RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780658|ref|YP_003065071.1| 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liberibacter asiaticus str. psy62] (113 letters) >gnl|CDD|30561 COG0212, COG0212, 5-formyltetrahydrofolate cyclo-ligase [Coenzyme metabolism]. Length = 191 Score = 89.6 bits (222), Expect = 2e-19 Identities = 42/111 (37%), Positives = 64/111 (57%), Gaps = 7/111 (6%) Query: 1 MIFRQY--ENPTDLVKSAVGTLSPPSYAKEMSP---DLILMPLIAFDLKGNRIGYGRGYY 55 ++F +Y + L+K+ G L P Y +++ P DL+L+PL+AFD +G R+GYG GYY Sbjct: 83 LLFLRYIPDPLQPLIKNRFGILEPGEYGRKIPPPEIDLVLVPLVAFDKQGYRLGYGGGYY 142 Query: 56 DRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFS 106 DR +A L G+ +GIA+D Q + E D+ L AI+TE + Sbjct: 143 DRYLA--NLRGRKTPTVGIAYDCQLVDHLPREPHDVPLDAIVTEEGVIRCL 191 >gnl|CDD|110784 pfam01812, 5-FTHF_cyc-lig, 5-formyltetrahydrofolate cyclo-ligase family. 5-formyltetrahydrofolate cyclo-ligase or methenyl-THF synthetase EC:6.3.3.2 catalyses the interchange of 5-formyltetrahydrofolate (5-FTHF) to 5-10-methenyltetrahydrofolate, this requires ATP and Mg2+. 5-FTHF is used in chemotherapy where it is clinically known as Leucovorin. Length = 182 Score = 87.4 bits (217), Expect = 8e-19 Identities = 35/101 (34%), Positives = 50/101 (49%), Gaps = 6/101 (5%) Query: 3 FRQYENPTDLVKSAVGTLSPPSYAKEMSP----DLILMPLIAFDLKGNRIGYGRGYYDRA 58 Y T L G P + DL+L+P +AFD +G R+G G GYYDR Sbjct: 84 ITPYYPETGLPSGPYGLPEPIEEEQRELALNQIDLVLVPGVAFDRQGYRLGRGGGYYDRY 143 Query: 59 IADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTE 99 +A RL+G P +G+A+D Q + E D+ + I+TE Sbjct: 144 LA--RLQGHGPLTVGLAYDEQLVERLPQEPHDVPVDEIVTE 182 >gnl|CDD|38303 KOG3093, KOG3093, KOG3093, 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism]. Length = 200 Score = 67.6 bits (165), Expect = 6e-13 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Query: 32 DLILMPLIAFDLKGNRIGYGRGYYDRAIA--DIRLEGKNPYLLGIAFDMQETSCIQAEAT 89 DLI++P +AFD KG R+G+G+GYYD + I + P L+G+ Q S I E Sbjct: 130 DLIIVPGVAFDRKGARLGHGKGYYDDFLKRYQIHAPEQKPLLVGLCLKEQILSEIPVEEH 189 Query: 90 DIRLHAILTES 100 D++L A++TE Sbjct: 190 DVKLDAVVTED 200 >gnl|CDD|39611 KOG4410, KOG4410, KOG4410, 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism]. Length = 396 Score = 28.9 bits (64), Expect = 0.36 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 6/76 (7%) Query: 32 DLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEG---KNPYLLGIAFDMQETSCIQAEA 88 DL+++ +A +G RIG G G+ D + G ++ I D Q I E Sbjct: 159 DLVVIGSVAVSREGYRIGKGEGFADLEYGMLIEMGAITPKTPVVTIVHDCQVVDSIPPEL 218 Query: 89 T---DIRLHAILTESR 101 D + I T +R Sbjct: 219 FQKHDTPVDIIATPTR 234 >gnl|CDD|34072 COG4354, COG4354, Predicted bile acid beta-glucosidase [Carbohydrate transport and metabolism]. Length = 721 Score = 28.4 bits (63), Expect = 0.45 Identities = 17/87 (19%), Positives = 27/87 (31%), Gaps = 26/87 (29%) Query: 14 KSAVGTLSPPSYAKEMSPDLILM--------------------------PLIAFDLKGNR 47 K GT P+ K++ PD +L+ L FD + Sbjct: 428 KPIYGTYQDPNLWKDLGPDFVLLVYRDFKFTNDREFLKEVYPVIVEAIDWLKRFDQDNDG 487 Query: 48 IGYGRGYYDRAIADIRLEGKNPYLLGI 74 I G D R++G + Y + Sbjct: 488 IPENSGAMDNTFDATRIQGHSSYCGSL 514 >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Length = 258 Score = 25.5 bits (57), Expect = 3.3 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Query: 2 IFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLI 34 I + + DL K+ VGT P Y +SP+L Sbjct: 149 ISKVLSSTVDLAKTVVGT---PYY---LSPELC 175 >gnl|CDD|144162 pfam00463, ICL, Isocitrate lyase family. Length = 526 Score = 24.5 bits (53), Expect = 7.1 Identities = 13/49 (26%), Positives = 21/49 (42%) Query: 21 SPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNP 69 S S + E PDL P+ K + + + ++DR + RLE Sbjct: 90 STASTSNEPGPDLADYPMDTVPNKVEHLFFAQLFHDRKQREERLEMPKE 138 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0712 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,388,506 Number of extensions: 66752 Number of successful extensions: 129 Number of sequences better than 10.0: 1 Number of HSP's gapped: 127 Number of HSP's successfully gapped: 10 Length of query: 113 Length of database: 6,263,737 Length adjustment: 79 Effective length of query: 34 Effective length of database: 4,556,626 Effective search space: 154925284 Effective search space used: 154925284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.5 bits)