HHsearch alignment of GI: 254780659 and MMDB domain: 2z06_A_

>2z06_A (A:) Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus HB8}
Probab=99.97  E-value=5.3e-27  Score=195.45  Aligned_cols=250  Identities=43%  Similarity=0.733  Sum_probs=235.9

Q ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEECCEECCCCCCCCHHHHHHHHHCCCCEEEECHHHHCCCCHHHHHH
Q ss_conf             92699972027688999999808988860998999917004788678999999998379989993426530222047542
Q gi|254780659|r    1 MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQ   80 (274)
Q Consensus         1 MkiLfiGDIvG~~Gr~~v~~~Lp~l~~~~~~DfvIaNgENaa~G~Git~~~~~~l~~~GvDviT~GNH~wd~kei~~~i~   80 (274)
                      ||||+++|+-|+.|...+.+.+.+++++.  |.+|+|+++...|.+.....++.|.++|.|++|.|||=|+......+.+
T Consensus         1 l~il~~sDiH~~~~~~~~~~~i~~~~~~~--~~li~~~GD~~~~~~~~~~~~~~l~~~~~d~~~~GNHe~~~~~~~~~~~   78 (252)
T 2z06_A            1 MRVLFIGDVMAEPGLRAVGLHLPDIRDRY--DLVIANGENAARGKGLDRRSYRLLREAGVDLVSLGNHAWDHKEVYALLE   78 (252)
T ss_dssp             CEEEEECCBCHHHHHHHHHHHHHHHGGGC--SEEEEECTTTTTTSSCCHHHHHHHHHHTCCEEECCTTTTSCTTHHHHHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHC--CEEEEEEECCCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCHHHHHHHC
T ss_conf             94999953689889999998767778528--8899963137888389999999999707978974750124445566640


Q ss_pred             HCCCEEEECCCCCCCCCCCEEEEECCCCCEEEEEEEEHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCHHH
Q ss_conf             18938975007988875407999848992899999600005883325989999999863413689988999625762289
Q gi|254780659|r   81 RHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSE  160 (274)
Q Consensus        81 ~~~~ilRP~N~p~~~PG~G~~i~~~~~g~ki~Vinl~Gr~fM~~~~d~PF~~~d~~l~~~~~~~~~~~i~VDfHaEaTSE  160 (274)
                      ... .++++|+.....+..+.+++. +|.++.++......+..+ .+.+.+.++.++++    .+++.++|-.|.--+.+
T Consensus        79 ~~~-~~~~~nv~~~~~~~~~~~~~~-~g~~i~~~~~~~~~~~~~-~~~~~~~~~~~~~~----~~~d~iIvl~H~g~~~~  151 (252)
T 2z06_A           79 SEP-VVRPLNYPPGTPGKGFWRLEV-GGESLLFVQVMGRIFMDP-LDDPFRALDRLLEE----EKADYVLVEVHAEATSE  151 (252)
T ss_dssp             HSS-EECCTTSCSSCSSCSEEEEEE-TTEEEEEEEEECCTTSCC-CCCHHHHHHHHHHH----CCCSEEEEEEECSCHHH
T ss_pred             CCC-CCCHHHCCCCCCCCCEEEECC-CCCEEEEEEEECCCCCCC-CCCHHHHHHHHHHH----CCCCEEEEECCCCHHHH
T ss_conf             263-235433257887773799904-991689888403136787-78989999999861----67866999835521543


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCHHHHCCCCEEEEECCCCCCCHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEE
Q ss_conf             99999760895779980697624654564036728984056013712103547467898885168865411157871999
Q gi|254780659|r  161 KQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLC  240 (274)
Q Consensus       161 K~A~g~~lDGrVsaVvGTHTHV~TaD~rILp~GTayiTDvGMtG~~~SVIG~~~~~~i~rf~t~~p~~r~~~a~g~~~l~  240 (274)
                      ...+..+++..+.+|+|.|||+++.++++.+++..|++..|+.|.+-+.+.++.+....++.+.+|. ++..++++..+.
T Consensus       152 ~~~~~~~~~~giDlvl~GH~H~~~~~~~~~~~~~~~iv~~g~~g~~~g~~~l~~~~~~~~~~~~~~~-~~~~~~~~~~~~  230 (252)
T 2z06_A          152 KMALAHYLDGRASAVLGTHTHVPTLDATRLPKGTLYQTDVGMTGTYHSIIGGEVETFLARFLTGRPQ-PFRAAQGKARFH  230 (252)
T ss_dssp             HHHHHHHHBTTBSEEEEESSCSCBSCCEECTTSCEEESCCCCBEESSSBTTBCHHHHHHHHHHCSCC-CCCBCCSCEEEE
T ss_pred             HEEEEEECCCCEEEEEECCCCCCCCCCEEECCCCEEEECCCCCCCHHHHCCCCHHHHHHHHHHCCCC-CCCCCCCCCEEE
T ss_conf             3212476079789997167545565446822770898058653266774077758999999718998-763579986999


Q ss_pred             EEEEEEECCCCCEEEEEEEEEC
Q ss_conf             9999984799867467899876
Q gi|254780659|r  241 GICAEISDVTGLAEKIAPIRIG  262 (274)
Q Consensus       241 gv~ieid~~tG~a~~I~ri~ig  262 (274)
                      +++.+++.  .++..++++++.
T Consensus       231 ~~~~~~~~--~~~~~~~~~~i~  250 (252)
T 2z06_A          231 ATELVFEG--GRPVAISPYVWE  250 (252)
T ss_dssp             EEEEEEET--TEEEEEEEEEEE
T ss_pred             EEEEECCC--CCEEEEEEEEEC
T ss_conf             99999589--978778999727