKTIVWNGPLGAFEIQPFDAGTNAVAGLVAARTEAGGLLSVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           ALAHAG  ++FTYVS AGGAFLEWLEGK+LPG+ AL+ 
Sbjct: 360 ALAHAGAEDKFTYVSAAGGAFLEWLEGKELPGVAALAK 397


>gi|183221463|ref|YP_001839459.1| phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911550|ref|YP_001963105.1| phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|238687778|sp|B0SB21|PGK_LEPBA RecName: Full=Phosphoglycerate kinase
 gi|238687850|sp|B0SSU3|PGK_LEPBP RecName: Full=Phosphoglycerate kinase
 gi|167776226|gb|ABZ94527.1| Phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779885|gb|ABZ98183.1| Phosphoglycerate kinase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 396

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 153/395 (38%), Positives = 250/395 (63%), Gaps = 5/395 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
            +L  + + ++++G R  +RVD+NVP  +GK  D TRIE+ +PT+  L+ K AK+++ SH
Sbjct: 1   MKLPLLEE-QNLKGKRVFVRVDFNVPVENGKATDRTRIEKTLPTLELLISKGAKIILGSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+   +   S+  V  +   ++   + F    IGS + +   +L EG I+L EN+RF
Sbjct: 60  LGRPKGGPEPKYSMKPVFDVLSELVKTKVSFSESVIGSDVVKMTNALGEGEILLLENLRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + EEE N   F + L++  D Y+NDAF  +HRAHAS  G++HLLP++ G  M+KE+ +L 
Sbjct: 120 HKEEEENVASFCKELAKLADVYVNDAFGTAHRAHASTEGVAHLLPAFAGLLMRKEIEVLS 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              ++ ++P VAIVGGSKVS+K  +L NL++KVD L+IGGGMA +FL ++ + VG+SL +
Sbjct: 180 GLLAKPERPFVAIVGGSKVSSKFAILKNLLEKVDHLLIGGGMAYTFLKSRAVPVGKSLVE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            +F     Q+   A     ++ +P D ++A        T+ V    +    + +D+G KT
Sbjct: 240 PEFESQAFQLIDRAGIQGVDLQIPVDHIIADAFDPNAKTKSVDKMGIIDGWMGMDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           ++   + I  A+T++WNGP+GVFE++ F + T+E+A  ++K     +  ++ GGGD+I A
Sbjct: 300 IDNYVKAIKDAKTILWNGPMGVFEMDKFSKGTIEIAKAISK----SKAKTVVGGGDSIAA 355

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++++ T++ST GGA LE+LEG+ LPG+  L
Sbjct: 356 VNKAGVADKITHISTGGGASLEFLEGRTLPGVQCL 390


>gi|300934505|ref|ZP_07149761.1| phosphoglycerate kinase [Corynebacterium resistens DSM 45100]
          Length = 403

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 142/406 (34%), Positives = 221/406 (54%), Gaps = 14/406 (3%)

Query: 2   SRLRTMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
             ++T+ DL +  + G   L+R D NVP  DG++ D  RI+  VPT+  L++  A+VV+ 
Sbjct: 1   MAVKTVQDLINEGVEGRHVLVRADLNVPLKDGEITDPGRIDASVPTLKALLDAGARVVVA 60

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +HLGRP+ +++ + SL  V       L + +    D  G    +    L++G I+L ENV
Sbjct: 61  AHLGRPKGEANPEFSLEPVAEALAERLDQWVPLAADVTGEDAHERANGLNDGDILLLENV 120

Query: 120 RFYSEEERNDPDFVRMLS-------RNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRA 172
           RF + E   +       +        +   +++D F V HRA AS+  ++  LP Y G  
Sbjct: 121 RFDARETSKNESEREEFAAELAALTADNGAFVSDGFGVVHRAQASVYDVAKKLPHYAGGL 180

Query: 173 MQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQG 232
           ++ EL +L+       KP   ++GGSKVS K+ ++  L  KVD L+IGGGM  +FL  QG
Sbjct: 181 VETELEVLKKVSENPAKPYAVVLGGSKVSDKLGVIEALAPKVDNLIIGGGMCFTFLKVQG 240

Query: 233 MGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDS 292
             VG SL Q D    +       +R    I++P+DVV A +       +VV   S+P + 
Sbjct: 241 HEVGGSLLQEDM---LDTCRDLLERFGDVIVLPKDVVAAEKFDKDAEHKVVDLDSIPAEW 297

Query: 293 IILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISI 352
           + LD+G ++V+   +++A ++TV WNGP+GVFE   F   T  VA  +   TK     S+
Sbjct: 298 MGLDIGPESVKAFAEILANSKTVFWNGPMGVFEFPAFAEGTRGVAEAIIGATK-NGAFSV 356

Query: 353 AGGGDTITALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            GGGD+  A+   G+  + F+++ST GGA LE+LEGK+LPG+  L 
Sbjct: 357 VGGGDSAAAVRTLGLGEDGFSHISTGGGASLEFLEGKELPGVAVLE 402


>gi|309811838|ref|ZP_07705612.1| phosphoglycerate kinase [Dermacoccus sp. Ellin185]
 gi|308434259|gb|EFP58117.1| phosphoglycerate kinase [Dermacoccus sp. Ellin185]
          Length = 398

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 147/398 (36%), Positives = 230/398 (57%), Gaps = 6/398 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +++++DL D+RG   LLR D NVP     + D  RI   VPTI EL +  A+VV+ +HLG
Sbjct: 1   MKSISDLGDLRGKTVLLRSDLNVPLDGSTITDDGRIRASVPTIQELTKAGARVVVVAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + +   SL  VV     +L +++ F  D +G +   ++ SL +G + L EN+RF  
Sbjct: 61  RPKGEPEAKYSLQPVVGRLSELLGQDVAFATDTVGDSARSTVESLGDGDVALLENLRFNV 120

Query: 124 EEER----NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E          F   L+   D +++D F V HR  AS+  ++ LLPS +G  ++ E+ +
Sbjct: 121 GETSKDEAERKKFAEQLASLADVFVSDGFGVVHRKQASVYDVAQLLPSAMGGLVKTEVEV 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L+      K+P   ++GG+KV+ K+ ++ NL++  D+L+IGGGM  +FL A+G  VG+SL
Sbjct: 181 LKQLTENPKRPYAVVLGGAKVADKLAVIENLMQTADRLLIGGGMVFTFLAAEGHEVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
              +  + V     +AK    EI++P DVVVA E       +VVS  ++P D + LD+G 
Sbjct: 241 LDTEQIETVKGYIAKAKELGVEIVLPSDVVVAPEFAADKGHEVVSIDAIPADQMGLDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ +     +   +TV WNGP+G FE+EPF   T  VA  + + T E   +++ GGGD+ 
Sbjct: 301 ESAKLYASKLTDCKTVFWNGPMGAFEMEPFAAGTKAVAQALVEAT-ENGALTVVGGGDSA 359

Query: 360 TALAHAGI-SNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
            A+   G   ++F ++ST GGA LE+LEGK+LPGI  L
Sbjct: 360 AAVRQLGFSDDQFGHISTGGGASLEYLEGKELPGISVL 397


>gi|241668150|ref|ZP_04755728.1| phosphoglycerate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876685|ref|ZP_05249395.1| phosphogylcerate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|169742979|gb|ACA66112.1| phosphoglycerate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842706|gb|EET21120.1| phosphogylcerate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 392

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 230/400 (57%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D+   R L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLENKRVLVRVDFNVPIKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I+ K + F  D +    +++      G I++ +NVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAEALSQIIKKPVRFAKDWLNGVDAKA------GEIVMCDNVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F   E+++D +  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNKGEKKSDDELSKKIASLGDVFVMDAFATAHRAQASTYGVAKYVPVACAGLLLANEIKA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+VAIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  +G SL
Sbjct: 174 LEKALKAPKKPMVAIVGGSKVSTKLSVLHNLLDKVEILIVGGGIANTFIKAEGFNIGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D       I  +AK     I VP DV VA+E        V +   V  D +ILD+G 
Sbjct: 234 YEEDLVGEAKDILAKAKELGVNIPVPVDVRVAKEFSENAVAVVKNVADVADDEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+   I  ++  A T++WNGP+GVFE + F   T  ++  +A    E    S+AGGGDTI
Sbjct: 294 KSERNIAALLKSANTILWNGPVGVFEFDNFAEGTKALSLAIA----ESDAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+    I ++ +Y+STAGGAFLE+LEGK LP +  L   
Sbjct: 350 AAIEKFDIKDKVSYISTAGGAFLEFLEGKKLPAVEILKEK 389


>gi|190893316|ref|YP_001979858.1| phosphoglycerate kinase [Rhizobium etli CIAT 652]
 gi|190698595|gb|ACE92680.1| phosphoglycerate kinase protein [Rhizobium etli CIAT 652]
          Length = 418

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 215/397 (54%), Positives = 282/397 (71%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL DI G R L+RVD NVP  DGKV D TRIERV PTILEL E  AKV++ +
Sbjct: 19  MPAFKTLDDLTDISGKRVLVRVDLNVPVKDGKVTDTTRIERVAPTILELSENGAKVILLA 78

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+     D SL  +    E +L   +   +DC G   + ++A++++G I+L EN R
Sbjct: 79  HFGRPKDGPSPDLSLSLIAPSVEEVLDHAVATASDCTGEAAAAAVAAMNDGDILLLENTR 138

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDPDF + L+ NGD Y+NDAFS +HRAHAS  GL+H LP+Y GR MQ EL  L
Sbjct: 139 FHKGEEKNDPDFTKALAANGDIYVNDAFSAAHRAHASTEGLAHHLPAYAGRTMQAELEAL 198

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTKI LL+NLVKKVD LVIGGGMAN+F+ A+G  VG+SLC
Sbjct: 199 EKGLGAPVRPVVAIVGGAKVSTKIDLLMNLVKKVDALVIGGGMANTFIAARGTNVGKSLC 258

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D ++   QI  EA  + C II+P D VVARE K G  ++ V   ++P D+++LD+G K
Sbjct: 259 EHDLAETAKQIMIEAATAGCAIILPEDGVVAREFKAGAASETVDINAIPADAMVLDLGPK 318

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           +VE I   I +A T++WNGPLG FEIEPFD ATV  A Y A+ T   ++ S+AGGGDT++
Sbjct: 319 SVEAINAWIERAATLVWNGPLGAFEIEPFDTATVAAAKYAAERTAAGKLTSVAGGGDTVS 378

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL HAG++++FTYVSTAGGAFLEW+EGK+LPG+  L+
Sbjct: 379 ALNHAGVADDFTYVSTAGGAFLEWMEGKELPGVAVLN 415


>gi|303280229|ref|XP_003059407.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459243|gb|EEH56539.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 406

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 156/395 (39%), Positives = 242/395 (61%), Gaps = 7/395 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ DL+  D++G    +R D NVP    K+ D TRI   +PT+  LV+  AKV++ SHL
Sbjct: 13  KSVGDLKEADLKGKTVFIRCDLNVPLDGAKITDDTRIRAAIPTLEYLVKNGAKVLVTSHL 72

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +    L  V      +L  ++  ++DC+G  +  +IA +  G + L ENVRFY
Sbjct: 73  GRPKDGPEDKFRLTPVGDRLAELLDCSVTKIDDCVGDVVKDAIAGMENGSVCLLENVRFY 132

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLE 181
            +EE+N  DF + L+ + D Y+NDAF  +HRAHAS  G++    PS  G  +QKEL  L+
Sbjct: 133 KDEEKNGADFAKQLAEHADLYVNDAFGTAHRAHASTAGVTEFLSPSVAGFLLQKELDYLD 192

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
              S  ++P  AIVGGSKVS+KI ++ +L++K DK+++GGGM  +F  A G  VG SL +
Sbjct: 193 GAVSNPERPFCAIVGGSKVSSKIGVIESLLEKTDKIILGGGMIFTFYKALGKSVGSSLVE 252

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D   ++  +A++   +I++P DVVVA        TQ VS   +P   + LD+G  +
Sbjct: 253 DDKIDLAKELMAKAEKKGVKILLPTDVVVADAFAADAKTQTVSVDDIPEGWMGLDIGPDS 312

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           V+  +  + + ++V+WNGP+GVFE++ F + T  +A  +A L      I+I GGGD++ A
Sbjct: 313 VKSFQDELNECKSVIWNGPMGVFEMDAFAKGTFAIADTLANL----DGITIIGGGDSVAA 368

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +  AG++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 369 VEKAGLADKMSHISTGGGASLELLEGKVLPGVAAL 403


>gi|187735910|ref|YP_001878022.1| Phosphoglycerate kinase [Akkermansia muciniphila ATCC BAA-835]
 gi|229620031|sp|B2UKW8|PGK_AKKM8 RecName: Full=Phosphoglycerate kinase
 gi|187425962|gb|ACD05241.1| Phosphoglycerate kinase [Akkermansia muciniphila ATCC BAA-835]
          Length = 403

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 164/405 (40%), Positives = 245/405 (60%), Gaps = 11/405 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++L T+ DL D +G   L+RVD+NVP  DG++ +  RI   +PTI  L+++ A++V+ S
Sbjct: 1   MAKL-TVRDL-DAKGKEVLMRVDFNVPLKDGEITNDARIVAALPTIKFLLDQGARLVLTS 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+++ D   SL  V +    +L K++ FV+  IG     + A++ +G ++L ENVR
Sbjct: 59  HLGRPKNEPDPAFSLKPVAARLSELLGKDVKFVSAAIGPEAEAARAAMKDGDVVLLENVR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSM 179
           FY  E++NDP+F + L  N   ++NDAF  +HRAHAS  G++H    S +G  +++EL  
Sbjct: 119 FYPGEKKNDPEFAKSLLGNATLFVNDAFGTAHRAHASTEGVTHFAEKSAMGFLIERELEY 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      +KP V I+GG+KVS KI +L  L++K D  +IGG MAN+FL A+G  +G S 
Sbjct: 179 LEGKLENPEKPFVVIMGGAKVSDKIEVLSKLMEKADTFLIGGAMANTFLAAEGYDLGASK 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV----SAQSVPLDSIIL 295
            + D  D   +I   AK    + ++P DV VA + + G  T           VP   + +
Sbjct: 239 IEGDKLDLAREILAAAKAKGVKFLLPADVRVAMKFEDGAETFCTAPFAEGGKVPEGGMAI 298

