RPSBLAST alignment for GI: 254780654 and conserved domain: PLN02358

>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase. Length = 338
 Score =  266 bits (682), Expect = 4e-72
 Identities = 149/333 (44%), Positives = 211/333 (63%), Gaps = 9/333 (2%)

Query: 4   KVAINGFGRIGRCILRAAVESRRDDVRIVAIND-LNSIETMAHLLRYDSVHGRFP-GEVK 61
           ++ INGFGRIGR + R  ++  RDDV +VA+ND   + E M ++ +YDSVHG++   E+K
Sbjct: 7   RIGINGFGRIGRLVARVVLQ--RDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query: 62  IIGD-TIDVGLGPIQVTSIRDPQDLPWGDV--DVAMECTGFFVTQEKASLHLSNGSQRVL 118
           +  D T+  G  P+ V  IR+P+D+PWG+   D  +E TG F  ++KA+ HL  G+++V+
Sbjct: 65  VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query: 119 VSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVH 178
           +SAP K     +V GVN      +  +VSNASCTTNCL P+  V++  FGI +G MTTVH
Sbjct: 125 ISAPSKDAPMFVV-GVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVH 183

Query: 179 SYTGDQHVLDAGHSDLYRS-RAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPN 237
           S T  Q  +D      +R  RAA+ +++P+STGAAKAV  VLP+L GKL G S RVPT +
Sbjct: 184 SITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVD 243

Query: 238 VSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQ 297
           VS+VDL     +    DEI   +K  +EG LK ILGY    +VS DF   + SSIF A  
Sbjct: 244 VSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKA 303

Query: 298 TKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMA 330
              +S   ++++ WYDNEWG+S+R++D    M+
Sbjct: 304 GIALSDKFVKLVSWYDNEWGYSSRVVDLIVHMS 336