RPSBLAST alignment of GI: 254780653 and SCOP domain: d1hdia_

Alignment
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 413
 Score =  320 bits (820), Expect = 1e-88
 Identities = 153/411 (37%), Positives = 228/411 (55%), Gaps = 22/411 (5%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFSHLGR 64
           T++ L +++G R ++RVD+NVP    ++ +  RI+  VP+I   ++  AK VV+ SHLGR
Sbjct: 4   TLDKL-NVKGKRVVMRVDFNVPMAAAQITNNARIKAAVPSIKFCLDDGAKSVVLMSHLGR 62

Query: 65  PQSKSDKDC-SLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P      D  SL  V +  +S L K +LF+ DC+G  + ++ A  + G +IL EN+RF+ 
Sbjct: 63  PDGSPMPDKYSLQPVAAELKSALGKAVLFLKDCVGPAVEKACADPAAGSVILLENLRFHV 122

Query: 124 EEE---------------RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY 168
           EEE                    F   LS  GD Y+NDAF  +HRAH+S+ G+ +L    
Sbjct: 123 EEEGKGKDASGNKAAGEPAKIKAFRASLSALGDVYVNDAFGTAHRAHSSMVGV-NLPKKA 181

Query: 169 IGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFL 228
               M+KEL+   +     ++P +AI+GG+KV+ KI L+ N++ KV++++IGGGMA +FL
Sbjct: 182 GAFLMKKELNYFAAAAESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFL 241

Query: 229 -VAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP-TQVVSAQ 286
            V   M +G SL        V  +  +A  +  +I +P D V A +        Q   A 
Sbjct: 242 KVLNNMEIGTSLFDEAGKKIVKNLMSKAAANGVKITLPVDFVTADKFDEQAKIGQATVAS 301

Query: 287 SVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKE 346
            +P   + LD G K+     + +A+A+ ++WNGP+GVFE E F + T  +   V K T  
Sbjct: 302 GIPAGWMGLDCGPKSSAKYSEAVARAKQIVWNGPVGVFEWEAFAQGTKALMDEVVKATS- 360

Query: 347 RRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           R  I+I GGGDT T  A     +  ++VST GGA LE LEGK LPG+ ALS
Sbjct: 361 RGCITIIGGGDTATCCAKWNTEDNVSHVSTGGGASLELLEGKVLPGVDALS 411

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate kinase
superfamily: Phosphoglycerate kinase
family: Phosphoglycerate kinase
domain: Phosphoglycerate kinase
species: Pig (Sus scrofa) [TaxId: 9823]