RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780653|ref|YP_003065066.1| phosphoglycerate kinase
[Candidatus Liberibacter asiaticus str. psy62]
         (400 letters)



>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus
           stearothermophilus [TaxId: 1422]}
          Length = 394

 Score =  366 bits (941), Expect = e-102
 Identities = 160/393 (40%), Positives = 238/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV   ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T  +A  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIAEALAEALD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima
           [TaxId: 2336]}
          Length = 398

 Score =  334 bits (857), Expect = 9e-93
 Identities = 159/393 (40%), Positives = 249/393 (63%), Gaps = 3/393 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 4   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 62

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 63  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 122

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 123 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 182

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 183 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 242

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSA-QSVPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +T+E 
Sbjct: 243 DLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT+ +  I++ GGGD+  A+  
Sbjct: 303 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTE-KGAITVVGGGDSAAAVNK 361

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G+ ++F++VST GGA LE+LEGK+LPGI ++ 
Sbjct: 362 FGLEDKFSHVSTGGGASLEFLEGKELPGIASMR 394


>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast
           (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 415

 Score =  332 bits (853), Expect = 3e-92
 Identities = 144/414 (34%), Positives = 228/414 (55%), Gaps = 20/414 (4%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVI-F 59
           +S   ++ DL D++  R  +RVD+NVP    K+    RI   +PTI  ++E   + V+  
Sbjct: 2   LSSKLSVQDL-DLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLA 60

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SHLG+P  + ++  SL  V    +S+L K++ F+NDC+G  +  ++ + + G +IL EN+
Sbjct: 61  SHLGQPNGERNEKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENL 120

Query: 120 RFYSEEER--------------NDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLL 165
           R++ EEE               +   F   LS   D YINDAF  +HRAH+S+ G   L 
Sbjct: 121 RYHIEEEGSRKVDGQKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVG-FDLP 179

Query: 166 PSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMAN 225
               G  ++KEL           +P +AI+GG+KV+ KI L+ NL+ KVD ++IGGGMA 
Sbjct: 180 QRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAF 239

Query: 226 SFL-VAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVS 284
           +F  V +   +G S+  +  ++ V ++  +AK    E+++P D ++A        T+ V+
Sbjct: 240 TFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVT 299

Query: 285 A-QSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKL 343
             + +P     LD G ++ +     +A+A+T++WNGP GVFE E F   T  +   V K 
Sbjct: 300 DKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKS 359

Query: 344 TKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +       I GGGDT T     G++++ ++VST GGA LE LEGK+LPG+  LS
Sbjct: 360 SAAG-NTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLS 412


>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite
           (Plasmodium falciparum) [TaxId: 5833]}
          Length = 417

 Score =  323 bits (830), Expect = 1e-89
 Identities = 155/415 (37%), Positives = 241/415 (58%), Gaps = 20/415 (4%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKA-KVVIF 59
           +    +++DL+DI+  + L+RVD+NVP  +G + D  RI   +PTI  L ++ A K+++ 
Sbjct: 4   LGNKLSISDLKDIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGASKIILI 63

Query: 60  SHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENV 119
           SH GRP    ++  +L  V    + +L + +LF+NDC+G  +   I +  E  +IL EN+
Sbjct: 64  SHCGRPDGLRNEKYTLKPVAETLKGLLGEEVLFLNDCVGKEVEDKINAAKENSVILLENL 123

Query: 120 RFYSEEE---------------RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL 164
           RF+ EEE                +   F   L++  D +INDAF  +HRAH+S+ G+   
Sbjct: 124 RFHIEEEGKGVDANGNKVKANKEDVEKFQNDLTKLADVFINDAFGTAHRAHSSMVGVKLN 183

Query: 165 LPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMA 224
           + +     M+KEL          ++PL+AI+GG+KVS KI L+ NL+ KVD+++IGGGMA
Sbjct: 184 VKASGFL-MKKELEYFSKALENPQRPLLAILGGAKVSDKIQLIKNLLDKVDRMIIGGGMA 242

