RPSBLAST alignment of GI: 254780654 and protein with PDBid: 2b4r

>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, protein structure initiative, GAPDH, oxidoreductase; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345
 Score =  400 bits (1028), Expect = e-112
 Identities = 151/336 (44%), Positives = 203/336 (60%), Gaps = 8/336 (2%)

Query: 1   MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAIND-LNSIETMAHLLRYDSVHGRFPGE 59
              K+ INGFGRIGR + RAA    R D+ +VAIND    +  + +LL+YDSVHG+FP E
Sbjct: 10  AATKLGINGFGRIGRLVFRAAFG--RKDIEVVAINDPFMDLNHLCYLLKYDSVHGQFPCE 67

Query: 60  VKIIGDTIDVGLGPIQVTSIRDPQDLPWGD--VDVAMECTGFFVTQEKASLHLSNGSQRV 117
           V      + +G   + V + +DP  +PWG   VDV  E TG F+T+E AS HL  G+++V
Sbjct: 68  VTHADGFLLIGEKKVSVFAEKDPSQIPWGKCQVDVVCESTGVFLTKELASSHLKGGAKKV 127

Query: 118 LVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTV 177
           ++SAP K      V G+NH   + +  +VSNASCTTNCL P+  V++  FGI +G MTTV
Sbjct: 128 IMSAPPKDDTPIYVMGINHHQYDTKQLIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTV 187

Query: 178 HSYTGDQHVLDAGH---SDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVP 234
           H+ T +Q V+D       D    R A  +++P STGAAKAV  VLP L GKL G + RVP
Sbjct: 188 HASTANQLVVDGPSKGGKDWRAGRCALSNIIPASTGAAKAVGKVLPELNGKLTGVAFRVP 247

Query: 235 TPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFA 294
              VS+VDL C   +    +E+   +K  AEG LK ILGY    +VS DF H + SSIF 
Sbjct: 248 IGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGPLKGILGYTEDEVVSQDFVHDNRSSIFD 307

Query: 295 ADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMA 330
                 ++ N  +++ WYDNEWG+SNR+LD A  + 
Sbjct: 308 MKAGLALNDNFFKLVSWYDNEWGYSNRVLDLAVHIT 343