Query: 296 DVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGG 355
           D+G K +E    +I  A+TV+WNGP+GVFE++ F + T EVA  +A  T     ISI GG
Sbjct: 299 DIGDKAIEEFSAIIKDAKTVLWNGPMGVFEMDCFAKGTKEVAEALADST----AISIVGG 354

Query: 356 GDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC 400
           GD++TA     + ++ ++ ST GGA LE LEGK LPG+ AL+  C
Sbjct: 355 GDSVTAAKKFKVQDKLSFCSTGGGASLELLEGKVLPGVGALTDKC 399


>gi|49474688|ref|YP_032730.1| phosphoglycerate kinase [Bartonella quintana str. Toulouse]
 gi|81695988|sp|Q6FYN4|PGK_BARQU RecName: Full=Phosphoglycerate kinase
 gi|49240192|emb|CAF26658.1| Phosphoglycerate kinase [Bartonella quintana str. Toulouse]
          Length = 397

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 195/395 (49%), Positives = 281/395 (71%), Gaps = 1/395 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              RT++D+ D+ G R L+RVD+NVP   GKV D TR++R   T+LEL ++ AK+++ SH
Sbjct: 1   MGFRTLDDV-DVTGKRVLVRVDFNVPMSQGKVCDETRLKRHKETLLELQKRGAKLILLSH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
            GRP+ + + + SL  VV + E I+++ + F  DC+G     +I +L  GG++L ENVRF
Sbjct: 60  CGRPKGQGEPEFSLRPVVRVLEKIINQPVAFAPDCVGVAAQTAIEALQNGGLLLLENVRF 119

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           +  EE+ND  F   L+ NGD Y+NDAFSVSHRAHAS+ G++HLLPSY GR++Q EL  LE
Sbjct: 120 HPGEEKNDCSFAEALAHNGDLYVNDAFSVSHRAHASVEGITHLLPSYAGRSLQCELQALE 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 K+P+VA+VGG+KVS+K+ +L +LV+KVD LVIGGGMANSFL AQG+ +G+SLC+
Sbjct: 180 KGLDNPKRPVVALVGGAKVSSKLFVLNHLVEKVDYLVIGGGMANSFLAAQGVHIGKSLCE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
                 + ++  +A+   C +++P D VV    + G P ++     +P D +ILD+G ++
Sbjct: 240 HALMQTIKKVIEKAQEYQCTLLLPVDAVVGFRFEKGAPHRLYDIGDIPDDGMILDIGTRS 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           + +I +VI +A T++WNGPLGVFE+ PFD+ T+ VA + A+ +   + +SIAGGGDT+ A
Sbjct: 300 IAHINEVIDKAATLVWNGPLGVFEMSPFDQGTIAVARHAAECSLTGKCVSIAGGGDTVFA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           L HAG++N+FTY+STAGGAFLEW+EGK LPGI AL
Sbjct: 360 LNHAGVANDFTYLSTAGGAFLEWMEGKVLPGIFAL 394


>gi|227496087|ref|ZP_03926393.1| phosphoglycerate kinase [Actinomyces urogenitalis DSM 15434]
 gi|226834321|gb|EEH66704.1| phosphoglycerate kinase [Actinomyces urogenitalis DSM 15434]
          Length = 397

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 156/401 (38%), Positives = 230/401 (57%), Gaps = 10/401 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           ++T+  L D+RG R L+R D+NVP   +  + D  RI+  +PT+  L+E  AKV+I +HL
Sbjct: 1   MKTIESLGDLRGKRVLVRSDFNVPLDAEKNITDDGRIQAALPTLKTLLEAGAKVIIVAHL 60

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+ + + D SL  V      +    +    D +G +   ++A L++G I+L ENVRF 
Sbjct: 61  GRPKGQVNPDFSLAPVAKRLAEVTGVKVTLAEDTVGESAKAAVAGLADGEIVLLENVRFN 120

Query: 123 SEEERN----DPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           + E          F + L+   D +++D F V HR  AS+  ++ +LP+  G  + KE+ 
Sbjct: 121 AAETSKDDVERQAFAKELASLADVFVSDGFGVVHRKQASVYDVAQILPAAAGLLVGKEIE 180

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L    ++ ++P   ++GGSKVS K+ ++ NL+ K D+L+IGGGMA +FL AQG  VG S
Sbjct: 181 SLSKAVNDPERPYTVVLGGSKVSDKLGVIANLLGKADRLLIGGGMAFTFLAAQGYEVGTS 240

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L ++D  D V      AK    E++VP DVVVA E K   P  VV A S+P + + LD+G
Sbjct: 241 LLEKDQIDTVKGYLATAKDKGVELLVPVDVVVAPEFKADAPATVVDADSIPAEQMGLDIG 300

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            KT     + IA ++TV+WNGP+GVFE   F   T  VA  ++    +    S+ GGGD+
Sbjct: 301 PKTQALYAEAIATSKTVVWNGPMGVFEFPAFAAGTKAVAQAIS----DSEAFSVIGGGDS 356

Query: 359 ITALAHAGISNE-FTYVSTAGGAFLEWLEGKDLPGIVALSG 398
             A+   G     F+++ST GGA LE LEGK LPGI  L G
Sbjct: 357 AAAVRTLGFDESTFSHISTGGGASLELLEGKTLPGISVLEG 397


>gi|225872303|ref|YP_002753758.1| phosphoglycerate kinase [Acidobacterium capsulatum ATCC 51196]
 gi|254782182|sp|C1F1M9|PGK_ACIC5 RecName: Full=Phosphoglycerate kinase
 gi|225794517|gb|ACO34607.1| phosphoglycerate kinase [Acidobacterium capsulatum ATCC 51196]
          Length = 404

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 166/409 (40%), Positives = 240/409 (58%), Gaps = 15/409 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPF-IDG-KVADVTRIERVVPTILELVEKKAKVVI 58
           MS+L ++ DL D+      +RVD+NVP   DG ++ D TRI   +PTI   +  KAK+++
Sbjct: 1   MSKL-SIRDL-DLAHKHVFMRVDFNVPLSEDGSEITDDTRIRETLPTIEYALRHKAKLIL 58

Query: 59  FSHLGRPQSKSDKDCSLFKVVSIAESILHKNIL------FVNDCIGSTLSQSIASLSEGG 112
            SHLGRP+ K +   SL  VV    ++L  ++       F  DC+G    +    L  G 
Sbjct: 59  ASHLGRPKGKVNPKYSLRPVVDRLRTLLDHDVTSRVNVAFSPDCVGDVAKELSLQLESGQ 118

Query: 113 IILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGR 171
           ++L EN+RF++EEE NDP+F R L+   + Y+NDAF  +HRAHAS  G++H    S  G 
Sbjct: 119 VLLLENLRFHAEEEANDPEFARKLASLCEIYVNDAFGSAHRAHASTEGITHFVKQSAAGL 178

Query: 172 AMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQ 231
            M+KEL  L        KP VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +FL +Q
Sbjct: 179 LMEKELEYLGKALEAPAKPFVAIIGGAKVSDKIKVIDNLLNKVDALLIGGGMAYTFLKSQ 238

Query: 232 GMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPL 290
           G  VG+SL + D  D       +AK      ++P D ++A +      TQ        P 
Sbjct: 239 GQDVGKSLVEADKLDIAKAALDKAKEKGVRFLLPVDHILADKFAADAATQTFEGTGAFPA 298

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
           + + LD+G K++E   + IA A T++WNGP+GVFE+  F + T  VA  VA        +
Sbjct: 299 EWMALDIGPKSIELFTKEIAAADTIVWNGPMGVFEMPAFAKGTTAVAQAVADNV---DAV 355

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           SI GGGD++ A+  AG++++  ++ST GGA LE+LEGK LPG+ AL+  
Sbjct: 356 SIIGGGDSVAAVKQAGVADKIKHISTGGGASLEFLEGKKLPGVEALTEK 404


>gi|312131696|ref|YP_003999036.1| phosphoglycerate kinase [Leadbetterella byssophila DSM 17132]
 gi|311908242|gb|ADQ18683.1| phosphoglycerate kinase [Leadbetterella byssophila DSM 17132]
          Length = 396

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 152/397 (38%), Positives = 226/397 (56%), Gaps = 3/397 (0%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +RT++   D  G + L+RVD+NVP  +  ++ D TRI+  +PTI +++     V++ SHL
Sbjct: 1   MRTVDSF-DFAGKKALVRVDFNVPLNERFEITDDTRIKATIPTIRKILADGGSVILMSHL 59

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+    +  SL  +V+    IL  ++ F +DC+G    +  ASL  G ++L EN+RFY
Sbjct: 60  GRPKDGPTEKYSLKHIVTPLSLILGVSVKFADDCVGEQAKEQAASLQPGEVLLLENLRFY 119

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASI-TGLSHLLPSYIGRAMQKELSMLE 181
            EEE+ D  F + L+  GD ++NDAF  +HRAHAS             G+ MQ E+    
Sbjct: 120 KEEEKGDVQFAQKLAELGDVWVNDAFGTAHRAHASTAVIGQFFTDKICGKVMQAEIDNAR 179

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                ++KP  AI+GG+K+S KI ++  L+ KVD L+IGGGM  +F  A G  +G+SL +
Sbjct: 180 HILENAEKPFTAIMGGAKISDKILIIERLLDKVDNLIIGGGMTYTFTKALGGNIGKSLLE 239

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D  D    I  +AK    ++ +P D V A       P    +   +P D   LD+G KT
Sbjct: 240 ADKLDLALSILEKAKEKGVKVYMPLDNVAADSFSNEAPRATYATGEIPDDKEGLDIGPKT 299

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +E    V+A ++T++WNGP+GVFE   F   T  +A  V K T +    S+ GGGD+  A
Sbjct: 300 IELFSSVVASSKTILWNGPMGVFEFPNFAIGTNAIAEAVVKATDDNNAFSLIGGGDSAAA 359

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           + +AG  +  +YVST GGA LE++EGK LPG+ AL  
Sbjct: 360 INNAGYGDRVSYVSTGGGALLEYMEGKTLPGVAALEN 396


>gi|332184444|gb|AEE26698.1| Phosphoglycerate kinase [Francisella cf. novicida 3523]
          Length = 392

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 152/400 (38%), Positives = 230/400 (57%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I+ K + F  D +          +  G I++ ENVR
Sbjct: 60  LGRPIEGEYDPQFSLEPVAEALSQIIKKPVRFAKDWLDGV------DVKAGEIVMCENVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F + E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNNGEKKSAEDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGMLLANEIHA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 174 LEKALKAPKKPMAAIVGGSKVSTKLSVLYNLLDKVEILIVGGGIANTFIKAEGYNVGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D       I  +AK     I VP DV VA+E              V  D +ILD+G 
Sbjct: 234 YEQDLVAEARDILSKAKTLGVNIPVPVDVRVAKEFSENAQAITKKVSDVAADEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 294 ESEKRIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 350 AAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEK 389


>gi|309790824|ref|ZP_07685368.1| Phosphoglycerate kinase [Oscillochloris trichoides DG6]
 gi|308227111|gb|EFO80795.1| Phosphoglycerate kinase [Oscillochloris trichoides DG6]
          Length = 383

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 152/381 (39%), Positives = 232/381 (60%), Gaps = 4/381 (1%)

Query: 20  LRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKV 78
           +RVD+NVP  + G + D TRI   +PTI  L+E+ A VV+ SHLGRP+ K +   S+  V
Sbjct: 1   MRVDFNVPQDEQGAITDDTRIRAALPTIRYLLEEGASVVLMSHLGRPKGKINPKYSMRPV 60

Query: 79  VSIAESILH--KNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRML 136
           V     +L     +       G     + ASL  G +++ EN RF + EE+NDPD    L
Sbjct: 61  VERLFELLPEATEVKKTEAITGPAAEAAAASLRPGQVLMLENTRFDAREEKNDPDMSAEL 120

Query: 137 SRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVG 196
           +R GD ++NDAF  +HRA+AS  G++H L    G  ++KEL+ +       ++P V I+G
Sbjct: 121 ARLGDIFVNDAFGAAHRANASTEGVAHHLEGVAGFLLEKELAFIGGALENPERPFVTIIG 180

Query: 197 GSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAK 256
           G+K+S KI ++ NL+ KV+ L+IGGGMAN+FL+AQG  +G+SL + D  D    +  +A+
Sbjct: 181 GAKISDKIGVIENLLGKVNTLLIGGGMANTFLLAQGKAMGKSLVEPDSLDLARSLMAKAE 240

Query: 257 RSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVM 316
            +   +++P D V+A        TQVV   ++P    +LD+G ++ +     +  A+TV+
Sbjct: 241 AAGTRLMLPVDAVLADAFSATANTQVVPVDAIPDGWQMLDIGPESAKLYAAEVVAAKTVI 300

Query: 317 WNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVST 376
           WNGP+GVFE+ PF + T  VA  +A  +  +  I+I GGGD++ A+  AG +++ ++VST
Sbjct: 301 WNGPMGVFEMAPFAKGTFAVAQAMADAS-AQGAITIIGGGDSVAAIEQAGFADKMSHVST 359