Query: 225 NSFL-VAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV 283
            +F  V   M +G SL     S  V +I  +AK    +I +P D  +A        T+ V
Sbjct: 243 YTFKKVLNNMKIGTSLFDEAGSKIVGEIMEKAKAKNVQIFLPVDFKIADNFDNNANTKFV 302

Query: 284 S-AQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAK 342
           +  + +P + + LD G K++E  K VI  ++TV+WNGP GVFE+  F + ++E  + V +
Sbjct: 303 TDEEGIPDNWMGLDAGPKSIENYKDVILTSKTVIWNGPQGVFEMPNFAKGSIECLNLVVE 362

Query: 343 LTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           +TK+   I+I GGGDT + +      NE ++VST GGA LE LEGK+LPG++ALS
Sbjct: 363 VTKKG-AITIVGGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLALS 416


>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa)
           [TaxId: 9823]}
          Length = 413

 Score =  320 bits (820), Expect = 1e-88
 Identities = 153/411 (37%), Positives = 228/411 (55%), Gaps = 22/411 (5%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAK-VVIFSHLGR 64
           T++ L +++G R ++RVD+NVP    ++ +  RI+  VP+I   ++  AK VV+ SHLGR
Sbjct: 4   TLDKL-NVKGKRVVMRVDFNVPMAAAQITNNARIKAAVPSIKFCLDDGAKSVVLMSHLGR 62

Query: 65  PQSKSDKDC-SLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           P      D  SL  V +  +S L K +LF+ DC+G  + ++ A  + G +IL EN+RF+ 
Sbjct: 63  PDGSPMPDKYSLQPVAAELKSALGKAVLFLKDCVGPAVEKACADPAAGSVILLENLRFHV 122

Query: 124 EEE---------------RNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSY 168
           EEE                    F   LS  GD Y+NDAF  +HRAH+S+ G+ +L    
Sbjct: 123 EEEGKGKDASGNKAAGEPAKIKAFRASLSALGDVYVNDAFGTAHRAHSSMVGV-NLPKKA 181

Query: 169 IGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFL 228
               M+KEL+   +     ++P +AI+GG+KV+ KI L+ N++ KV++++IGGGMA +FL
Sbjct: 182 GAFLMKKELNYFAAAAESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFL 241

Query: 229 -VAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIP-TQVVSAQ 286
            V   M +G SL        V  +  +A  +  +I +P D V A +        Q   A 
Sbjct: 242 KVLNNMEIGTSLFDEAGKKIVKNLMSKAAANGVKITLPVDFVTADKFDEQAKIGQATVAS 301

Query: 287 SVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKE 346
            +P   + LD G K+     + +A+A+ ++WNGP+GVFE E F + T  +   V K T  
Sbjct: 302 GIPAGWMGLDCGPKSSAKYSEAVARAKQIVWNGPVGVFEWEAFAQGTKALMDEVVKATS- 360

Query: 347 RRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           R  I+I GGGDT T  A     +  ++VST GGA LE LEGK LPG+ ALS
Sbjct: 361 RGCITIIGGGDTATCCAKWNTEDNVSHVSTGGGASLELLEGKVLPGVDALS 411


>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus
           [TaxId: 274]}
          Length = 390

 Score =  311 bits (797), Expect = 7e-86
 Identities = 157/395 (39%), Positives = 232/395 (58%), Gaps = 5/395 (1%)

Query: 4   LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLG 63
           +RT+ DL D +G R L+RVD+NVP  DGKV D TRI   +PT+  L+   A +V+ SHLG
Sbjct: 1   MRTLLDL-DPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHLG 59

Query: 64  RPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYS 123
           RP+    K  SL  V     + L +              +   +L  G ++L ENVRF  
Sbjct: 60  RPKGPDPKY-SLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEP 118

