RPSBLAST alignment of GI: 254780653 and protein with PDBid: 1v6s

>1v6s_A Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus} SCOP: c.86.1.1 PDB: 2ie8_A Length = 390
 Score =  314 bits (806), Expect = 2e-86
 Identities = 157/395 (39%), Positives = 232/395 (58%), Gaps = 5/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ DL D +G R L+RVD+NVP  DGKV D TRI   +PT+  L+   A +V+ SHLG
Sbjct: 1   MRTLLDL-DPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHLG 59

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+    K  SL  V     + L +              +   +L  G ++L ENVRF  
Sbjct: 60  RPKGPDPKY-SLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEP 118

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+     +R G+ ++ DAF  +HRAHAS+ G++ LLP+Y G  M+KE+  L   
Sbjct: 119 GEEKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRL 178

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + ++P   ++GG+KVS KI ++ +L+ ++D+L+IGG MA +FL A G  VGRSL + D
Sbjct: 179 LKDPERPYAVVLGGAKVSDKIGVIESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEED 238

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    +   A+     + +P DVV A  ++ G+ T+V  A+++P+  + LD+G KT E
Sbjct: 239 RLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVETRVFPARAIPVPYMGLDIGPKTRE 298

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +  ARTV WNGP+GVFE+ PFD  T+ V   +A L       ++ GGGD++ A+ 
Sbjct: 299 AFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEG---AFTVVGGGDSVAAVN 355

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
             G+   F +VST GGA LE+LE   LPG+  L G
Sbjct: 356 RLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLEG 390