Query: 377 AGGAFLEWLEGKDLPGIVALS 397
            GGA LE LEGK LPG+ AL+
Sbjct: 360 GGGASLELLEGKILPGVAALA 380


>gi|296126590|ref|YP_003633842.1| phosphoglycerate kinase [Brachyspira murdochii DSM 12563]
 gi|296018406|gb|ADG71643.1| Phosphoglycerate kinase [Brachyspira murdochii DSM 12563]
          Length = 399

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 156/402 (38%), Positives = 252/402 (62%), Gaps = 12/402 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFID---GKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           +T+ D+ DI+G + ++RVD+NVP       K+ D TR++  +PTI  ++ + A +++ SH
Sbjct: 3   KTVKDI-DIKGKKVIMRVDFNVPLDKETSSKITDTTRVDAAMPTIEYILSQGACLILMSH 61

Query: 62  LGRPQSKSDKDCSLFKVVSIAESI-LHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP+ + +   SL  V    ++   +  + F  DCIG  + +  + L  G ++L EN+R
Sbjct: 62  LGRPKGEPNPKYSLKPVYDYLKTKLPNNKVEFAKDCIGEEVKKQASELKAGDVLLLENLR 121

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL---SHLLPSYIGRAMQKEL 177
           +++EEE+NDP F + L+   D Y+NDAF  +HRAHAS  G+      +P+  G  M+KE+
Sbjct: 122 YHAEEEKNDPAFSKQLADLADVYVNDAFGTAHRAHASTAGIVSAKAGMPAVAGFLMEKEI 181

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L    +   +P VAI+GG+KVS+KI++L NL+ KVD L++ GGMA +FL AQG+ +G 
Sbjct: 182 KYLGDAVANPARPFVAIIGGAKVSSKISVLKNLLNKVDTLIVVGGMAYTFLKAQGLEIGS 241

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SLC+ D+     +I  +AK     + +P D V+A +       +VV + ++P   + +DV
Sbjct: 242 SLCEDDYISTAKEIMDKAKELNKTLYLPVDNVIADKFDNDANIKVVDSNAIPAGWMGMDV 301

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT++ ++ ++  A+TV+WNGPLGVFE+  F + T EVA ++A        +SI GGGD
Sbjct: 302 GPKTLKELEDILKNAKTVVWNGPLGVFEMSNFAKGTFEVAKFIA----NSDCVSIIGGGD 357

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +++A+  +G++++ T+VST GGA LE+LEG +LPGI  L   
Sbjct: 358 SVSAVNKSGVADKMTHVSTGGGASLEFLEGIELPGIAVLQDK 399


>gi|293192773|ref|ZP_06609668.1| phosphoglycerate kinase [Actinomyces odontolyticus F0309]
 gi|292820020|gb|EFF79018.1| phosphoglycerate kinase [Actinomyces odontolyticus F0309]
          Length = 396

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 153/399 (38%), Positives = 227/399 (56%), Gaps = 9/399 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT++ L D+RG R L+R D+NVP  DG + D  RI   +PT+  L +  AKVVI +HLG
Sbjct: 1   MRTISTLGDLRGKRVLVRSDFNVPLKDGVITDDGRIRAALPTLKTLTDAGAKVVIMAHLG 60

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+ + D   SL  V +    +    +   +D +G + ++++A+L EG I L ENVR+ +
Sbjct: 61  RPKGQVDPAFSLAPVATRLAELSGVKVTLASDVVGPSATETVAALGEGEIALLENVRYDA 120

Query: 124 EEERNDPDFVRMLSRNG----DFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
            E     +    L+R      D +++D F V HR  AS+  ++ +LPS  G  + KE+  
Sbjct: 121 RETSKVDEEREELAREYAKLGDAFVSDGFGVVHRKQASVYDIAKILPSAAGLLVLKEIES 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++P   ++GGSKVS K+ ++ NL+KK D L IGGGMA +FL AQG  VG+SL
Sbjct: 181 LSKVTGDPERPYGVVLGGSKVSDKLGVIANLLKKADMLFIGGGMAFTFLAAQGHSVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  + V     EA     ++++P DVVVA E     P  VV   ++P D + LD+G 
Sbjct: 241 LEEDQIETVKGYIAEAAERGVDLVLPIDVVVAPEFAADAPATVVKVDAIPDDQMGLDIGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ +     +A A+TV WNGP+GVFE + F   T  VA  ++       + S+ GGGD+ 
Sbjct: 301 ESAKLFADKLATAKTVAWNGPMGVFEFDAFAGGTRAVAEALST----GSMFSVIGGGDSA 356

Query: 360 TALAHAGISNE-FTYVSTAGGAFLEWLEGKDLPGIVALS 397
            A+   G     F+++ST GGA LE LEGK LPGI  L 
Sbjct: 357 AAVRLLGFDENTFSHISTGGGASLELLEGKVLPGIAVLE 395


>gi|332678626|gb|AEE87755.1| Phosphoglycerate kinase [Francisella cf. novicida Fx1]
          Length = 392

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 233/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I++K + F  D +          +  G I++ ENVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGV------DVKAGEIVMCENVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F S E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNSGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTNEIQA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 174 LEKALKLPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFIKAEGFDVGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D      +I  +AK     I VP DV VA+E        +     V  D +ILD+G 
Sbjct: 234 YEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSDVAADEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 294 ESEKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 350 AAIEKFGIKDKVSYISTAGGAFLEFLEGKKLPAIEILKEK 389


>gi|302780079|ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gi|300160113|gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
          Length = 472

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 161/406 (39%), Positives = 248/406 (61%), Gaps = 13/406 (3%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL+  D++G R  +R D NVP   D K+ D TRI   VPTI  L+   AKV+
Sbjct: 61  MAK-KSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNGAKVI 119

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKN------ILFVNDCIGSTLSQSIASLSEG 111
           + SHLGRP+  +DK   L  +V     +L         +   +D IG  + + +A+L +G
Sbjct: 120 LSSHLGRPKGVTDK-YRLTPLVPRLSELLGIKASLFSQVEKADDSIGPEVEKKVAALPDG 178

Query: 112 GIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIG 170
           G++L ENVRFY EEE+N P+  + L+   D Y+NDAF  +HRAHAS  G++    PS  G
Sbjct: 179 GVLLLENVRFYPEEEKNVPEHAQKLAALADLYVNDAFGTAHRAHASTEGVTKFLKPSVAG 238

Query: 171 RAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVA 230
             +QKEL  L+   S  K+P  AIVGGSKVS+KI ++ +L++K + L++GGGM  +F  A
Sbjct: 239 FLLQKELDYLDGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCNILLLGGGMIFTFFKA 298

Query: 231 QGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPL 290
           QG+ VG SL + D  D    +   AK     +++P DVVVA +      +++V + ++P 
Sbjct: 299 QGLSVGSSLVEEDKIDLAKSLMKTAKDKGVSLLLPTDVVVADKFAADANSKIVPSTAIPD 358

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
             + LD+G  +V+   + +   +TV+WNGP+GVFE + F   T  VA  +A+L+  + + 
Sbjct: 359 GWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSG-KGVT 417

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +I GGGD++ A+   G++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 418 TIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVAAL 463


>gi|163796403|ref|ZP_02190363.1| Phosphoglycerate kinase [alpha proteobacterium BAL199]
 gi|159178253|gb|EDP62797.1| Phosphoglycerate kinase [alpha proteobacterium BAL199]
          Length = 397

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 197/397 (49%), Positives = 270/397 (68%), Gaps = 1/397 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT+ D  ++ GLR L+R+D NVP  DG+V D TRIER  PT+ EL EK AKVV+ S
Sbjct: 1   MAAFRTL-DQVEVAGLRVLVRLDLNVPMKDGRVTDATRIERAAPTVKELAEKGAKVVVVS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+ K D   SL  +     + + + + F +DCIG + + ++  L++GG+ L EN+R
Sbjct: 60  HYGRPKGKPDPTMSLKPLADPLAAAVGRPVAFADDCIGPSATATVGDLADGGVALLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE NDP+F   L+   D Y+NDAFS +HRAHASI G++ L P+Y GR MQ EL  L
Sbjct: 120 FHAGEEANDPEFAAALANLCDLYVNDAFSAAHRAHASIDGVARLRPAYAGRLMQTELDAL 179

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P+ A+VGG+KVSTK+ LL NLV++VD L IGGGMAN+FL AQG+ VG SL 
Sbjct: 180 GRALESPTRPVAAVVGGAKVSTKLDLLGNLVERVDVLAIGGGMANTFLFAQGIEVGASLA 239

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           +RD +D    I  +A+   C++++  DVV+A ++  G+ T VV   +VP  ++ILDVG  
Sbjct: 240 ERDLADTAWAILQKAEAKGCDVLLAIDVVIADKLAPGVVTTVVGVDAVPSGAMILDVGPA 299

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  + + +A  RT++WNGPLG FE  PFD  T  +A   A+LT + R++++AGGGDT+ 
Sbjct: 300 TVAAMSERLAACRTLVWNGPLGAFETAPFDAGTNALAKAAAELTDQGRLLTVAGGGDTVA 359

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           ALAHAG+   F+YVSTAGGAFLEWLEGKDLPG+  L 
Sbjct: 360 ALAHAGVLERFSYVSTAGGAFLEWLEGKDLPGVAVLK 396


>gi|254368907|ref|ZP_04984920.1| phosphogylcerate kinase [Francisella tularensis subsp. holarctica
           FSC022]
 gi|157121828|gb|EDO65998.1| phosphogylcerate kinase [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 392

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 233/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I++K + F  D +          +  G I++ ENVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGV------DVKAGEIVMCENVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F S E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNSGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTNEIQA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 174 LEKALKSPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFIKAEGFDVGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D      +I  +AK     I VP DV VA+E        +     V  D +ILD+G 
Sbjct: 234 YEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSYVVADEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 294 ESQKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 350 AAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEK 389


>gi|7288201|gb|AAF45020.1|AF108451_1 phosphoglycerate kinase precursor [Phaeodactylum tricornutum]
          Length = 441

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 243/397 (61%), Gaps = 3/397 (0%)

Query: 6   TMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ DL D  ++G + L+R D NVP    K+ D TRI   +PTI  L  K A V + SHLG
Sbjct: 45  SIEDLSDAELKGKKVLVRCDVNVPLDGKKITDDTRIRSSIPTIEYLKNKGAIVSVCSHLG 104

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL         +L + +    DCIG  +++ +    EG +I+ EN RFY 
Sbjct: 105 RPKDGPEDKFSLGPCAERMGELLGQTVTLAPDCIGEEVAKIVNDAKEGDVIMLENTRFYK 164

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLES 182
           EE +NDP+FV  L+   D Y+NDAF  +HRAHAS  G++    PS  G  + KEL  L+ 
Sbjct: 165 EETKNDPEFVEKLAAPFDLYVNDAFGTAHRAHASTEGVTKFLKPSVGGFLLAKELEYLDG 224

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S  KKP+ AIVGGSKVS+KIT+L  L+ K DK++IGGGM  +FL A+G  VG SL + 
Sbjct: 225 AISNGKKPMAAIVGGSKVSSKITVLEALLDKCDKVIIGGGMVFTFLKAKGFNVGTSLVED 284

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           DF D   ++  +A++   EI++P D+V+A +      T+VVSA+ +P   + LD G +T 
Sbjct: 285 DFVDTAKEVLAKAEKLGKEILLPIDIVIADKFDAEAETKVVSAEEIPDGWMGLDNGPETT 344

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              K+ ++  +T++ NGP+GVFE E F + T ++ + +A L+K++  I+I GGGD++ A 
Sbjct: 345 AQQKEALSDCKTIIMNGPMGVFEFEKFAKGTFDLVNILADLSKDKGAITIIGGGDSVAAT 404

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             +G + + +++ST GGA LE LEGK LPG+ AL+  
Sbjct: 405 EQSGRAGDMSHISTGGGASLELLEGKVLPGVAALNDK 441


>gi|21536853|gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
          Length = 401

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 162/400 (40%), Positives = 246/400 (61%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G    +RVD NVP  D   + D TRI   VPTI  L+   ++VV
Sbjct: 1   MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+       SL  +V     +L   ++  ND IG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY+EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  MQKE
Sbjct: 120 NVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L+  VD L++GGGM  +F  AQG+ VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 240 SSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE + F   T  VA  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSG-KGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE +EGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELIEGKPLPGVLAL 398


>gi|302781120|ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gi|300159801|gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
          Length = 412

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 161/406 (39%), Positives = 248/406 (61%), Gaps = 13/406 (3%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL+  D++G R  +R D NVP   D K+ D TRI   VPTI  L+   AKV+
Sbjct: 1   MAK-KSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNGAKVI 59

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKN------ILFVNDCIGSTLSQSIASLSEG 111
           + SHLGRP+  +DK   L  +V     +L         +   +D IG  + + +A+L +G
Sbjct: 60  LSSHLGRPKGVTDK-YRLTPLVPRLSELLGIKASLFSQVEKADDSIGPEVEKKVAALPDG 118

Query: 112 GIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIG 170
           G++L ENVRFY EEE+N P+  + L+   D Y+NDAF  +HRAHAS  G++    PS  G
Sbjct: 119 GVLLLENVRFYPEEEKNVPEHAQKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPSVAG 178

Query: 171 RAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVA 230
             +QKEL  L+   S  K+P  AIVGGSKVS+KI ++ +L++K + L++GGGM  +F  A
Sbjct: 179 FLLQKELDYLDGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCNILLLGGGMIFTFYKA 238

Query: 231 QGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPL 290
           QG+ VG SL + D  D    +   AK     +++P DVVVA +      +++V + ++P 
Sbjct: 239 QGLSVGSSLVEEDKIDLAKSLMRTAKDKGVSLLLPTDVVVADKFAADANSKIVPSTAIPD 298

Query: 291 DSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRII 350
             + LD+G  +V+   + +   +TV+WNGP+GVFE + F   T  VA  +A+L+  + + 
Sbjct: 299 GWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSG-KGVT 357