Query: 124 EEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESC 183
            EE+NDP+     +R G+ ++ DAF  +HRAHAS+ G++ LLP+Y G  M+KE+  L   
Sbjct: 119 GEEKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRL 178

Query: 184 FSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRD 243
             + ++P   ++GG+KVS KI ++ +L+ ++D+L+IGG MA +FL A G  VGRSL + D
Sbjct: 179 LKDPERPYAVVLGGAKVSDKIGVIESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEED 238

Query: 244 FSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVE 303
             D    +   A+     + +P DVV A  ++ G+ T+V  A+++P+  + LD+G KT E
Sbjct: 239 RLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVETRVFPARAIPVPYMGLDIGPKTRE 298

Query: 304 YIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALA 363
              + +  ARTV WNGP+GVFE+ PFD  T+ V   +A L       ++ GGGD++ A+ 
Sbjct: 299 AFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEG---AFTVVGGGDSVAAVN 355

Query: 364 HAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG 398
             G+   F +VST GGA LE+LE   LPG+  L G
Sbjct: 356 RLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLEG 390


>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei
           [TaxId: 5691]}
          Length = 415

 Score =  296 bits (759), Expect = 2e-81
 Identities = 139/414 (33%), Positives = 230/414 (55%), Gaps = 24/414 (5%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +++N+  D++G + L+RVD+NVP  +GK+ +  RI   +PT+ +++ +    V+ SHLGR
Sbjct: 3   KSINEC-DLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGR 61

Query: 65  PQSKS----------------DKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASL 108
           P+                    +  +L  V      +L + + F  DC+ +     ++ +
Sbjct: 62  PKGIPMAQAGKIRSTGGVPGFQQKATLKPVAKRLSELLLRPVTFAPDCLNAA--DVVSKM 119

Query: 109 SEGGIILAENVRFYSEEERND----PDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHL 164
           S G ++L ENVRFY EE            ++L+  GD YI+DAF  +HR  A++TG+  +
Sbjct: 120 SPGDVVLLENVRFYKEEGSKKAKDREAMAKILASYGDVYISDAFGTAHRDSATMTGIPKI 179

Query: 165 LPSYIGRAMQKELSMLESCF-SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGM 223
           L +     + ++     +       +PLVAIVGG+KVS KI LL N+++++D L+IGG M
Sbjct: 180 LGNGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGGAM 239

Query: 224 ANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVV 283
           A +FL AQG  +G+S C+    +    +  +A+    ++I+P D V   E K      + 
Sbjct: 240 AYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAVDSPLIT 299

Query: 284 SAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKL 343
             Q++P   + LD+G KT+E   Q I + ++ +WNGP+GVFE+ P+ + T  +A  + + 
Sbjct: 300 EDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRG 359

Query: 344 TKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           T E  ++SI GGGD+ +A   +G +   ++VST GGA LE LEGK LPG+  L 
Sbjct: 360 THEHGLMSIIGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLD 413


>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue
           {Nostoc punctiforme [TaxId: 272131]}
          Length = 302

 Score = 28.1 bits (61), Expect = 1.3
 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 2/55 (3%)

Query: 344 TKERRIISIAGGGDTITALAHAGISNEFT--YVSTAGGAFLEWLEGKDLPGIVAL 396
                I     G    TA+A      + T  YV T GG FL    G     +V L
Sbjct: 238 RSTTIIAQAEQGVIGSTAVAFGQTEGDCTAIYVVTNGGMFLPPPTGVVPANVVRL 292


>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas
           aeruginosa [TaxId: 287]}
          Length = 505

 Score = 27.8 bits (61), Expect = 1.5
 Identities = 22/129 (17%), Positives = 37/129 (28%), Gaps = 17/129 (13%)

Query: 249 HQIAWEAKRSACEIIVPRDVV------VAREMKTGI-PTQVVSAQSVPLDSIILDVGFKT 301
           +   W        +   RD+              G+   QV +   +P      D  +  
Sbjct: 326 NWPRWGNAEIVEVLEKQRDLYGYLHDQTLHLANQGVTIGQVHNRLRLPPSL---DQEWYD 382

