RPSBLAST alignment of GI: 254780653 and MMDB domain: 1v6s_A_1-180_381-390

>1v6s_A (A:1-180,A:381-390) Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus}Length = 190
 Score =  193 bits (492), Expect = 4e-50
 Identities = 72/178 (40%), Positives = 102/178 (57%), Gaps = 2/178 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ DL D +G R L+RVD+NVP  DGKV D TRI   +PT+  L+   A +V+ SHLG
Sbjct: 1   MRTLLDL-DPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHLG 59

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+    K  SL  V     + L +              +   +L  G ++L ENVRF  
Sbjct: 60  RPKGPDPKY-SLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEP 118

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLE 181
            EE+NDP+     +R G+ ++ DAF  +HRAHAS+ G++ LLP+Y G  M+KE+  L 
Sbjct: 119 GEEKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALS 176