Query: 351 SIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +I GGGD++ A+   G++++ +++ST GGA LE LEGK LPG+ AL
Sbjct: 358 TIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVAAL 403


>gi|257125094|ref|YP_003163208.1| phosphoglycerate kinase [Leptotrichia buccalis C-1013-b]
 gi|257049033|gb|ACV38217.1| Phosphoglycerate kinase [Leptotrichia buccalis C-1013-b]
          Length = 400

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 153/405 (37%), Positives = 246/405 (60%), Gaps = 11/405 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M++ +T+ DL D++G + L+RVD+NVP  DG + +  RI   +PT+  ++E   KV+ FS
Sbjct: 1   MAK-KTLKDL-DVKGKKVLVRVDFNVPIKDGVITNDNRITAALPTLKYILENGGKVIAFS 58

Query: 61  HLGRPQSKSDK-DCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           HLG+ + ++DK   +L  V    E +L K + F+ +  G+ L  ++A L +G I++ EN 
Sbjct: 59  HLGKVKEEADKASKTLAPVAKRLEELLGKPVKFIPETRGAELEAAVAELKDGEILMFENT 118

Query: 120 RFY----SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQ 174
           RF      +E +NDP+  +  +  GD ++NDAF  +HRAHAS  G+ S++  S +G  ++
Sbjct: 119 RFEDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVGIASNIKDSAVGFLVE 178

Query: 175 KELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMG 234
           KE+  +       ++PLVAI+GG+KVS KI ++ NL+ K DK++IGGGM  +FL A+G  
Sbjct: 179 KEIEFIGGAVDNPERPLVAILGGAKVSDKIGVIENLLDKADKVIIGGGMMFTFLKAEGKN 238

Query: 235 VGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSII 294
            G SL + D  +    +  +AK    E+++P D VVA+E K     + VS   +    + 
Sbjct: 239 TGSSLLEADKVELAASLIKKAKEKNVELLLPIDTVVAKEFKNDTEFKTVSVDDIEDGWMG 298

Query: 295 LDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAG 354
           LD+G  +++     +  A+TV+WNGP+GVFE+E F + T+ V   +A+L       +I G
Sbjct: 299 LDIGEASIKLFSDALVGAKTVVWNGPMGVFEMENFAKGTIGVCKAIAEL---SGAKTIIG 355

Query: 355 GGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGD+  A    G +++F+++ST GGA LE+LEGK LPG+ A+S  
Sbjct: 356 GGDSAAAAIQLGFADKFSHISTGGGASLEYLEGKVLPGVDAISEK 400


>gi|238917118|ref|YP_002930635.1| phosphoglycerate kinase [Eubacterium eligens ATCC 27750]
 gi|238872478|gb|ACR72188.1| phosphoglycerate kinase [Eubacterium eligens ATCC 27750]
          Length = 402

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 153/402 (38%), Positives = 244/402 (60%), Gaps = 8/402 (1%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G R L R D+NVP    ++ D TR+   +PTI +L+    KV++ S
Sbjct: 6   MLNKKSIDDI-NVKGKRVLCRCDFNVPLDGSRITDETRLVAALPTIKKLIADGGKVILCS 64

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+   D   SL  V      +L + + F  D   +G     ++A++++G +IL EN
Sbjct: 65  HLGKPKG-PDAAFSLAPVAKRLSELLGQEVKFAADDTVVGDNARAAVAAMNDGDVILLEN 123

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            RF  EE +N   F + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 124 TRFRPEETKNGEAFSKDLASIADVFVNDAFGTAHRAHCSNVGVTQFVDTAVVGYLMQKEI 183

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +   +P VAI+GGSKVS+KI+++ NL+ KVD L+IGGGM+ +F  A G  VG+
Sbjct: 184 DFLGNAVNNPVRPFVAILGGSKVSSKISVINNLLDKVDTLIIGGGMSYTFQKAHGGNVGK 243

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDV 297
           SL + D+ D   ++  +A+    ++++P D VVA+E     P+ VV A     D + +D+
Sbjct: 244 SLVEDDYLDFAKEMMKKAEEKGVKMLIPIDTVVAKEFSNDSPSHVVEAGHQADDDMGMDI 303

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G KT E  K+ +  A+TV+WNGP+GVFE   F   T+ VA  +A+L   +   +I GGGD
Sbjct: 304 GPKTCELYKEALKDAKTVVWNGPMGVFEFPNFAAGTIAVAEELAQL---KDATTIIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           +  A+ + G  ++ T++ST GGA LE+LEGK+LPG+VA +  
Sbjct: 361 SAAAVNNLGFGDKMTHISTGGGASLEFLEGKELPGVVAANDK 402


>gi|323483829|ref|ZP_08089207.1| phosphoglycerate kinase [Clostridium symbiosum WAL-14163]
 gi|323402851|gb|EGA95171.1| phosphoglycerate kinase [Clostridium symbiosum WAL-14163]
          Length = 401

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 136/402 (33%), Positives = 235/402 (58%), Gaps = 12/402 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  +GK+ D  R+   +PTI +L+    +V++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLVRCDFNVPLKEGKITDENRLVAALPTIKKLIGDGGRVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V      +L + + F  D   +G     ++  + +G ++L EN
Sbjct: 60  HLGKPKGEPKPELSLAPVAVRLSELLGQEVKFAADPEVVGPNAKAAVDGMKDGDVVLLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKEL 177
            R+ +EE +N   F + L+   + Y++DAF  +HRAH S  G++  +    +G  MQKE+
Sbjct: 120 TRYRAEETKNGEAFSKDLASLCEIYVDDAFGTAHRAHCSNVGVTQYVSEAAVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +   +P VAI+GG+KV+ K+ ++ NL++K D L+IGGGMA +FL AQG  +G+
Sbjct: 180 DFLGNAVNNPVRPFVAILGGAKVADKLNVISNLLEKCDTLIIGGGMAFTFLKAQGKEIGK 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRD----VVVAREMKTGIPTQVVSAQSVPLDSI 293
           SL      +   ++  +A++   ++++P D    V     +   I  Q VS  ++P D++
Sbjct: 240 SLVDDTKLEYCREMVEKAEKLGKKLLLPVDAAVAVSFPNPIDAPIDIQYVSVDAIPADTM 299

Query: 294 ILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIA 353
            LD+G +T +     +  A+TV+WNGP+GVFE     + T+ VA  +A    E    +I 
Sbjct: 300 GLDIGTETAKLYADAVKSAKTVVWNGPMGVFENPVLAKGTIAVAEALA----ETEATTII 355

Query: 354 GGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVA 395
           GGGD+  A+   G  ++ +++ST GGA LE+LEGK+LPG+ A
Sbjct: 356 GGGDSAAAVNQLGFGDKMSHISTGGGASLEFLEGKELPGVAA 397


>gi|266621570|ref|ZP_06114505.1| phosphoglycerate kinase [Clostridium hathewayi DSM 13479]
 gi|288866765|gb|EFC99063.1| phosphoglycerate kinase [Clostridium hathewayi DSM 13479]
          Length = 404

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 146/404 (36%), Positives = 229/404 (56%), Gaps = 14/404 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL  ++G + L+R D+NVP  DG + +  RI+  +PTI +L+++ AKV++ S
Sbjct: 1   MLNKKTVDDLTGLQGKKVLVRCDFNVPLKDGVIQNYNRIDGAIPTIKKLLDQGAKVILCS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V       L   + FV+D    G    +  A L +G ++L +N
Sbjct: 61  HLGKPKGEPLPEMSLAPVAPALSERLGVEVKFVDDPKVTGPETQKVAAELKDGEVLLLQN 120

Query: 119 VRFYSEEERNDPD-----FVRMLSR-NGDFYINDAFSVSHRAHASITG-LSHLLPSYIGR 171
            R+  EE +   D     + + L+      ++NDAF  +HRAH S  G   +   + +G 
Sbjct: 121 TRYRIEETKYGKDENAEGYAKELADLCDGIFVNDAFGTAHRAHCSNVGVTKYTTTNVVGY 180

Query: 172 AMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQ 231
            M+KE+  L        +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  AQ
Sbjct: 181 LMEKEIKFLGQAVENPVRPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMAYTFEKAQ 240

Query: 232 GMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLD 291
           G  +G SLC+ D  D   ++  +A+    ++++P D V  RE       +VV    +   
Sbjct: 241 GEEIGNSLCEEDKLDYALEMIKKAEEKGVKLLLPVDHVEGREFSNDTERKVVDV--IDAG 298

Query: 292 SIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIIS 351
               D+G KT+   K  +  A+TV+WNGP+GVFE   F   T+EV   VA L   +   +
Sbjct: 299 WSGFDIGPKTIALYKAALEGAKTVVWNGPMGVFEFSNFAEGTLEVCRAVADL---QDATT 355

Query: 352 IAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVA 395
           + GGGD++ A+   G +++ T++ST GGA LE+LEGK+LPG+ A
Sbjct: 356 VIGGGDSVNAVKRLGFADKMTHISTGGGASLEFLEGKELPGVAA 399


>gi|147918735|ref|YP_687542.1| 3-phosphoglycerate kinase [uncultured methanogenic archaeon RC-I]
 gi|110622938|emb|CAJ38216.1| 3-phosphoglycerate kinase [uncultured methanogenic archaeon RC-I]
          Length = 403

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 156/400 (39%), Positives = 249/400 (62%), Gaps = 7/400 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID--GKVADVTRIERVVPTILELVEKKAKVVIF 59
             ++T+ND+ D+   R LLRVD+NVP     G + D TRI   +PTI  L++  AKV+I 
Sbjct: 1   MPIKTVNDI-DVTSKRVLLRVDFNVPMEKSGGGIRDDTRIRVCLPTIRYLLDHHAKVIIC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLGRP+ K D+   +  V      +L + +  + +C+G  + + ++S+++G ++L EN+
Sbjct: 60  SHLGRPKGKIDETLRMTPVARRLSELLGQPVKSLKECVGPEVEKVVSSMNDGDVVLLENL 119

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RFY  EE+NDP+F + L+R  D ++NDAF  SHRAHAS+ G+++ LPS  G  M+KE++ 
Sbjct: 120 RFYPGEEKNDPEFAKGLARLADVFVNDAFGASHRAHASVVGVTNYLPSVAGFLMEKEVTS 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++P  A++GG+KVS K+ +L N+V  VD L+IGGGM  +FL ++G  VG+SL
Sbjct: 180 LGGLLEKPERPFAAVIGGAKVSDKLDVLDNIVPDVDVLIIGGGMTATFLKSRGNRVGKSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D    V  ++ +AK     +++P DVVV+  +     ++ VS   +P    I D+G 
Sbjct: 240 VEDDKIQYVRDLSEQAKSHDVRLLLPTDVVVSPSLDGTSESRTVSVSDIPDGWFIGDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           +T+      ++  +TV WNGP+GVFE+E F   T E+A  +A+L      + + GGG T+
Sbjct: 300 QTIAEYTGALSGCKTVFWNGPMGVFEVEQFATGTREIASTIARL----DAVKVVGGGSTV 355

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   G++++ T+VST GGA LE++ GK LPG+ AL  +
Sbjct: 356 EAVTRLGVADQMTHVSTGGGATLEFISGKQLPGVKALEEN 395


>gi|222055980|ref|YP_002538342.1| phosphoglycerate kinase [Geobacter sp. FRC-32]
 gi|254782204|sp|B9M2C3|PGK_GEOSF RecName: Full=Phosphoglycerate kinase
 gi|221565269|gb|ACM21241.1| Phosphoglycerate kinase [Geobacter sp. FRC-32]
          Length = 399

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 157/398 (39%), Positives = 236/398 (59%), Gaps = 5/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFS 60
             +  +++++D+R     +RVD+NVP  D G + + TRI   VPTI   +E  AKV++ S
Sbjct: 1   MSILYIDEIKDLREKLVFIRVDFNVPQDDNGNITEDTRIVGAVPTIKYAIENGAKVILAS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +     ++         +L K +    DC G  +   +A+L  G +++ ENVR
Sbjct: 61  HLGRPKGEKKPKYTMAPAARRLSELLGKEVKQATDCFGPDVDAMVAALQPGDVLMLENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKELSM 179
           FY  EE+NDPDF   L+   + Y+NDAF+VSHRAHAS+  ++  +P    G  M+ E++ 
Sbjct: 121 FYPGEEKNDPDFACKLANGCEIYVNDAFAVSHRAHASVHAITKCIPVIAAGFLMKNEMTF 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
            E   +   +PL AI+GG+KVS K+ +L  LV KVD ++IGGGMA +FL A+G+ VG+SL
Sbjct: 181 FEKAMTRPVRPLAAILGGAKVSGKLEVLETLVGKVDIIIIGGGMAFTFLKARGLSVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D  D   +I   A +   E ++P D VVA         + VS   +P + + LDVG 
Sbjct: 241 VEDDLIDTAKRILDNAAKRGIEFLLPEDCVVADRFAADADCKTVSVNDIPSEWMALDVGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            +       + +A TV+WNGP+GVFE++ F + T  +A  VA L   +   +I GGGDT 
Sbjct: 301 ASTARFSDALKEANTVIWNGPMGVFEMDRFAKGTFAIADVVAGL---KNATTIIGGGDTD 357

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +A+  AG++++ +Y+ST GGAFLE LEGK LPG+  L 
Sbjct: 358 SAVRKAGVADKVSYISTGGGAFLELLEGKKLPGVEVLE 395


>gi|108804826|ref|YP_644763.1| phosphoglycerate kinase [Rubrobacter xylanophilus DSM 9941]
 gi|123069005|sp|Q1AUH7|PGK_RUBXD RecName: Full=Phosphoglycerate kinase
 gi|108766069|gb|ABG04951.1| phosphoglycerate kinase [Rubrobacter xylanophilus DSM 9941]
          Length = 392

