RPSBLAST alignment of GI: 254780653 and MMDB domain: 16pk_A_204-415

>16pk_A (A:204-415) PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei}Length = 212
 Score =  241 bits (617), Expect = 1e-64
 Identities = 85/209 (40%), Positives = 130/209 (62%)

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +PLVAIVGG+KVS KI LL N+++++D L+IGG MA +FL AQG  +G+S C+    +  
Sbjct: 2   RPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFA 61

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             +  +A+    ++I+P D V   E K      +   Q++P   + LD+G KT+E   Q 
Sbjct: 62  RSLLKKAEDRKVQVILPIDHVCHTEFKAVDSPLITEDQNIPEGHMALDIGPKTIEKYVQT 121

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           I + ++ +WNGP+GVFE+ P+ + T  +A  + + T E  ++SI GGGD+ +A   +G +
Sbjct: 122 IGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRGTHEHGLMSIIGGGDSASAAELSGEA 181

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              ++VST GGA LE LEGK LPG+  L 
Sbjct: 182 KRMSHVSTGGGASLELLEGKTLPGVTVLD 210