HHsearch alignment for GI: 254780654 and conserved domain: COG0057

>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].
Probab=100.00  E-value=0  Score=856.58  Aligned_cols=330  Identities=57%  Similarity=0.903  Sum_probs=321.2

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             61898856686889999999968888728999606889999998875144125567408983653001656542110123
Q gi|254780654|r    2 VCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRD   81 (333)
Q Consensus         2 ~ikIgINGfGRIGR~v~R~~~~~~~~~i~ivaINd~~~~~~~~~Ll~yDS~hG~~~~~v~~~~~~l~in~~~i~i~~~~~   81 (333)
T Consensus         1 ~ikV~INGfGrIGR~v~ra~~~~~~-dieVVaInd~t~~~~~A~Llk~Ds~hg~f~~~v~~~~~~~~v~g~~I~v~~~~~   79 (335)
T COG0057           1 MIKVAINGFGRIGRLVARAALERDG-DIEVVAINDLTDPDYLAHLLKYDSVHGRFDGEVEVKDDALVVNGKGIKVLAERD   79 (335)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCC-CEEEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCEEEEEECCC
T ss_conf             9089994575788999999971789-759999936899789989986425578877732247874898995268873289


Q ss_pred             CCCCCCCC--CCEEEEECCCCCCCCCCCHHHHC-CCCEEEEECCCCCCCEEEEEECCCCCCCCCCEEECCCCCCHHHHHH
Q ss_conf             33334465--63278606643332122001105-8423433036788734898405532122221033057641023466
Q gi|254780654|r   82 PQDLPWGD--VDVAMECTGFFVTQEKASLHLSN-GSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVP  158 (333)
Q Consensus        82 p~~i~W~~--vDiViEcTG~f~~~~~~~~HL~~-GakkVIiSaP~kd~~~tiV~GvN~~~~~~~~~IiS~aSCTtn~laP  158 (333)
T Consensus        80 p~~l~w~d~gvdiVve~Tg~f~~~e~~~~hl~agGaKkV~isap~~~~~~~vv~gvn~~~~~~~~~iVsnaSCTTNcLap  159 (335)
T COG0057          80 PANLPWADLGVDIVVECTGKFTGREKAEKHLKAGGAKKVLISAPGKDDVATVVYGVNHNYYDAGHTIVSNASCTTNCLAP  159 (335)
T ss_pred             HHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEECCCCCCCCCCCEEEECCCHHHHHHH
T ss_conf             68798121286399989987666334799987459978998578988861799852513357888489874511300678


Q ss_pred             HHHHHHHCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             88875412102322100113453222355665453000112365646453112456777762017871043431233531
Q gi|254780654|r  159 VVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNV  238 (333)
Q Consensus       159 vlk~l~~~~gI~~g~~TTiH~~t~~Q~l~D~~~~d~Rr~Raa~~niIPt~Tgaa~ai~~vlP~l~gkl~g~a~RVPt~~v  238 (333)
T Consensus       160 ~~kvl~d~fGI~~g~mTtVh~~T~dQ~~~dgph~~~rr~raa~~niIp~sTgaAkav~~VlP~L~GKl~g~A~RVPt~~v  239 (335)
T COG0057         160 VAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPHKDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPTPNV  239 (335)
T ss_pred             HHHHHHHHCCEEEEEEEEEECCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEEECCCCCC
T ss_conf             79999886094599999997015987444476522010012347777578742331766470457845568999058872


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEEEEECCCEEEECCCCCCCCEEEECCCCEEECCCEEEEEEEECCCHHH
Q ss_conf             01123433201220678899998741000048574225873544348878621683268464289779999983871467
Q gi|254780654|r  239 SMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGF  318 (333)
Q Consensus       239 S~vDlt~~l~k~~t~e~in~~~~~as~~~~~~il~~~~~~lVS~D~ig~~~s~i~D~~~t~v~~~~~~Ki~~WYDNEwgY  318 (333)
T Consensus       240 s~~dl~v~l~k~~t~eeIn~alk~as~~~lkg~~~y~e~~~Vs~D~~~~~~ssI~d~~~t~~~~~~~vk~~~wydNE~gy  319 (335)
T COG0057         240 SVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNEWGY  319 (335)
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCEEEEECCCEEEECCCEEEEEEEEECCCCC
T ss_conf             79999999688788999999999864026542362464130266568994416897675687067489999999154322


Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999997504
Q gi|254780654|r  319 SNRMLDTASAMANL  332 (333)
Q Consensus       319 s~rlidl~~~ia~~  332 (333)
T Consensus       320 s~r~vD~~~~~~~~  333 (335)
T COG0057         320 SNRVVDLLAMVAKA  333 (335)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             57789999998641