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 156/395 (39%), Positives = 243/395 (61%), Gaps = 9/395 (2%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
              R++ DL ++RG + L+RVD+NVP   G+V D TRI R +PTI  L+++ A+V + SH
Sbjct: 1   MDKRSVRDL-ELRGKKVLVRVDFNVPVKGGEVTDDTRIRRALPTIRYLLQRGARVALISH 59

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP+ + D    +  V    E +L + +  ++   G  + +++  L E G+IL EN RF
Sbjct: 60  LGRPKGEPDPRYRMDPVARRLEELLGEPVRKLDTATGPEVGRALEEL-ERGVILLENSRF 118

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           Y  E +NDP F   L+   D Y+NDAF  +HRAHA+  G++  LP+  G  +++EL  L+
Sbjct: 119 YPGETKNDPAFAAELAGPFDLYVNDAFGAAHRAHATTVGVAERLPAAAGFLLEQELDYLD 178

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
                 ++P VAI+GG+KVS K+ ++ +L+   D+L++GG M  +FL A+G+GVG SL +
Sbjct: 179 GVLRSPERPFVAILGGAKVSDKLGVIESLLGVADRLLVGGAMCFTFLKARGLGVGASLVE 238

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D+     ++   A      +++P DVVVA  M+ G  T+ V  + +P   + LD+G +T
Sbjct: 239 DDYLGEARRLMEGAAD---RLVLPVDVVVAERMEEGARTRTVPVEEIPEGWMGLDIGPRT 295

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           VE  ++ I QART+ WNGP+GVFEI+ F R T  VA  VA    E    S+ GGGD++ A
Sbjct: 296 VELFRRHILQARTIFWNGPMGVFEIDAFARGTEGVARAVA----ESGATSVVGGGDSVAA 351

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           +   G+ +  +++ST GGA LE++EG++LPG+  L
Sbjct: 352 VRKLGLEDRMSHISTGGGASLEYVEGRELPGVAVL 386


>gi|219124224|ref|XP_002182409.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217406370|gb|EEC46310.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 441

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 164/397 (41%), Positives = 243/397 (61%), Gaps = 3/397 (0%)

Query: 6   TMNDLRD--IRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           ++ DL D  ++G + L+R D NVP    K+ D TRI   +PTI  L  K A V + SHLG
Sbjct: 45  SIEDLSDAELKGKKVLVRCDVNVPLDGKKITDDTRIRSSIPTIEYLKNKGAIVSVCSHLG 104

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+   +   SL         +L + +    DCIG  +++ +    EG +I+ EN RFY 
Sbjct: 105 RPKDGPEDKFSLGPCAERMGELLGQTVTLAPDCIGEEVAKIVNDAKEGDVIMLENTRFYK 164

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLES 182
           EE +NDP+FV  L+   D Y+NDAF  +HRAHAS  G++    PS  G  + KEL  L+ 
Sbjct: 165 EETKNDPEFVEKLAAPFDLYVNDAFGTAHRAHASTEGVTKFLKPSVGGFLLAKELEYLDG 224

Query: 183 CFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQR 242
             S  KKP+ AIVGGSKVS+KIT+L  L+ K DK++IGGGM  +FL A+G  VG SL + 
Sbjct: 225 AISNGKKPMAAIVGGSKVSSKITVLEALLDKCDKVIIGGGMVFTFLKAKGFNVGTSLVED 284

Query: 243 DFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTV 302
           DF D   ++  +A++   EI++P D+V+A +      T+VVSA+ +P   + LD G +T 
Sbjct: 285 DFVDTAKEVLAKAEKLGKEILLPIDIVIADKFDAEAETKVVSAEEIPDGWMGLDNGPETT 344

Query: 303 EYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITAL 362
              K+ ++  +T++ NGP+GVFE E F + T ++ + +A L+K++  I+I GGGD++ A 
Sbjct: 345 AQQKEALSDCKTIIMNGPMGVFEFEKFAKGTFDLVNILADLSKDKGAITIIGGGDSVAAT 404

Query: 363 AHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
             +G + + +++ST GGA LE LEGK LPG+ AL+  
Sbjct: 405 EQSGRAGDMSHISTGGGASLELLEGKVLPGVAALNDK 441


>gi|303232299|ref|ZP_07318997.1| phosphoglycerate kinase [Atopobium vaginae PB189-T1-4]
 gi|302481622|gb|EFL44684.1| phosphoglycerate kinase [Atopobium vaginae PB189-T1-4]
          Length = 396

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 157/393 (39%), Positives = 241/393 (61%), Gaps = 6/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D++G R L+RVD+NVP  DG V D+TRI++ +PTI  L E  A +V+ SHLGR
Sbjct: 6   KTVRDI-DVKGKRVLMRVDFNVPVKDGVVGDITRIQKAIPTIKYLKEHGAGIVLMSHLGR 64

Query: 65  PQS-KSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           PQ    ++  SL  V    + +    + FV D  G     ++ ++  G I+L ENVRF  
Sbjct: 65  PQGTGYEEALSLAPVAKKLQELSGYEVKFVADTYGDEAEAAVKAVKPGDILLLENVRFLK 124

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            E++NDP+  + L+  GD ++ DAF  +HRA  S+ G S  +P+  G  ++KE+  L S 
Sbjct: 125 AEKKNDPEVAKKLASYGDIFVLDAFGTAHRAQGSVVGPSAYIPAVAGFLLEKEVDTLTSI 184

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
           FSE K+P VAIVGGSKVS+KI +L +L+   D L+IGGGMA +F +A+G  VG SL + D
Sbjct: 185 FSEPKRPFVAIVGGSKVSSKIGVLDHLIDSCDTLIIGGGMAYTFFLAKGYKVGTSLQEPD 244

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
           + +   ++  +A+    +I++P D V+          +VV + ++P D + +D+G KT E
Sbjct: 245 WVERAGEMLKKAEAKGVKILLPVDNVITDHFGEDAKGEVVCSNAIPDDRMGMDIGPKTEE 304

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
                + +A TV WNGP+GVFE++ F   T  VA  +A    +    SI GGGD++ A+ 
Sbjct: 305 LYADAVRKAATVFWNGPMGVFEMDQFAHGTEVVAKAIA----DSSCTSIIGGGDSVAAIN 360

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             G++++ +++ST GGA +E +EGK LPG+ AL
Sbjct: 361 KFGLADKMSWISTGGGASMELVEGKALPGVEAL 393


>gi|56708420|ref|YP_170316.1| phosphoglycerate kinase [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670891|ref|YP_667448.1| phosphoglycerate kinase [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134301591|ref|YP_001121559.1| phosphoglycerate kinase [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|224457569|ref|ZP_03666042.1| phosphoglycerate kinase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254371046|ref|ZP_04987048.1| phosphogylcerate kinase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254875263|ref|ZP_05247973.1| phosphogylcerate kinase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81677029|sp|Q5NF76|PGK_FRATT RecName: Full=Phosphoglycerate kinase
 gi|123359405|sp|Q14GM9|PGK_FRAT1 RecName: Full=Phosphoglycerate kinase
 gi|166987786|sp|A4IWY7|PGK_FRATW RecName: Full=Phosphoglycerate kinase
 gi|56604912|emb|CAG46000.1| phosphogylcerate kinase [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110321224|emb|CAL09383.1| phosphogylcerate kinase [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134049368|gb|ABO46439.1| phosphoglycerate kinase [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151569286|gb|EDN34940.1| phosphogylcerate kinase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254841262|gb|EET19698.1| phosphogylcerate kinase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159609|gb|ADA79000.1| phosphoglycerate kinase [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 392

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 233/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I++K + F  D +          +  G I++ ENVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGV------DVKAGEIVMCENVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F S E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNSGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTNEIQA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 174 LEKALKSPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFIKAEGFDVGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D      +I  +AK     I VP DV VA+E        +     V  D +ILD+G 
Sbjct: 234 YEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSDVVADEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 294 ESQKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 350 AAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEK 389


>gi|182680367|ref|YP_001834513.1| phosphoglycerate kinase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636250|gb|ACB97024.1| Phosphoglycerate kinase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 409

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 187/397 (47%), Positives = 271/397 (68%), Gaps = 1/397 (0%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
           S   T++D+  + G R L+RVD NVP  +G + D TRI+R++P I E+ +K  KV++ SH
Sbjct: 8   SPFPTLDDVV-VTGKRVLVRVDLNVPMDNGIITDATRIDRILPNIKEISQKGGKVILLSH 66

Query: 62  LGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRF 121
           LGRP++  +   SL  V    E  L + + F +DC+G     + ++L EG I+L EN RF
Sbjct: 67  LGRPKNGPEAKTSLKPVAVELERHLGRYVAFASDCVGDVAKSAASALKEGDILLLENTRF 126

Query: 122 YSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
           + +E +NDP FV  L+  GD Y+NDAFS +HRAHA+  GL+H LP+Y GR MQ EL ML 
Sbjct: 127 HPQETKNDPAFVDALAELGDIYVNDAFSTAHRAHATTEGLAHKLPAYAGRTMQLELDMLT 186

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           S  +  ++PL AIVGG+KVSTK+ LL NL+++V+ L IGGGMAN+FL A G  +G+SLC+
Sbjct: 187 SMLAHPERPLAAIVGGAKVSTKLELLGNLMRRVEYLFIGGGMANTFLAASGKPIGKSLCE 246

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            D +D   +I  +A+ + C++++P D +VA +++  IPT+ +   ++  + +ILD+G ++
Sbjct: 247 MDLADVARKIMADAEAAHCQLVLPVDAIVAPKLEANIPTRAIDIDAITENEMILDIGPRS 306

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
           +  I  ++  ART++WNGP+G FE+ PF   T+ +A   A+LTK   + +IAGGGDTI A
Sbjct: 307 ISKIVTLLGSARTLVWNGPVGAFEVPPFHVGTMAIAKVAAQLTKVSALETIAGGGDTIAA 366

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           L  AG  ++FTYVSTAGGAFLEWLEGK LPG+ AL G
Sbjct: 367 LNQAGAYDDFTYVSTAGGAFLEWLEGKLLPGVEALRG 403


>gi|254373262|ref|ZP_04988750.1| phosphogylcerate kinase [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|151570988|gb|EDN36642.1| phosphogylcerate kinase [Francisella novicida GA99-3549]
          Length = 392

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 233/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I++K + F  D +          +  G I++ ENVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGV------DVKAGEIVMCENVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F S E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNSGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTNEIQA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 174 LEKALKSPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFIKAEGFDVGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D      +I  +AK     I VP DV VA+E        +     V  D +ILD+G 
Sbjct: 234 YEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSDVAADEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 294 ESEKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 350 AAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEK 389


>gi|154247005|ref|YP_001417963.1| phosphoglycerate kinase [Xanthobacter autotrophicus Py2]
 gi|259530840|sp|A7IJW3|PGK_XANP2 RecName: Full=Phosphoglycerate kinase
 gi|154161090|gb|ABS68306.1| Phosphoglycerate kinase [Xanthobacter autotrophicus Py2]
          Length = 396

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 198/396 (50%), Positives = 268/396 (67%), Gaps = 2/396 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M+  RT++D  D+   R L+RVD NVP   G+V D TR++ ++PTI  + +K  K V+ +
Sbjct: 1   MTAFRTLDD-ADLADKRVLVRVDLNVPMESGRVTDETRLKAILPTIRTITDKGGKAVLLA 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+   D+  SL  V    E  L + + F +DC+G   S +I+ L+ G +I+ EN R
Sbjct: 60  HFGRPKG-RDESQSLAPVAKALEGQLGRKVAFASDCVGEEASSAISRLAAGEVIVLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F++ EE+N PDFV  L+  GD Y+NDAFS +HRAHAS  GL+  LP+Y GR+M+ EL+ L
Sbjct: 119 FHAGEEKNAPDFVEALASLGDIYVNDAFSAAHRAHASTEGLARKLPAYAGRSMESELAAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
                   +P++A+VGGSKVS+K+ LL NLVKKVD LVI GGMAN+FL A G  VG+SLC
Sbjct: 179 TKALEAPVRPVLAVVGGSKVSSKLELLGNLVKKVDILVIAGGMANTFLAALGKKVGKSLC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + D +D   +I  +AK + CEI++P D VVA+E K     +VVS   V  D +ILD G +
Sbjct: 239 EHDLADTAREILEKAKAAGCEIVLPVDAVVAKEFKANAANRVVSVDEVGDDEMILDAGPE 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           TV  + Q +  A+TV+WNGP G FE+ PFD ATV VA  V K T+   ++S+AGGGDT+ 
Sbjct: 299 TVAVVAQKLDGAKTVVWNGPFGAFEMTPFDAATVAVARDVGKRTRAGTLLSVAGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           AL HAG++ +F+YVSTAGGAFLEWLEGK LPG+ AL
Sbjct: 359 ALNHAGVAGDFSYVSTAGGAFLEWLEGKALPGVEAL 394


>gi|169589440|gb|ACA58084.1| Pgk [Francisella noatunensis]
          Length = 392

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 152/400 (38%), Positives = 230/400 (57%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKNKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I+ K + F  D +    ++       G I++ +NVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAEALSQIIKKPVRFAKDWLNGVDAKV------GEIVMCDNVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F   E+++D +  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G     E+  
Sbjct: 114 FNKGEKKSDDELSKKIASLGDVFVMDAFATAHRAQASTYGVAKYVPVACAGLLSANEIKA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+VAIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  +G SL
Sbjct: 174 LEKALKAPKKPMVAIVGGSKVSTKLSVLHNLLDKVEILIVGGGIANTFIKAEGFNIGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D       I  +AK     I VP DV VA+E        V +   V  D +ILD+G 
Sbjct: 234 YEEDLVGKAKDILAKAKEFGVNIPVPVDVRVAKEFSENAVAVVKNVADVADDEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+   I +++  A T++WNGP+GVFE + F   T  ++  +A    E    S+AGGGDTI
Sbjct: 294 KSERKIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIA----ESDAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+    I ++ +Y+STAGGAFLE+LEGK LP +  L   
Sbjct: 350 AAIEKFDIKDKVSYISTAGGAFLEFLEGKKLPAVEILKEK 389


