HHsearch alignment for GI: 254780654 and conserved domain: COG0136

>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism].
Probab=99.69  E-value=1.3e-15  Score=122.60  Aligned_cols=296  Identities=20%  Similarity=0.206  Sum_probs=206.6

Q ss_pred             CEEEEEEC-CCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEECC-CCCCCCCCCCCCCC
Q ss_conf             61898856-68688999999996888872899960688999999887514412556740898365-30016565421101
Q gi|254780654|r    2 VCKVAING-FGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGD-TIDVGLGPIQVTSI   79 (333)
Q Consensus         2 ~ikIgING-fGRIGR~v~R~~~~~~~~~i~ivaINd~~~~~~~~~Ll~yDS~hG~~~~~v~~~~~-~l~in~~~i~i~~~   79 (333)
T Consensus         1 ~~~VavvGATG~VG~~~~~~L~e~-~f~~~~~~~~A----------------------S~rSaG~~~~~f~~~~~~v~-~   56 (334)
T COG0136           1 KLNVAVLGATGAVGQVLLELLEER-HFPFEELVLLA----------------------SARSAGKKYIEFGGKSIGVP-E   56 (334)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHC-CCCCCEEEEEE----------------------CCCCCCCCCCCCCCCCCCCC-C
T ss_conf             918999942355899999998753-99840578885----------------------23115771601067503576-2


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCCCHHHHCCCCEEEEECCC----CCCCEEEEEECCCCCCCCC--CE-EECCCCCC
Q ss_conf             23333344656327860664333212200110584234330367----8873489840553212222--10-33057641
Q gi|254780654|r   80 RDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPC----KGVKKTIVYGVNHQSLNKE--DK-VVSNASCT  152 (333)
Q Consensus        80 ~~p~~i~W~~vDiViEcTG~f~~~~~~~~HL~~GakkVIiSaP~----kd~~~tiV~GvN~~~~~~~--~~-IiS~aSCT  152 (333)
T Consensus        57 ~~~~~~~~~~~Divf~~ag~~~s~~~~p~~~~~G--~~VIdnsSa~Rm~~DVPLVVPeVN~~~l~~~~~rg~IianpNCs  134 (334)
T COG0136          57 DAADEFVFSDVDIVFFAAGGSVSKEVEPKAAEAG--CVVIDNSSAFRMDPDVPLVVPEVNPEHLIDYQKRGFIIANPNCS  134 (334)
T ss_pred             CCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHCC--CEEEECCCCCCCCCCCCEECCCCCHHHHHHHHHCCCEEECCCHH
T ss_conf             1134100124999999176687899999999769--88996873111589987765886989997454179789889718


Q ss_pred             HHHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCC-----CCC-------CCCCCCCCCCCCCCCCCCCCCH----------
Q ss_conf             023466888754121023221001134532223-----556-------6545300011236564645311----------
Q gi|254780654|r  153 TNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQH-----VLD-------AGHSDLYRSRAAAISMVPTSTG----------  210 (333)
Q Consensus       153 tn~laPvlk~l~~~~gI~~g~~TTiH~~t~~Q~-----l~D-------~~~~d~Rr~Raa~~niIPt~Tg----------  210 (333)
T Consensus       135 t~~l~~aL~PL~~~~~i~~v~VsTyQAvSGAG~~~~~el~~q~~~~~~~~~i~~~-~~~iAfNviP~I~~~~~ng~t~EE  213 (334)
T COG0136         135 TIQLVLALKPLHDAFGIKRVVVSTYQAVSGAGAEGGVELAGQTDALLNGIPILPI-GYPLAFNVIPHIDGFLDNGYTKEE  213 (334)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEEEEHHHHCCCCCHHHHHHHHHHHCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             9999998898875138108999975011226810156689887431367655665-664333101357764557751899


Q ss_pred             --HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEEEEEC-CCEEEECCCCC
Q ss_conf             --245677776201787104343123353101123433201220678899998741000048574225-87354434887
Q gi|254780654|r  211 --AAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVT-LPLVSVDFNHT  287 (333)
Q Consensus       211 --aa~ai~~vlP~l~gkl~g~a~RVPt~~vS~vDlt~~l~k~~t~e~in~~~~~as~~~~~~il~~~~-~~lVS~D~ig~  287 (333)
T Consensus       214 ~K~~~Et~KIlg~~~~~VsatcvRVPV~~GHse~v~ve~~~~~~~~e~~~~~l~~a--p~v~v~~~~~~~P~~~~d~~g~  291 (334)
T COG0136         214 WKIEAETRKILGDPDIKVSATCVRVPVFYGHSEAVTVEFKKDVDPEEIREELLPSA--PGVVVVDNPEDRPQTPLDATGG  291 (334)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEEECCEECCCCEEEEEEECCCCCHHHHHHHHHCCC--CCCEEEECCCCCCCCHHHHCCC
T ss_conf             99889999871889882578999724161520678998569899899999975318--9968986776686583663489


Q ss_pred             CCCEEEECCCCEE-ECCCEEEEEEEECCC-HHHHHHHHHHHHH
Q ss_conf             8621683268464-289779999983871-4679999999999
Q gi|254780654|r  288 SYSSIFAADQTKV-VSQNLLRVLVWYDNE-WGFSNRMLDTASA  328 (333)
Q Consensus       288 ~~s~i~D~~~t~v-~~~~~~Ki~~WYDNE-wgYs~rlidl~~~  328 (333)
T Consensus       292 ~~v~V--GRiR~d~~~~~~l~~~~v~dNl~~GAA~~av~iaE~  332 (334)
T COG0136         292 DEVSV--GRIRKDLSGPEGLKLWVVGDNLRKGAALNAVLIAEL  332 (334)
T ss_pred             CCEEE--EEEEECCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
T ss_conf             85577--676634788874799998601135118899999886