BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780657|ref|YP_003065070.1| hypothetical protein CLIBASIA_02720 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780657|ref|YP_003065070.1| hypothetical protein CLIBASIA_02720 [Candidatus Liberibacter asiaticus str. psy62] Length = 61 Score = 121 bits (304), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 61/61 (100%), Positives = 61/61 (100%) Query: 1 MTPREHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPLEKKKPKSQLFILCNRKS 60 MTPREHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPLEKKKPKSQLFILCNRKS Sbjct: 1 MTPREHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPLEKKKPKSQLFILCNRKS 60 Query: 61 M 61 M Sbjct: 61 M 61 >gi|254780591|ref|YP_003065004.1| aminomethyltransferase protein (glycine cleavage) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 21.9 bits (45), Expect = 1.9, Method: Composition-based stats. Identities = 7/12 (58%), Positives = 11/12 (91%) Query: 5 EHKNLIRKKKMI 16 +H+N+IRK+ MI Sbjct: 195 QHRNIIRKRPMI 206 >gi|254780245|ref|YP_003064658.1| 50S ribosomal protein L18 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 20.0 bits (40), Expect = 7.1, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Query: 12 KKKMIARNLLSPAYRHMKSIS 32 KKK++AR + S RH+KS+S Sbjct: 4 KKKVLARRI-SRIRRHLKSVS 23 >gi|254780282|ref|YP_003064695.1| putative transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 299 Score = 20.0 bits (40), Expect = 8.0, Method: Compositional matrix adjust. Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 25 YRHMKSISLADLGAK 39 YRH + ++L + G+K Sbjct: 51 YRHARGLTLTEQGSK 65 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.132 0.370 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,424 Number of Sequences: 1233 Number of extensions: 1019 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 61 length of database: 328,796 effective HSP length: 33 effective length of query: 28 effective length of database: 288,107 effective search space: 8066996 effective search space used: 8066996 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 31 (16.5 bits)