>gi|225388381|ref|ZP_03758105.1| hypothetical protein CLOSTASPAR_02117 [Clostridium asparagiforme
           DSM 15981]
 gi|225045556|gb|EEG55802.1| hypothetical protein CLOSTASPAR_02117 [Clostridium asparagiforme
           DSM 15981]
          Length = 405

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 144/406 (35%), Positives = 230/406 (56%), Gaps = 16/406 (3%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   +T++DL+D++G + L+R D+NVP  +G + +  RI+  +PTI +L+++ AKV++ S
Sbjct: 1   MLNKKTVDDLKDLQGKKVLVRCDFNVPLKEGVIQNYNRIDGAIPTIKKLLDQGAKVILCS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ +   + SL  V       L   + FV+D    G    +  A L +G ++L +N
Sbjct: 61  HLGKPKGQPLPEMSLAPVAPALSERLGVEVKFVDDPQVTGEETKKVAAELKDGEVLLLQN 120

Query: 119 VRFYSEEERNDPDFVRMLS--------RNGDFYINDAFSVSHRAHASITG-LSHLLPSYI 169
            R+  EE +         +         +G  +++DAF  +HRAH S  G   +   + +
Sbjct: 121 TRYRIEETKYKEGDAATEAYAKELADLCDGGVFVDDAFGTAHRAHCSNVGVTKYTKENVV 180

Query: 170 GRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLV 229
           G  MQKE+  L        +P VAI+GG+KVS KI ++ NL+ KVD L+IGGGMA +F  
Sbjct: 181 GYLMQKEIKFLGQAVENPVRPFVAILGGAKVSDKINVINNLLDKVDTLIIGGGMAYTFAK 240

Query: 230 AQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVP 289
           AQG  +G SLC+ D  D   ++  +A+    ++++P D V  +E       +VV    + 
Sbjct: 241 AQGQEIGNSLCEADKLDYALEMVKKAEEKGVKLLLPVDHVEGKEFSNDTEHKVVDV--ID 298

Query: 290 LDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRI 349
                 D+G KT+E  K  +  A+TV+WNGP+GVFE   F   T+E+   VA+L      
Sbjct: 299 AGWSGFDIGPKTIELYKDALKGAKTVVWNGPMGVFEFSNFAEGTLEICRAVAELA---DA 355

Query: 350 ISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVA 395
            ++ GGGD++ A+   G +++ T++ST GGA LE+LEGK+LPG+ A
Sbjct: 356 TTVIGGGDSVNAVKRLGFADKMTHISTGGGASLEFLEGKELPGVAA 401


>gi|110598566|ref|ZP_01386834.1| Phosphoglycerate kinase [Chlorobium ferrooxidans DSM 13031]
 gi|110339800|gb|EAT58307.1| Phosphoglycerate kinase [Chlorobium ferrooxidans DSM 13031]
          Length = 397

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 162/398 (40%), Positives = 248/398 (62%), Gaps = 4/398 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFI-DGKVADVTRIERVVPTILELVEKKAKVVIFS 60
            + +T++ +  I+G R L+RVD+NVP      + D  RI   +P+I ++++   ++++ S
Sbjct: 1   MQKKTLSSVS-IQGKRILMRVDFNVPLDASKNITDDKRIVESLPSIRKVLDDGGRLILMS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ K + D SL  V      ++   +    D IG+ + Q + ++ +G +IL EN+R
Sbjct: 60  HLGRPKGKVNADFSLAPVAKRLSELIDTPVTMAKDSIGTEVMQQVLAMQDGEVILLENLR 119

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYI-GRAMQKELSM 179
           F+ EEE NDPDF + L+  G+ Y+NDAF  +HRAHAS  G++H + S + G  +++EL  
Sbjct: 120 FHPEEEANDPDFAKELASLGEIYVNDAFGTAHRAHASTEGITHYVQSAVAGFLIERELLY 179

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L     + ++P VAI+GGSK+S KI +L NL KKVD ++IGG M  +F  AQG  VG SL
Sbjct: 180 LGKALQDPERPFVAILGGSKISGKIDVLENLFKKVDTVLIGGAMVFTFFKAQGYEVGNSL 239

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            +    +   +I  EAKR   ++++P DV+VA  +      +     ++P   I +D+G 
Sbjct: 240 VEESKIELALEILAEAKRKGIKLLLPEDVIVAPAISADAEFRTELISAIPEGMIGVDIGP 299

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           KT E   + I  ARTV+WNGP+GVFEI+ F   T+ VA  +A  T  +  I+I GGGD+ 
Sbjct: 300 KTAELYSREILSARTVLWNGPMGVFEIDNFASGTMAVAKALADAT-AKGAITIVGGGDSA 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +A+A AG++ E T++ST GGA LE+LEGK+LPGI AL+
Sbjct: 359 SAIAKAGLAKEITHISTGGGASLEFLEGKELPGIAALN 396


>gi|313585890|gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
          Length = 481

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 161/400 (40%), Positives = 246/400 (61%), Gaps = 7/400 (1%)

Query: 1   MSRLRTMNDL--RDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVV 57
           M++ +++ DL   +++G    +R D NVP  D + + D TRI   VPTI  L+   AKV+
Sbjct: 76  MAK-KSVGDLTAAELKGKNVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVI 134

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + +HLGRP+       SL  +V     +L   ++ V DCIG  + + +ASL EGG++L E
Sbjct: 135 LSTHLGRPKG-VTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLE 193

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKE 176
           NVRFY EEE+N+P+F + L+   D Y+NDAF  +HRAHAS  G++    PS  G  +QKE
Sbjct: 194 NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKE 253

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    S  K+P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG
Sbjct: 254 LDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVG 313

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  +    +  +AK     +++P DVV+A +      +++V A ++P   + LD
Sbjct: 314 SSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLD 373

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +V+     +   +TV+WNGP+GVFE + F   T  +A  +A L+  + + +I GGG
Sbjct: 374 IGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSG-KGVTTIIGGG 432

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G+++  +++ST GGA LE LEGK LPG+VAL
Sbjct: 433 DSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVVAL 472


>gi|253700505|ref|YP_003021694.1| phosphoglycerate kinase [Geobacter sp. M21]
 gi|259530759|sp|C6E770|PGK_GEOSM RecName: Full=Phosphoglycerate kinase
 gi|251775355|gb|ACT17936.1| Phosphoglycerate kinase [Geobacter sp. M21]
          Length = 399

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 157/400 (39%), Positives = 238/400 (59%), Gaps = 6/400 (1%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGK-VADVTRIERVVPTILELVEKKAKVVIFS 60
             +R ++++ ++ G +  +RVD+NVP  D + + + TRI  V+P+I   +++KAK+++ S
Sbjct: 1   MSIRYIDEIENLSGKKLFMRVDFNVPLDDNQNITEDTRIRAVLPSINYALDQKAKIILAS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP+ +  +  S+         +L K +   +DCIG  +   I ++  G +I+ ENVR
Sbjct: 61  HLGRPKGERKEKYSMAPAAKRLSRLLGKEVKLASDCIGDEVKAMINAMQPGDVIMLENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLP-SYIGRAMQKELSM 179
           FY+ EE+ND DF + L+ + D Y+NDAF+VSHRAHAS+  +++  P    G  M+ E++ 
Sbjct: 121 FYAGEEKNDADFAKALANDCDVYVNDAFAVSHRAHASVEAITNCFPVVAAGFLMKNEMNY 180

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
            E       +PLVAI+GG+KVS KI +L NL  KVDK++IGGGMA +FL   G  VG+SL
Sbjct: 181 FEKAMKNPIRPLVAILGGAKVSGKIEVLENLCDKVDKIIIGGGMAFTFLKGMGYNVGKSL 240

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + +  D   +   +A+    +  +P D VVA +      T+V   Q +P   + LDVG 
Sbjct: 241 VEDNLIDTAMKTYEKARAQGVKFYLPVDCVVADQFNPAAETKVCPIQEIPEGWMALDVGP 300

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
            TV    + +  A+T++WNGP+GVFE++ F R T  +   VA        ++I GGGDT 
Sbjct: 301 ATVTLFTEALQNAKTIVWNGPMGVFEMDAFSRGTFAMVSAVA----NSYALTIVGGGDTD 356

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+  AG   + +Y+ST GGAFLE LEGK LPGI  L   
Sbjct: 357 VAVHRAGEYAKISYISTGGGAFLELLEGKKLPGIKVLEDK 396


>gi|323453579|gb|EGB09450.1| hypothetical protein AURANDRAFT_71305 [Aureococcus anophagefferens]
          Length = 978

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 165/387 (42%), Positives = 237/387 (61%), Gaps = 4/387 (1%)

Query: 5   RTMNDLR--DIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHL 62
           +++ D+   D++G + L+R D NVP  DG + D TRI   VPT+  L+EK A V + SHL
Sbjct: 259 KSVADMSEADLKGKKVLIRCDLNVPLKDGVIGDDTRIRASVPTVKYLLEKGASVAMCSHL 318

Query: 63  GRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFY 122
           GRP+   +   SL  V +     L K++    DCIG  ++  + SL EG  +L EN RFY
Sbjct: 319 GRPKDGPEDKFSLGPVSARMAECLGKDVKMAPDCIGDEVAAMVGSLGEGEAMLLENTRFY 378

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLE 181
            EEE+N+  FV  L+   D ++NDAF  +HRAHAS  G++    PS  G  + KEL  L 
Sbjct: 379 KEEEKNEAAFVEKLAAPFDLFVNDAFGTAHRAHASTEGVTKFLSPSVSGYLLAKELKYLA 438

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
               E  +PL AIVGGSKVS+KIT+L +L+ K DK++IGGGM  +FL A G  VG SL +
Sbjct: 439 GAVDEPVRPLAAIVGGSKVSSKITVLESLINKCDKVIIGGGMTFTFLKAMGKPVGSSLVE 498

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKT 301
            DF D        A+   CE+I P +++VA +      TQVV   S+P   + LD G K 
Sbjct: 499 DDFLDTAKAAMKLAEEKGCELIFPSEILVADKFDAEANTQVVDQDSIPDGWMGLDNGPKA 558

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
            + I++ +A  +TV+WNGP+GVFEI+ F + T  +   +A+LT E+  ++I GGGD++ A
Sbjct: 559 TKEIQEKLADCKTVIWNGPMGVFEIDAFAKGTFAICDTLAELT-EKGCVTIIGGGDSVAA 617

Query: 362 LAHAGISNEFTYVSTAGGAFLEWLEGK 388
           +  AG++++ +++ST GGA LE LEGK
Sbjct: 618 VEKAGLADKMSHISTGGGASLELLEGK 644


>gi|89256471|ref|YP_513833.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314906|ref|YP_763629.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156502577|ref|YP_001428642.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010391|ref|ZP_02275322.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254367805|ref|ZP_04983826.1| phosphogylcerate kinase [Francisella tularensis subsp. holarctica
           257]
 gi|290953023|ref|ZP_06557644.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313789|ref|ZP_06804363.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           URFT1]
 gi|122325080|sp|Q0BLP2|PGK_FRATO RecName: Full=Phosphoglycerate kinase
 gi|122500657|sp|Q2A369|PGK_FRATH RecName: Full=Phosphoglycerate kinase
 gi|166987784|sp|A7NCI3|PGK_FRATF RecName: Full=Phosphoglycerate kinase
 gi|89144302|emb|CAJ79586.1| phosphogylcerate kinase [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129805|gb|ABI82992.1| phosphogylcerate kinase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134253616|gb|EBA52710.1| phosphogylcerate kinase [Francisella tularensis subsp. holarctica
           257]
 gi|156253180|gb|ABU61686.1| phosphoglycerate kinase [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 392

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 152/400 (38%), Positives = 232/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I++K + F  D +          +  G I++ ENVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGV------DVKAGEIVMCENVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F   E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNIGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTNEIQA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 174 LEKALKSPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFIKAEGFDVGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D      +I  +AK     I VP DV VA+E        +     V  D +ILD+G 
Sbjct: 234 YEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSYVVADEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 294 ESQKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 350 AAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEK 389


>gi|297566467|ref|YP_003685439.1| phosphoglycerate kinase [Meiothermus silvanus DSM 9946]
 gi|296850916|gb|ADH63931.1| Phosphoglycerate kinase [Meiothermus silvanus DSM 9946]
          Length = 395

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 158/399 (39%), Positives = 239/399 (59%), Gaps = 9/399 (2%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ DL +  G R L+RVD+NVP  DGKV D TRI   +PT+  L+E+ A +V+ SHLG
Sbjct: 1   MRTLKDL-NAAGKRVLVRVDYNVPIKDGKVKDDTRITASLPTLQYLLEQGATLVLLSHLG 59

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGST-----LSQSIASLSEGGIILAEN 118
           RP+   ++  SL  V  + E  L + + F+      T       + + SL +G + L EN
Sbjct: 60  RPKGGFEEASSLAPVAKVLEKHLGRPVRFIGGSPELTPASEATLEQVKSLPQGSVALLEN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELS 178
           VRF   EE+ND    R  +R GD ++ DAF  +HRAHAS+TG++  LPS+ G  M+KE+ 
Sbjct: 120 VRFEPGEEKNDEGLARKYARLGDAFVLDAFGSAHRAHASVTGVARFLPSHAGFLMEKEVK 179

Query: 179 MLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRS 238
            L+       KP   ++GG+KVS KI ++ NL+ +V+ ++IGG MA +F+ AQG  VG S
Sbjct: 180 NLKRVIDNPDKPYWVVLGGAKVSDKIGVIENLLPRVNGMLIGGAMAFTFIKAQGGQVGNS 239

