RPSBLAST alignment for GI: 254780653 and conserved domain: PLN02282

>gnl|CDD|165923 PLN02282, PLN02282, phosphoglycerate kinase. Length = 401
 Score =  323 bits (830), Expect = 4e-89
 Identities = 169/400 (42%), Positives = 251/400 (62%), Gaps = 6/400 (1%)

Query: 1   MSRLRTMNDLR--DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVV 57
           M+  R++  L+  D++G R  +RVD NVP  D   + D TRI   VPTI  L+   A+V+
Sbjct: 1   MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGHGARVI 60

Query: 58  IFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAE 117
           + SHLGRP+  + K  SL  +V     +L   ++  NDCIG  + + +A L EGG++L E
Sbjct: 61  LCSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVVMANDCIGEEVEKLVAELPEGGVLLLE 119

Query: 118 NVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKE 176
           NVRFY EEE+NDP+F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  MQKE
Sbjct: 120 NVRFYKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHASTEGVAKYLKPSVAGFLMQKE 179

Query: 177 LSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVG 236
           L  L    +  KKP  AIVGGSKVSTKI ++ +L++KVD L++GGGM  +F  AQG  VG
Sbjct: 180 LDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLEKVDILLLGGGMIFTFYKAQGYSVG 239

Query: 237 RSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILD 296
            SL + D  D    +  +AK     +++P DVV+A +      ++VV A ++P   + LD
Sbjct: 240 SSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLD 299

Query: 297 VGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGG 356
           +G  +++   + +   +T++WNGP+GVFE E F   T  +A  +A+L+  + + +I GGG
Sbjct: 300 IGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAKKLAELS-GKGVTTIIGGG 358

Query: 357 DTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVAL 396
           D++ A+   G++++ +++ST GGA LE LEGK LPG++AL
Sbjct: 359 DSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLAL 398