RPSBLAST alignment of GI: 254780653 and protein with PDBid: 1fw8

>1fw8_A PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae} SCOP: c.86.1.1 Length = 416
 Score =  313 bits (804), Expect = 4e-86
 Identities = 120/340 (35%), Positives = 185/340 (54%), Gaps = 18/340 (5%)

Query: 74  SLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEE------- 126
           SL  V    +S+L K++ F+NDC+G  +  ++ + + G +IL EN+R++ EEE       
Sbjct: 5   SLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHIEEEGSRKVDG 64

Query: 127 -------RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSM 179
                   +   F   LS   D YINDAF  +HRAH+S+ G   L     G  ++KEL  
Sbjct: 65  QKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVGF-DLPQRAAGFLLEKELKY 123

Query: 180 LESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFL-VAQGMGVGRS 238
                    +P +AI+GG+KV+ KI L+ NL+ KVD ++IGGGMA +F  V +   +G S
Sbjct: 124 FGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAFTFKKVLENTEIGDS 183

Query: 239 LCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPT-QVVSAQSVPLDSIILDV 297
           +  +  ++ V ++  +AK    E+++P D ++A        T  V   + +P     LD 
Sbjct: 184 IFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVTDKEGIPAGWQGLDN 243

Query: 298 GFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGD 357
           G ++ +     +A+A+T++WNGP GVFE E F   T  +   V K +       I GGGD
Sbjct: 244 GPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSAAG-NTVIIGGGD 302

Query: 358 TITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           T T     G++++ ++VST GGA LE LEGK+LPG+  LS
Sbjct: 303 TATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLS 342