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVG 298
           L + D  +    +  +A+    + ++P DVV A++++ G+  ++  A  +P   + LD+G
Sbjct: 240 LVEDDKLELARNLLQKAQDLGVKFLLPTDVVAAQKIEPGVEKRIFPADQIPQGWMGLDIG 299

Query: 299 FKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDT 358
            +T +   Q +  A+TV+WNGP+GVFEIE F   T+ V   +A L       ++ GGGD+
Sbjct: 300 PETRKTFAQALQGAKTVLWNGPMGVFEIEDFAAGTLAVGQAIADLP---EAFTVIGGGDS 356

Query: 359 ITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           + A    G++ +F++VST GGA LE LE   LPGI ALS
Sbjct: 357 VAAANKLGVAEKFSHVSTGGGASLELLELGTLPGIEALS 395


>gi|225849789|ref|YP_002730023.1| phosphoglycerate kinase [Persephonella marina EX-H1]
 gi|225646502|gb|ACO04688.1| phosphoglycerate kinase [Persephonella marina EX-H1]
          Length = 398

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 155/396 (39%), Positives = 244/396 (61%), Gaps = 7/396 (1%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFID-GKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           T+ D+ D+ G R  +RVD+NVP  + G + D TRI   +PTI  L++K AKV++ SHLGR
Sbjct: 7   TLEDV-DVTGKRVFVRVDYNVPLDEHGHIVDDTRIRETIPTINYLLDKNAKVILASHLGR 65

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ + +   SLF V    E +L+K + F  DC+G  + + + ++ +G ++L EN+RF+  
Sbjct: 66  PKGERNPKYSLFPVARRLERLLNKEVKFAPDCVGKEVEELVFNMKDGDVVLLENLRFHPG 125

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPS-YIGRAMQKELSMLESC 183
           EE NDP+F + L++  + Y+ DAF   HR HAS+ G+   +    +G  +++EL   E  
Sbjct: 126 EEGNDPEFAKSLAKLAEIYVIDAFGTCHRKHASMYGIKDFVQPVVMGFLLERELKYFEKA 185

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
               ++P+VA +GGSKVS+K+ ++ +L+ K DK+ IGG MA +F+ A G  VG SL + D
Sbjct: 186 LVNPQRPVVAFIGGSKVSSKLGVIKHLLDKADKIFIGGAMAFTFIKAMGYEVGSSLVEDD 245

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    +  EAK+   +  +P D V  + +    P   V+ Q +P   + LD+G  ++ 
Sbjct: 246 MFDEALYVIDEAKKRGVKFYLPVDFVCGQAISEQTPVIEVAWQEIPKGWMGLDIGHASIT 305

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
            IK+++  A+T++WNGP+GVFEI+ F   T  +AH +A    E   +SIAGGGDT  A+ 
Sbjct: 306 LIKEILKDAQTIIWNGPMGVFEIDKFKGGTFGLAHAIA----ESPALSIAGGGDTDYAIH 361

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            AG+ +E +Y+ST GGAFL+ LEGK LP + A++ +
Sbjct: 362 KAGVIDEISYISTGGGAFLKLLEGKVLPCLEAITKN 397


>gi|169334489|ref|ZP_02861682.1| hypothetical protein ANASTE_00892 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259206|gb|EDS73172.1| hypothetical protein ANASTE_00892 [Anaerofustis stercorihominis DSM
           17244]
          Length = 401

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 141/406 (34%), Positives = 244/406 (60%), Gaps = 12/406 (2%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   ++++D+ +++G + L+R D+NVP  DG++ D  RI   +PTI ++++   KV++ S
Sbjct: 1   MLNKKSVDDI-NVKGKKVLIRCDFNVPLKDGEITDENRINAALPTIEKVMKDGGKVILCS 59

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAEN 118
           HLG+P+ ++  + SL  V       L K ++F  D   +G    +++A + EG ++L +N
Sbjct: 60  HLGKPKGEAKPELSLAPVAKRLSEKLGKEVVFAADDNVVGENAKKAVAEMKEGDVVLLQN 119

Query: 119 VRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKEL 177
            R+ +EE +N     + L+   D ++NDAF  +HRAH S  G++  + +  +G  MQKE+
Sbjct: 120 TRYRAEETKNGEALSKDLASLCDIFVNDAFGTAHRAHCSNVGVTEFVDTAVVGYLMQKEI 179

Query: 178 SMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGR 237
             L +  +  ++P VAI+GG+KV+ K+ ++ NL++K D L+IGGGMA +FL A+G  +G 
Sbjct: 180 DFLGNAVNNPERPFVAILGGAKVADKLNVIANLLEKCDTLIIGGGMAYTFLKAKGYEIGT 239

Query: 238 SLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTG----IPTQVVSAQSVPLDSI 293
           SL   +  D   ++  +A++   ++++P D  + ++        I  +VVS+ ++P D +
Sbjct: 240 SLVDDEKLDYCKEMMEKAEKLGKKLLLPIDTTITKDFPNPIDAEIEIKVVSSDAIPADMM 299

Query: 294 ILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIA 353
            LD+G +T +     +  A+TV+WNGP+GVFE     + T+ VA  +A    E    +I 
Sbjct: 300 GLDIGTETAKLFADAVKSAKTVVWNGPMGVFENPILAKGTISVAEALA----ETDATTII 355

Query: 354 GGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           GGGD+  A+   G  ++ T++ST GGA LE+LEGKDLPG+VA +  
Sbjct: 356 GGGDSAAAVNQLGFGDKMTHISTGGGASLEFLEGKDLPGVVAANDK 401


>gi|261367967|ref|ZP_05980850.1| phosphoglycerate kinase [Subdoligranulum variabile DSM 15176]
 gi|282569949|gb|EFB75484.1| phosphoglycerate kinase [Subdoligranulum variabile DSM 15176]
          Length = 402

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 139/401 (34%), Positives = 234/401 (58%), Gaps = 12/401 (2%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T++D  +  G R L+R D+NVP  DG + +  RI   +PTI +L++  AKV++ SHLG+
Sbjct: 6   KTIDD-ENYAGKRVLVRCDFNVPMKDGVITNDNRINAALPTIQKLIKDGAKVILCSHLGK 64

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAENVRFY 122
           P++  +   SL  V       L + + F +D   +G+    ++A++S+G ++L +N RF 
Sbjct: 65  PKNGPEAKFSLAPVAVRLSEKLGQPVQFADDDEVVGAQAKAAVATMSDGDVVLLQNTRFR 124

Query: 123 SEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL-LPSYIGRAMQKELSMLE 181
            EE +N P+F + L+   D Y++DAF   HRAH S  G++     + +G  M+KE+  L 
Sbjct: 125 KEETKNMPEFSKELASLADAYVDDAFGSCHRAHCSTAGVTEFIQDTAVGYLMEKEIKYLG 184

Query: 182 SCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ 241
           +  ++  +P  AI+GG+KV+ K+ ++ NL++KVD L+IGGGMA +FL A+G  +G+SLC 
Sbjct: 185 NAVNDPVRPFTAILGGAKVADKLNVISNLLEKVDTLIIGGGMAYTFLKAEGYEIGKSLCD 244

Query: 242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTG----IPTQVVSAQSVPLDSIILDV 297
               D    +  +AK    ++++P D     +        + T++V   ++P D    D+
Sbjct: 245 DSKIDYCKDMMAKAKEKGVKLLLPVDTACVTDFPDPIDAEVETKIVPVTAIPADMEGCDI 304

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G +T++     +  ++TV+WNGP+GVFE       T+ VA  +A    E    ++ GGGD
Sbjct: 305 GPETMKLFADAVKASKTVVWNGPMGVFENPTLAAGTLAVAKAMA----ESDATTVIGGGD 360

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           +  A+   G+ ++ T++ST GGA LE+LEGK+LPGI  +  
Sbjct: 361 SAAAVQQMGLGDKMTHISTGGGASLEYLEGKELPGIAVIQN 401


>gi|167627583|ref|YP_001678083.1| phosphoglycerate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189036816|sp|B0TY21|PGK_FRAP2 RecName: Full=Phosphoglycerate kinase
 gi|167597584|gb|ABZ87582.1| Phosphoglycerate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 392

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 151/400 (37%), Positives = 233/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 1   MSFLTLKDV-DLKNKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 59

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V  +   I+ K + F  D +    +++      G I++ +NVR
Sbjct: 60  LGRPTEGEYDSQFSLEPVAEVLSQIIKKPVRFAKDWLNGVDAKA------GEIVMCDNVR 113

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F   E+++D +  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 114 FNKGEKKSDDELSKKIASLGDVFVMDAFATAHRAQASTYGVAKYVPVACAGLLLANEIKA 173

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  +G SL
Sbjct: 174 LEKALKAPKKPMAAIVGGSKVSTKLSVLHNLLDKVEILIVGGGIANTFIKAEGFNIGNSL 233

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            + D       I  +AK     I VP DV VA+E+       V +   V  D +ILD+G 
Sbjct: 234 YEEDLVGEAKDILAKAKELGVNIPVPVDVRVAKELSENAVAVVKNVADVADDEMILDIGP 293

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           K+   I +++  A T++WNGP+GVFE + F   T  ++  +A    E    S+AGGGDTI
Sbjct: 294 KSERNIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIA----ESDAFSVAGGGDTI 349

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+    I ++ +Y+STAGGAFLE+LEGK LP +  L   
Sbjct: 350 AAIEKFDIKDKVSYISTAGGAFLEFLEGKKLPAVEILKEK 389


>gi|8037939|gb|AAF71544.1|AF256214_1 phosphoglycerate kinase [Brucella abortus]
          Length = 396

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 200/398 (50%), Positives = 276/398 (69%), Gaps = 2/398 (0%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           M   RT++D  +++  R L+RVD NVP  +G+V D+TRIER+VPTI EL  K AKV++ +
Sbjct: 1   MM-FRTLDD-ANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLA 58

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           H GRP+  +  + SL  VV     +L  ++ F  DCIG     ++ +L +G ++L EN R
Sbjct: 59  HFGRPKGVASDENSLKHVVKPLSKVLDHSVHFAEDCIGDKAKPAVDALKDGDVLLLENTR 118

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           F+  EE+NDP+FV+ L+ NGD Y+NDAFS +HRAHAS  GL+++LP++ GRAMQ EL  L
Sbjct: 119 FHKGEEKNDPEFVQALAANGDLYVNDAFSAAHRAHASTEGLANVLPAFAGRAMQAELEAL 178

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E       +P+VAIVGG+KVSTK+ LL NL++KVD LVIGGGMAN+FL A+G+ VG+SLC
Sbjct: 179 EKGLGNPARPVVAIVGGAKVSTKLDLLSNLIEKVDALVIGGGMANTFLAAKGLDVGKSLC 238

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           + + +    +I  +A+ + C II+P D VV        P Q     SVP D++ILD G  
Sbjct: 239 EHELASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTYGVDSVPGDAMILDAGEL 298

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           + + I   I  A T++WNGPLG FE+ PFD ATV+VA +VAK TKE +++S+ GGGDT+ 
Sbjct: 299 STDLIASAIDDAATLVWNGPLGAFELSPFDTATVKVARHVAKRTKEGKLVSVGGGGDTVA 358

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
           AL HAG++++FTY+STAGGAFLEW+EGK LPG+  L  
Sbjct: 359 ALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVDVLKK 396


>gi|57339704|gb|AAW49839.1| hypothetical protein FTT1367 [synthetic construct]
          Length = 427

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 153/400 (38%), Positives = 233/400 (58%), Gaps = 13/400 (3%)

Query: 2   SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSH 61
               T+ D+ D++  + L+RVD+NVP  DGKV    RIE  +PTI  ++++   V++ SH
Sbjct: 27  MSFLTLKDV-DLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSH 85

Query: 62  LGRP-QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           LGRP + + D   SL  V      I++K + F  D +          +  G I++ ENVR
Sbjct: 86  LGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGV------DVKAGEIVMCENVR 139

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL-SHLLPSYIGRAMQKELSM 179
           F S E+++  D  + ++  GD ++ DAF+ +HRA AS  G+  ++  +  G  +  E+  
Sbjct: 140 FNSGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTNEIQA 199

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           LE      KKP+ AIVGGSKVSTK+++L NL+ KV+ L++GGG+AN+F+ A+G  VG SL
Sbjct: 200 LEKALKSPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFIKAEGFDVGNSL 259

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D      +I  +AK     I VP DV VA+E        +     V  D +ILD+G 
Sbjct: 260 YEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSDVVADEMILDIGP 319

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++ + I +++  A T++WNGP+GVFE + F   T  ++  +A+        S+AGGGDTI
Sbjct: 320 ESQKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQ----SHAFSVAGGGDTI 375

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            A+   GI ++ +Y+STAGGAFLE+LEGK LP I  L   
Sbjct: 376 AAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEK 415


>gi|255524720|ref|ZP_05391672.1| Phosphoglycerate kinase [Clostridium carboxidivorans P7]
 gi|296185682|ref|ZP_06854091.1| phosphoglycerate kinase [Clostridium carboxidivorans P7]
 gi|255511614|gb|EET87902.1| Phosphoglycerate kinase [Clostridium carboxidivorans P7]
 gi|296049810|gb|EFG89235.1| phosphoglycerate kinase [Clostridium carboxidivorans P7]
          Length = 397

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 152/403 (37%), Positives = 235/403 (58%), Gaps = 10/403 (2%)

Query: 1   MS-RLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   +T+ D+ +++G R L R D+NVP  DG + D  R+   +PTI  LVEK AKV++ 
Sbjct: 1   MAFNKKTIEDV-EVKGKRVLARCDFNVPLKDGVITDENRLVGAMPTIKYLVEKGAKVILC 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVND--CIGSTLSQSIASLSEGGIILAE 117
           SHLG+ +   D   +L  V      +L K ++F  D   +G    +++A++ +G ++L E
Sbjct: 60  SHLGKAKG-PDPKLTLAPVAKRLSEMLGKEVVFAADDTVVGENAKKAVAAMKDGDVVLLE 118