Query: 302 VEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITA 361
             Y   V   AR V  N  LG ++  P           ++      R +   GG + +  
Sbjct: 383 RGYHGSVSHNARAV-LNRYLGYYDGNPAT------LDPLSPEDSAGRYVEYMGGAERLLE 435

Query: 362 LAHAGISNE 370
            A A  +  
Sbjct: 436 QARASYARG 444


>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor
           (AIF) {Human (Homo sapiens) [TaxId: 9606]}
          Length = 213

 Score = 26.6 bits (57), Expect = 3.6
 Identities = 12/44 (27%), Positives = 17/44 (38%), Gaps = 7/44 (15%)

Query: 212 KKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEA 255
             V  L+IGGG A            RS+  RD    V  ++ + 
Sbjct: 3   SHVPFLLIGGGTA-------AFAAARSIRARDPGARVLIVSEDP 39


>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar
           hydrolase), N-terminal domain {Escherichia coli [TaxId:
           562]}
          Length = 337

 Score = 25.7 bits (55), Expect = 7.2
 Identities = 12/72 (16%), Positives = 20/72 (27%)

Query: 328 PFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEG 387
           P     +E      +     + +      D I A  H G  +   + S A G        
Sbjct: 156 PEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARAL 215

Query: 388 KDLPGIVALSGH 399
                 + + GH
Sbjct: 216 PAGSLAMIVGGH 227


>d2gkpa1 d.351.1.1 (A:1-164) Hypothetical protein NMB0488 {Neisseria
           meningitidis [TaxId: 487]}
          Length = 164

 Score = 25.5 bits (56), Expect = 7.9
 Identities = 9/45 (20%), Positives = 15/45 (33%), Gaps = 5/45 (11%)

Query: 139 NGDFYINDAFSVSHRAHASITGLSHLLP-----SYIGRAMQKELS 178
           N    I   +S   R         H+LP       +G  + + L+
Sbjct: 16  NERALIIQTWSGFGRYAPDHLYPPHILPLDTDNETLGTTVLQALA 60


>d1f0la3 f.1.2.1 (A:201-380) Diphtheria toxin, middle domain
           {Corynebacterium diphtheriae [TaxId: 1717]}
          Length = 180

 Score = 25.5 bits (55), Expect = 7.9
 Identities = 8/30 (26%), Positives = 20/30 (66%)

Query: 280 TQVVSAQSVPLDSIILDVGFKTVEYIKQVI 309
           + ++ AQ++PL   ++D+GF    +++ +I
Sbjct: 136 SSLMVAQAIPLVGELVDIGFAAYNFVESII 165


>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima
           [TaxId: 2336]}
          Length = 252

 Score = 25.5 bits (55), Expect = 8.4
 Identities = 16/113 (14%), Positives = 32/113 (28%), Gaps = 5/113 (4%)

Query: 113 IILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFS---VSHRAHASITGLSHLLPSYI 169
           I+         E+        + +         +      +++    +I       P   
Sbjct: 124 ILCVGETLEEREKGLTFCVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQA 183

Query: 170 GRAMQKELSMLESCFSESKKPLVAIV-GGSKVSTKITLLINLVKKVDKLVIGG 221
                    +L   + E     + I+ GGS        LI   K +D  ++GG
Sbjct: 184 QEVHAFIRKLLSEMYDEETAGSIRILYGGSIKPDNFLGLIVQ-KDIDGGLVGG 235


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.321    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0415    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,453,230
Number of extensions: 67262
Number of successful extensions: 261
Number of sequences better than 10.0: 1
Number of HSP's gapped: 239
Number of HSP's successfully gapped: 17
Length of query: 400
Length of database: 2,407,596
Length adjustment: 87
Effective length of query: 313
Effective length of database: 1,213,086
Effective search space: 379695918
Effective search space used: 379695918
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)