RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780657|ref|YP_003065070.1| hypothetical protein CLIBASIA_02720 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) >1sbq_A H91_ORF164, 5,10-methenyltetrahydrofolate synthetase homolog; MTHFS, 5- formyltetrahydrofolate cyclo-ligase, structural genomics; 2.20A {Mycoplasma pneumoniae} (A:) Length = 189 Score = 26.1 bits (57), Expect = 1.9 Identities = 7/35 (20%), Positives = 12/35 (34%) Query: 1 MTPREHKNLIRKKKMIARNLLSPAYRHMKSISLAD 35 KN +RK+ + R LS + + Sbjct: 22 FQGHMDKNALRKQILQKRMALSTIEKSHLDQKINQ 56 >3hy3_A 5-formyltetrahydrofolate cyclo-ligase; antifolate, cancer, acetylation, ATP-binding, cytoplasm, folate-binding, magnesium, nucleotide-binding; HET: 10F; 1.80A {Homo sapiens} PDB: 3hxt_A* 3hy4_A* 3hy6_A (A:) Length = 203 Score = 25.1 bits (54), Expect = 3.4 Identities = 6/34 (17%), Positives = 11/34 (32%) Query: 2 TPREHKNLIRKKKMIARNLLSPAYRHMKSISLAD 35 K +R + +S R +S L+ Sbjct: 5 AVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQ 38 >2jcb_A 5-formyltetrahydrofolate cyclo-ligase family protein; 10- methenyltetrahydrofolate synthetase, MTHFS, folate metabolism, structural genomics; HET: ADP; 1.6A {Bacillus anthracis} (A:) Length = 200 Score = 25.0 bits (54), Expect = 4.1 Identities = 9/34 (26%), Positives = 13/34 (38%) Query: 2 TPREHKNLIRKKKMIARNLLSPAYRHMKSISLAD 35 RE K +RK+ + N LS S + Sbjct: 8 HVREEKLRLRKQIIEHMNSLSKERYTTLSEQIVF 41 >1sou_A 5,10-methenyltetrahydrofolate synthetase; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Aquifex aeolicus} (A:) Length = 194 Score = 23.5 bits (50), Expect = 9.8 Identities = 9/29 (31%), Positives = 13/29 (44%) Query: 7 KNLIRKKKMIARNLLSPAYRHMKSISLAD 35 K+ +RKK + R LS R S + Sbjct: 3 KSELRKKVLHKRINLSEEERRRLSEKVIS 31 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.132 0.370 Gapped Lambda K H 0.267 0.0516 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 414,454 Number of extensions: 13463 Number of successful extensions: 28 Number of sequences better than 10.0: 1 Number of HSP's gapped: 28 Number of HSP's successfully gapped: 7 Length of query: 61 Length of database: 4,956,049 Length adjustment: 30 Effective length of query: 31 Effective length of database: 3,941,899 Effective search space: 122198869 Effective search space used: 122198869 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.5 bits)