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY-IGRAMQKE 176
           N RF  EE +N+  F + L+   D Y+NDAF  +HRAH S+ G++  + +   G  +QKE
Sbjct: 119 NTRFRKEEGKNEEAFSKDLASLADIYVNDAFGSAHRAHCSVVGVTQFVDTAVCGYLIQKE 178

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  ++P VAI+GG+KVS KI ++ NL+ KV+ L+IGGGMA +FL AQG  +G
Sbjct: 179 LKFLGEAVNTPERPFVAILGGAKVSDKINVINNLLDKVNTLIIGGGMAYTFLKAQGYTIG 238

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D   ++  +AK    ++++P D VV  +             ++P   + LD
Sbjct: 239 TSLLEADKVDYAKEMMEKAKAKGVKLLLPIDNVVGEKFAADTTPVTTEDANIPEGYMGLD 298

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G KT +     +  A+TV+WNGP+GVFE E F + T+ VA  +A         ++ GGG
Sbjct: 299 IGPKTSKIYADAVKDAKTVVWNGPMGVFEFENFAKGTIAVAKAMADA----DATTVIGGG 354

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
           D+  A+   G  ++ T++ST GGA LE+LEGK LPGI AL+  
Sbjct: 355 DSAAAVNILGFGDKMTHISTGGGASLEFLEGKALPGIEALNDK 397


>gi|92118993|ref|YP_578722.1| phosphoglycerate kinase [Nitrobacter hamburgensis X14]
 gi|91801887|gb|ABE64262.1| phosphoglycerate kinase [Nitrobacter hamburgensis X14]
          Length = 398

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 195/400 (48%), Positives = 266/400 (66%), Gaps = 3/400 (0%)

Query: 1   MSR-LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIF 59
           M+   RT++D+ D++G R LLRVD NVP   G+V D TR+ERV PTI E+  K  K ++ 
Sbjct: 1   MTNSFRTLDDV-DVKGKRVLLRVDLNVPMEQGRVTDTTRLERVAPTITEIAGKGGKAILL 59

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           +H GRP+   D   SL  V +    +L + + F +DCIG    +++A++ +G I+  EN 
Sbjct: 60  AHFGRPKG-RDAKDSLRPVATELAKVLGRPVAFADDCIGDAAEKAVAAMKDGDILCLENT 118

Query: 120 RFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
           RF+ EEE+NDP FV  L++ GD ++NDAFS +HRAHAS  GL H LP Y GR MQ EL  
Sbjct: 119 RFHKEEEKNDPAFVAELAKLGDIWVNDAFSAAHRAHASTEGLGHKLPGYAGRTMQAELEA 178

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSL 239
           L        KP++AI+GG+KVSTKI LL NLV KVD LVIGGGMAN+FL AQG+ VG+SL
Sbjct: 179 LNKALEAPTKPVIAIIGGAKVSTKIDLLENLVSKVDALVIGGGMANTFLHAQGVNVGKSL 238

Query: 240 CQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGF 299
            ++D +    +I  +AK + C II+P D  VA       P+      ++P + +ILDVG 
Sbjct: 239 AEKDLAATALRILDKAKAANCTIILPVDATVAFHFAANAPSHAYGLDAIPAEGMILDVGP 298

Query: 300 KTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTI 359
           ++VE ++  I  A T++WNGPLG FE+ PFDR TV  A + A+ TK  +++S+AGGGDT+
Sbjct: 299 QSVERVRSAIDDAATLVWNGPLGAFELSPFDRGTVVAAKHAAERTKTGKLVSVAGGGDTV 358

Query: 360 TALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH 399
            AL  AG++ +F+YVSTAGGAFLEW+EGK LPG+  L   
Sbjct: 359 AALNQAGVAGDFSYVSTAGGAFLEWMEGKPLPGVEVLRAK 398


>gi|29376485|ref|NP_815639.1| phosphoglycerate kinase [Enterococcus faecalis V583]
 gi|227519305|ref|ZP_03949354.1| phosphoglycerate kinase [Enterococcus faecalis TX0104]
 gi|227555489|ref|ZP_03985536.1| phosphoglycerate kinase [Enterococcus faecalis HH22]
 gi|229545454|ref|ZP_04434179.1| phosphoglycerate kinase [Enterococcus faecalis TX1322]
 gi|229549698|ref|ZP_04438423.1| phosphoglycerate kinase [Enterococcus faecalis ATCC 29200]
 gi|255972396|ref|ZP_05422982.1| phosphoglycerate kinase [Enterococcus faecalis T1]
 gi|255975499|ref|ZP_05426085.1| phosphoglycerate kinase [Enterococcus faecalis T2]
 gi|256619437|ref|ZP_05476283.1| phosphoglycerate kinase [Enterococcus faecalis ATCC 4200]
 gi|256853478|ref|ZP_05558848.1| phosphoglycerate kinase [Enterococcus faecalis T8]
 gi|256959276|ref|ZP_05563447.1| phosphoglycerate kinase [Enterococcus faecalis DS5]
 gi|256961548|ref|ZP_05565719.1| phosphoglycerate kinase [Enterococcus faecalis Merz96]
 gi|256964764|ref|ZP_05568935.1| phosphoglycerate kinase [Enterococcus faecalis HIP11704]
 gi|257079343|ref|ZP_05573704.1| phosphoglycerate kinase/triose-phosphate isomerase [Enterococcus
           faecalis JH1]
 gi|257084835|ref|ZP_05579196.1| phosphoglycerate kinase [Enterococcus faecalis Fly1]
 gi|257087168|ref|ZP_05581529.1| phosphoglycerate kinase [Enterococcus faecalis D6]
 gi|257090245|ref|ZP_05584606.1| phosphoglycerate kinase [Enterococcus faecalis CH188]
 gi|257419644|ref|ZP_05596638.1| phosphoglycerate kinase [Enterococcus faecalis T11]
 gi|257422248|ref|ZP_05599238.1| phosphoglycerate kinase [Enterococcus faecalis X98]
 gi|293384692|ref|ZP_06630547.1| phosphoglycerate kinase [Enterococcus faecalis R712]
 gi|293387392|ref|ZP_06631947.1| phosphoglycerate kinase [Enterococcus faecalis S613]
 gi|294779755|ref|ZP_06745142.1| phosphoglycerate kinase [Enterococcus faecalis PC1.1]
 gi|300861228|ref|ZP_07107315.1| phosphoglycerate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|307268150|ref|ZP_07549537.1| phosphoglycerate kinase [Enterococcus faecalis TX4248]
 gi|307272845|ref|ZP_07554092.1| phosphoglycerate kinase [Enterococcus faecalis TX0855]
 gi|307275902|ref|ZP_07557035.1| phosphoglycerate kinase [Enterococcus faecalis TX2134]
 gi|307277684|ref|ZP_07558770.1| phosphoglycerate kinase [Enterococcus faecalis TX0860]
 gi|307287892|ref|ZP_07567925.1| phosphoglycerate kinase [Enterococcus faecalis TX0109]
 gi|307295921|ref|ZP_07575753.1| phosphoglycerate kinase [Enterococcus faecalis TX0411]
 gi|312900891|ref|ZP_07760185.1| phosphoglycerate kinase [Enterococcus faecalis TX0470]
 gi|312902742|ref|ZP_07761946.1| phosphoglycerate kinase [Enterococcus faecalis TX0635]
 gi|312908322|ref|ZP_07767286.1| phosphoglycerate kinase [Enterococcus faecalis DAPTO 512]
 gi|312910604|ref|ZP_07769446.1| phosphoglycerate kinase [Enterococcus faecalis DAPTO 516]
 gi|312951297|ref|ZP_07770198.1| phosphoglycerate kinase [Enterococcus faecalis TX0102]
 gi|46576783|sp|Q833I9|PGK_ENTFA RecName: Full=Phosphoglycerate kinase
 gi|29343949|gb|AAO81709.1| phosphoglycerate kinase [Enterococcus faecalis V583]
 gi|227073234|gb|EEI11197.1| phosphoglycerate kinase [Enterococcus faecalis TX0104]
 gi|227175385|gb|EEI56357.1| phosphoglycerate kinase [Enterococcus faecalis HH22]
 gi|229305178|gb|EEN71174.1| phosphoglycerate kinase [Enterococcus faecalis ATCC 29200]
 gi|229309370|gb|EEN75357.1| phosphoglycerate kinase [Enterococcus faecalis TX1322]
 gi|255963414|gb|EET95890.1| phosphoglycerate kinase [Enterococcus faecalis T1]
 gi|255968371|gb|EET98993.1| phosphoglycerate kinase [Enterococcus faecalis T2]
 gi|256598964|gb|EEU18140.1| phosphoglycerate kinase [Enterococcus faecalis ATCC 4200]
 gi|256711937|gb|EEU26975.1| phosphoglycerate kinase [Enterococcus faecalis T8]
 gi|256949772|gb|EEU66404.1| phosphoglycerate kinase [Enterococcus faecalis DS5]
 gi|256952044|gb|EEU68676.1| phosphoglycerate kinase [Enterococcus faecalis Merz96]
 gi|256955260|gb|EEU71892.1| phosphoglycerate kinase [Enterococcus faecalis HIP11704]
 gi|256987373|gb|EEU74675.1| phosphoglycerate kinase/triose-phosphate isomerase [Enterococcus
           faecalis JH1]
 gi|256992865|gb|EEU80167.1| phosphoglycerate kinase [Enterococcus faecalis Fly1]
 gi|256995198|gb|EEU82500.1| phosphoglycerate kinase [Enterococcus faecalis D6]
 gi|256999057|gb|EEU85577.1| phosphoglycerate kinase [Enterococcus faecalis CH188]
 gi|257161472|gb|EEU91432.1| phosphoglycerate kinase [Enterococcus faecalis T11]
 gi|257164072|gb|EEU94032.1| phosphoglycerate kinase [Enterococcus faecalis X98]
 gi|291077999|gb|EFE15363.1| phosphoglycerate kinase [Enterococcus faecalis R712]
 gi|291083183|gb|EFE20146.1| phosphoglycerate kinase [Enterococcus faecalis S613]
 gi|294453129|gb|EFG21544.1| phosphoglycerate kinase [Enterococcus faecalis PC1.1]
 gi|295113228|emb|CBL31865.1| phosphoglycerate kinase [Enterococcus sp. 7L76]
 gi|300850267|gb|EFK78017.1| phosphoglycerate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|306496252|gb|EFM65831.1| phosphoglycerate kinase [Enterococcus faecalis TX0411]
 gi|306501037|gb|EFM70344.1| phosphoglycerate kinase [Enterococcus faecalis TX0109]
 gi|306505563|gb|EFM74747.1| phosphoglycerate kinase [Enterococcus faecalis TX0860]
 gi|306507232|gb|EFM76369.1| phosphoglycerate kinase [Enterococcus faecalis TX2134]
 gi|306510459|gb|EFM79482.1| phosphoglycerate kinase [Enterococcus faecalis TX0855]
 gi|306515540|gb|EFM84068.1| phosphoglycerate kinase [Enterococcus faecalis TX4248]
 gi|310625736|gb|EFQ09019.1| phosphoglycerate kinase [Enterococcus faecalis DAPTO 512]
 gi|310630733|gb|EFQ14016.1| phosphoglycerate kinase [Enterococcus faecalis TX0102]
 gi|310633796|gb|EFQ17079.1| phosphoglycerate kinase [Enterococcus faecalis TX0635]
 gi|311289152|gb|EFQ67708.1| phosphoglycerate kinase [Enterococcus faecalis DAPTO 516]
 gi|311291990|gb|EFQ70546.1| phosphoglycerate kinase [Enterococcus faecalis TX0470]
 gi|315025968|gb|EFT37900.1| phosphoglycerate kinase [Enterococcus faecalis TX2137]
 gi|315028889|gb|EFT40821.1| phosphoglycerate kinase [Enterococcus faecalis TX4000]
 gi|315033280|gb|EFT45212.1| phosphoglycerate kinase [Enterococcus faecalis TX0017]
 gi|315034518|gb|EFT46450.1| phosphoglycerate kinase [Enterococcus faecalis TX0027]
 gi|315143393|gb|EFT87409.1| phosphoglycerate kinase [Enterococcus faecalis TX2141]
 gi|315152603|gb|EFT96619.1| phosphoglycerate kinase [Enterococcus faecalis TX0031]
 gi|315159877|gb|EFU03894.1| phosphoglycerate kinase [Enterococcus faecalis TX0312]
 gi|315161359|gb|EFU05376.1| phosphoglycerate kinase [Enterococcus faecalis TX0645]
 gi|315163656|gb|EFU07673.1| phosphoglycerate kinase [Enterococcus faecalis TX1302]
 gi|315167512|gb|EFU11529.1| phosphoglycerate kinase [Enterococcus faecalis TX1341]
 gi|315169371|gb|EFU13388.1| phosphoglycerate kinase [Enterococcus faecalis TX1342]
 gi|315174304|gb|EFU18321.1| phosphoglycerate kinase [Enterococcus faecalis TX1346]
 gi|315574566|gb|EFU86757.1| phosphoglycerate kinase [Enterococcus faecalis TX0309B]
 gi|315576672|gb|EFU88863.1| phosphoglycerate kinase [Enterococcus faecalis TX0630]
 gi|315581792|gb|EFU93983.1| phosphoglycerate kinase [Enterococcus faecalis TX0309A]
 gi|323481099|gb|ADX80538.1| phosphoglycerate kinase [Enterococcus faecalis 62]
 gi|327535478|gb|AEA94312.1| phosphoglycerat