RPSBLAST alignment for GI: 254780653 and conserved domain: PLN03034

>gnl|CDD|178602 PLN03034, PLN03034, phosphoglycerate kinase; Provisional. Length = 481
 Score =  316 bits (810), Expect = 9e-87
 Identities = 162/387 (41%), Positives = 244/387 (63%), Gaps = 4/387 (1%)

Query: 12  DIRGLRCLLRVDWNVPFIDG-KVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSD 70
           D++G +  +R D NVP  D   + D TRI   +PTI  L+   AKV++ SHLGRP+  + 
Sbjct: 89  DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNGAKVILSSHLGRPKGVTP 148

Query: 71  KDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDP 130
           K  SL  +V     +L   ++  +DCIG  + + +ASL EGG++L ENVRFY EEE+N+P
Sbjct: 149 K-FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEP 207

Query: 131 DFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL-PSYIGRAMQKELSMLESCFSESKK 189
           +F + L+   D Y+NDAF  +HRAHAS  G++  L PS  G  +QKEL  L    S  K+
Sbjct: 208 EFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVSNPKR 267

Query: 190 PLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVH 249
           P  AIVGGSKVS+KI ++ +L++K D L++GGGM  +F  AQG+ VG SL + D  +   
Sbjct: 268 PFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELAT 327

Query: 250 QIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
            +  +AK     +++P DVV+A +      +++V A ++P   + LD+G  +V+   + +
Sbjct: 328 SLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEAL 387

Query: 310 AQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISN 369
              +TV+WNGP+GVFE E F   T  VA  +A+L+  + + +I GGGD++ A+   G+++
Sbjct: 388 DTTQTVIWNGPMGVFEFEKFAVGTEAVAKKLAELS-GKGVTTIIGGGDSVAAVEKVGVAD 446

Query: 370 EFTYVSTAGGAFLEWLEGKDLPGIVAL 396
             +++ST GGA LE LEGK+LPG+VAL
Sbjct: 447 VMSHISTGGGASLELLEGKELPGVVAL 473